Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L11814g1576155278890.0
YER166W (DNF1)1571157359380.0
Scas_576.81591158458820.0
YDR093W (DNF2)1612151156070.0
Scas_636.161554155155850.0
CAGL0G08085g1578156952130.0
KLLA0C17644g1576146450670.0
AGR120C1547146148870.0
Kwal_26.70701315107517650.0
CAGL0G06270g1328104217540.0
KLLA0A04015g1343104217370.0
YAL026C (DRS2)1355104217000.0
ADR350W1311106916470.0
YIL048W (NEO1)115110139041e-101
ADL079C11669659041e-101
Sklu_2193.111438658921e-99
Scas_704.3811618658859e-99
CAGL0L00715g11448668681e-96
Kwal_23.578911338638644e-96
Kwal_56.234672803017561e-90
KLLA0C08393g11489008167e-90
KLLA0E01650g15505428101e-87
CAGL0H04477g16265458082e-87
YMR162C (DNF3)16565477895e-85
Kwal_23.355615976387797e-84
AFL191W15755367636e-82
Scas_669.316386277593e-81
Scas_505.410254445862e-61
Scas_89.12712904042e-43
CAGL0M11308g14523231852e-13
Kwal_26.920714693231834e-13
Scas_665.3014393331772e-12
AFR567W14493241692e-11
CAGL0L01419g12143321549e-10
AFR354C12103231531e-09
CAGL0A00517g11229011502e-09
Kwal_47.1754712406501493e-09
YEL031W (SPF1)12153241476e-09
KLLA0B08217g14393301468e-09
YOR291W14723331469e-09
KLLA0A08910g12806451361e-07
KLLA0E22352g12063121352e-07
YGL006W (PMC1)11731901272e-06
CAGL0I04312g9512711262e-06
YDR040C (ENA1)10918911262e-06
YDR039C (ENA2)10918911226e-06
YDR038C (ENA5)10918911217e-06
Scas_583.14*8753361153e-05
AFL011W12421911136e-05
AEL301W9571701082e-04
KLLA0F20658g1082426960.007
KLLA0E14630g1082668950.007
CAGL0J01870g946325910.021
Scas_707.48*741269910.025
Scas_297.180069870.062
Kwal_23.31601100410870.069
Scas_710.4190454840.14
CAGL0A00495g90254840.17
Scas_688.191354830.18
YPL036W (PMA2)94754820.24
YGL008C (PMA1)91854820.26
CAGL0K12034g1087655820.29
YGL167C (PMR1)950270810.30
AGL085C90954790.53
KLLA0A03157g938174790.54
Kwal_47.1752289954780.82
KLLA0A09031g89954780.84
KLLA0D04092g115265761.5
AGL041C123373742.2
YJL103C618100742.3
AFR269W101864732.8
AGL097C1096124733.2
Kwal_14.1498939167724.0
KLLA0F07447g975231724.1
KLLA0F17523g85764707.4
KLLA0E20933g71045698.8
Kwal_26.793159561689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L11814g
         (1552 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...  3043   0.0  
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...  2291   0.0  
Scas_576.8                                                           2270   0.0  
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...  2164   0.0  
Scas_636.16                                                          2155   0.0  
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...  2012   0.0  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...  1956   0.0  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...  1887   0.0  
Kwal_26.7070                                                          684   0.0  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   680   0.0  
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   673   0.0  
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   659   0.0  
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   639   0.0  
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   352   e-101
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   352   e-101
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         348   e-99 
Scas_704.38                                                           345   9e-99
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...   338   1e-96
Kwal_23.5789                                                          337   4e-96
Kwal_56.23467                                                         295   1e-90
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...   318   7e-90
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   316   1e-87
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   315   2e-87
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   308   5e-85
Kwal_23.3556                                                          304   7e-84
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   298   6e-82
Scas_669.3                                                            296   3e-81
Scas_505.4                                                            230   2e-61
Scas_89.1                                                             160   2e-43
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    76   2e-13
Kwal_26.9207                                                           75   4e-13
Scas_665.30                                                            73   2e-12
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    70   2e-11
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    64   9e-10
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    64   1e-09
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    62   2e-09
Kwal_47.17547                                                          62   3e-09
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    61   6e-09
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    61   8e-09
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    61   9e-09
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    57   1e-07
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    57   2e-07
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    54   2e-06
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    53   2e-06
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    53   2e-06
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    52   6e-06
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    51   7e-06
Scas_583.14*                                                           49   3e-05
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    48   6e-05
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    46   2e-04
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    42   0.007
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    41   0.007
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    40   0.021
Scas_707.48*                                                           40   0.025
Scas_297.1                                                             38   0.062
Kwal_23.3160                                                           38   0.069
Scas_710.41                                                            37   0.14 
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    37   0.17 
Scas_688.1                                                             37   0.18 
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    36   0.24 
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    36   0.26 
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    36   0.29 
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    36   0.30 
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    35   0.53 
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    35   0.54 
Kwal_47.17522                                                          35   0.82 
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    35   0.84 
KLLA0D04092g complement(344666..348124) some similarities with s...    34   1.5  
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    33   2.2  
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    33   2.3  
AFR269W [3461] [Homologous to ScYGL241W (KAP114) - SH] complemen...    33   2.8  
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    33   3.2  
Kwal_14.1498                                                           32   4.0  
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    32   4.1  
KLLA0F17523g join(complement(1609428..1609446), similar to sp|P3...    32   7.4  
KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042 Saccha...    31   8.8  
Kwal_26.7931                                                           31   9.4  

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 3043 bits (7889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1479/1552 (95%), Positives = 1479/1552 (95%)

Query: 1    MSGSNKPGNGDFITSPFDDAFEFEEXXXXXXXXXXXXXXXXXXXXXXXDGHKMEEKETTL 60
            MSGSNKPGNGDFITSPFDDAFEFEE                       DGHKMEEKETTL
Sbjct: 1    MSGSNKPGNGDFITSPFDDAFEFEEGDNTVNNSSSNGNGHTSGSGNWNDGHKMEEKETTL 60

Query: 61   ADDTDIEISSIQPTPHLGGAKTGMFXXXXXXXXXXXXSSREMKRLRMGTRRVKGHKSQFG 120
            ADDTDIEISSIQPTPHLGGAKTGMF            SSREMKRLRMGTRRVKGHKSQFG
Sbjct: 61   ADDTDIEISSIQPTPHLGGAKTGMFDDVALDNDDHNDSSREMKRLRMGTRRVKGHKSQFG 120

Query: 121  NMSRNKTLKWAKKNIKNPFDDFSRDEEEENDRSTNRADQLRTVYHNLPLPEEMLDEEGNP 180
            NMSRNKTLKWAKKNIKNPFDDFSRDEEEENDRSTNRADQLRTVYHNLPLPEEMLDEEGNP
Sbjct: 121  NMSRNKTLKWAKKNIKNPFDDFSRDEEEENDRSTNRADQLRTVYHNLPLPEEMLDEEGNP 180

Query: 181  IMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPL 240
            IMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPL
Sbjct: 181  IMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPL 240

Query: 241  IVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEGXXXXXXXXXXXXLWRRFKKANSRLL 300
            IVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEG            LWRRFKKANSRLL
Sbjct: 241  IVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEGVVNENVSVDNVSLWRRFKKANSRLL 300

Query: 301  MQFIQWCKERMTEDGXXXXXXXXXXXXXXSTRNGHGPRNSLDSMDSYRPSADYYNRPSLD 360
            MQFIQWCKERMTEDG              STRNGHGPRNSLDSMDSYRPSADYYNRPSLD
Sbjct: 301  MQFIQWCKERMTEDGKRRRLQRQRRKLRKSTRNGHGPRNSLDSMDSYRPSADYYNRPSLD 360

Query: 361  YDNMGHXXXXXXXXXXXXRTLPPRTDTRFARDYWKSVKVGDIVRIHNNDEIPADIILLST 420
            YDNMGH            RTLPPRTDTRFARDYWKSVKVGDIVRIHNNDEIPADIILLST
Sbjct: 361  YDNMGHIVGEDEDVDIIDRTLPPRTDTRFARDYWKSVKVGDIVRIHNNDEIPADIILLST 420

Query: 421  SDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDIARTRFWIESEGPHANLYSYQGN 480
            SDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDIARTRFWIESEGPHANLYSYQGN
Sbjct: 421  SDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDIARTRFWIESEGPHANLYSYQGN 480

Query: 481  LKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSR 540
            LKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSR
Sbjct: 481  LKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSR 540

Query: 541  ISRELNFSVLINFLVLFILCFISGLANGIDYDKHPRSRDFFEFGTVAGNPATNGFVSFWV 600
            ISRELNFSVLINFLVLFILCFISGLANGIDYDKHPRSRDFFEFGTVAGNPATNGFVSFWV
Sbjct: 541  ISRELNFSVLINFLVLFILCFISGLANGIDYDKHPRSRDFFEFGTVAGNPATNGFVSFWV 600

Query: 601  AVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYI 660
            AVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYI
Sbjct: 601  AVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYI 660

Query: 661  FSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEAEGRREKEEIAKDRD 720
            FSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEAEGRREKEEIAKDRD
Sbjct: 661  FSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEAEGRREKEEIAKDRD 720

Query: 721  VMINDLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKKCCEHFMLALALCHSVLTEP 780
            VMINDLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKKCCEHFMLALALCHSVLTEP
Sbjct: 721  VMINDLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKKCCEHFMLALALCHSVLTEP 780

Query: 781  SPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVVEIQGIQKEFEILNILEFNS 840
            SPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVVEIQGIQKEFEILNILEFNS
Sbjct: 781  SPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVVEIQGIQKEFEILNILEFNS 840

Query: 841  ARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEKTALHLEQYA 900
            ARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEKTALHLEQYA
Sbjct: 841  ARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEKTALHLEQYA 900

Query: 901  TEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIERDLILLGGTAIE 960
            TEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIERDLILLGGTAIE
Sbjct: 901  TEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIERDLILLGGTAIE 960

Query: 961  DRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLE 1020
            DRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLE
Sbjct: 961  DRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLE 1020

Query: 1021 YGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVIDGDALKIALTGD 1080
            YGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVIDGDALKIALTGD
Sbjct: 1021 YGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVIDGDALKIALTGD 1080

Query: 1081 DMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVG 1140
            DMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVG
Sbjct: 1081 DMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVG 1140

Query: 1141 IGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFW 1200
            IGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFW
Sbjct: 1141 IGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFW 1200

Query: 1201 YGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLE 1260
            YGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLE
Sbjct: 1201 YGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLE 1260

Query: 1261 WNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAVFACN 1320
            WNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAVFACN
Sbjct: 1261 WNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAVFACN 1320

Query: 1321 LYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSLDLWKAGERIYDSPSFWAVFFI 1380
            LYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSLDLWKAGERIYDSPSFWAVFFI
Sbjct: 1321 LYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSLDLWKAGERIYDSPSFWAVFFI 1380

Query: 1381 GVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGDYDHYPVGYDPTDPNRPKISKGAKFG 1440
            GVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGDYDHYPVGYDPTDPNRPKISKGAKFG
Sbjct: 1381 GVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGDYDHYPVGYDPTDPNRPKISKGAKFG 1440

Query: 1441 ERLGQGIVLEDETYAGGNVSRDSVFTEEIPMNIISGTDGTPRGFEMSGRTPDIPQTQWES 1500
            ERLGQGIVLEDETYAGGNVSRDSVFTEEIPMNIISGTDGTPRGFEMSGRTPDIPQTQWES
Sbjct: 1441 ERLGQGIVLEDETYAGGNVSRDSVFTEEIPMNIISGTDGTPRGFEMSGRTPDIPQTQWES 1500

Query: 1501 PEREEQNLLNSPQANVGLGTFEQTVRQSIDRTRDSMLANRELDNRYSVDRAR 1552
            PEREEQNLLNSPQANVGLGTFEQTVRQSIDRTRDSMLANRELDNRYSVDRAR
Sbjct: 1501 PEREEQNLLNSPQANVGLGTFEQTVRQSIDRTRDSMLANRELDNRYSVDRAR 1552

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 2291 bits (5938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1101/1573 (69%), Positives = 1286/1573 (81%), Gaps = 44/1573 (2%)

Query: 1    MSGSNKPGNGDFITSPFDDAFEFEEXXXXX------------XXXXXXXXXXXXXXXXXX 48
            MSG+   G+G    SPF+D F+FE+                                   
Sbjct: 1    MSGTFH-GDGHAPMSPFEDTFQFEDNSSNEDTHIAPTHFDDGATSNKYSRPQVSFNDETP 59

Query: 49   DGHKMEEKETTLADDTDIEISSIQPTPHLGGAKTGMFXXXXXXXXXXXXSSR--EMKRLR 106
               + + +E T  DDT+ +  S QPTP L    +G F             +    MKR R
Sbjct: 60   KNKREDAEEFTFNDDTEYDNHSFQPTPKLNNG-SGTFDDVELDNDSGEPHTNYDGMKRFR 118

Query: 107  MGTRRVKGHKSQFGN--MSRNKTLKWAKKNIKNPFDDFSRDEEEENDRSTNRADQLRTVY 164
            MGT+R K      GN  M R+KTLKWA+KNI NPF+DF++D+ +    + NRA +LRTVY
Sbjct: 119  MGTKRNKK-----GNPIMGRSKTLKWARKNIPNPFEDFTKDDIDPG--AINRAQELRTVY 171

Query: 165  HNLPLPEEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGA 224
            +N+PLP++M+DEEGNPIM+YPRNKIRTTKYTPL+F PKN+LFQF NFANVYFLVLIILGA
Sbjct: 172  YNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGA 231

Query: 225  FQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEGXXXXXXXXX 284
            FQIFGVTNPGLSAVPL+VIVIITAIKD IEDSRRT+LDLEVNNT+THILEG         
Sbjct: 232  FQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVSTD 291

Query: 285  XXXLWRRFKKANSRLLMQFIQWCKERMTEDGXXXXXXXXXXXXXXSTRNG-HGPRNSLDS 343
               LWRRFKKANSRLL +FIQ+CKE +TE+G                  G  GPR+SLDS
Sbjct: 292  NISLWRRFKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSLDS 351

Query: 344  MDSYRPSADYYNRPSLDYDNMGHXXXXXXXXXXXXRTLPPRTDTRFARDYWKSVKVGDIV 403
            +DSYR SADY  RPSLDYDN+              R+LPPRTD +FA++YWK VKVGDIV
Sbjct: 352  IDSYRVSADY-GRPSLDYDNLEQGAGEANIVD---RSLPPRTDCKFAKNYWKGVKVGDIV 407

Query: 404  RIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDIARTRF 463
            RIHNNDEIPADIILLSTSD+DG CYVETKNLDGETNLKVRQ+LKC+  I+TS+DIART+F
Sbjct: 408  RIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKF 467

Query: 464  WIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIVVFTGD 523
            WIESEGPH+NLY+YQGN+KW++  + E+RNEP+TINN+LLRGCTLRNTKWAMG+V+FTG 
Sbjct: 468  WIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGG 527

Query: 524  DTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKHPRSRDFFEF 583
            DTKIMLN+G+TPTKKSRISRELNFSV+INF++LFILCF+SG+ANG+ YDK  RSR  +EF
Sbjct: 528  DTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSYEF 587

Query: 584  GTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPC 643
            GT+AG+ ATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPC
Sbjct: 588  GTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPC 647

Query: 644  TPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGID 703
            TPKSWNISDDLGQ+EYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGID
Sbjct: 648  TPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGID 707

Query: 704  VEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKKCC 763
            VE EGRREK EIAKDRD MI++LR LS N+QF+P+E+TF+SKE V+D KG +G++Q++CC
Sbjct: 708  VETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCC 767

Query: 764  EHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVVEI 823
            EHFMLALALCHSVL E +P NP KL++KAQSPDEAALV TARD+GF F+GKTK G+++E+
Sbjct: 768  EHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEM 827

Query: 824  QGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGE 883
            QGIQKEFEILNILEFNS+RKRMSCI+KIPG  P DEPRALLICKGADS+IYSRLS ++G 
Sbjct: 828  QGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGS 887

Query: 884  NDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIV 943
            N E +LEKTALHLEQYATEGLRTLC+AQREL+WSEY +WN +YDIAAASL NRE++LE+V
Sbjct: 888  NSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVV 947

Query: 944  SDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN 1003
            +DSIER+LILLGGTAIEDRLQDGVP+ I LLAEAGIKLWVLTGDKVETAINIGFSCNLLN
Sbjct: 948  ADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLN 1007

Query: 1004 NDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGD 1063
            N+MELLV+KT G+DV E+G +P E+V++L+SKYL+E F L+GSE E+  AK DH FPKG+
Sbjct: 1008 NEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGN 1067

Query: 1064 FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLA 1123
            +A+VIDGDALK+AL G+D++RKFLLLCKNC+AVLCCRVSP+QKAAVVKLVK++LDVMTLA
Sbjct: 1068 YAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLA 1127

Query: 1124 IGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLSEM 1183
            IGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYL RL+LVHGRWSYKRL+EM
Sbjct: 1128 IGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEM 1187

Query: 1184 IPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVNDT 1243
            IPEFFYKN+IF LALFWYGIYN+FDGSYL+EYTY+MFYNLAFTS+PVI LGILDQDVNDT
Sbjct: 1188 IPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDT 1247

Query: 1244 ISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLEH 1303
            ISLVVPQLYRVGILR EWNQ KFLWYM DGLYQS+ICFFFPYL+Y +N +VT NG+GL+H
Sbjct: 1248 ISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDH 1307

Query: 1304 RYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSLDLWK 1363
            RY+VG+ VTTIAV +CN Y+L+HQYRWDWFSG FI LSC+VV  WTGIW+S+  S + +K
Sbjct: 1308 RYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFK 1367

Query: 1364 AGERIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGDYDHYPVGY 1423
            A  RIY +PSFWAVFF+ V FCLLPRFT+D + +FF P+DV+I+REMW+ G +DHYP GY
Sbjct: 1368 AAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGY 1427

Query: 1424 DPTDPNRPKISKGAKFGERLGQGIVLEDETYAGGNVSRDSVFTEEIPMNIISGTDGTPRG 1483
            DPTDPNRPK++K  + GE++ +GI L D    G N SRDSV TEEIPM  + G DG+P G
Sbjct: 1428 DPTDPNRPKVTKAGQHGEKIIEGIALSD-NLGGSNYSRDSVVTEEIPMTFMHGEDGSPSG 1486

Query: 1484 FEMSGRTPDIPQTQWESPEREEQNLLNSPQ----ANVGLGTFEQTVRQSIDRTRDSMLAN 1539
            ++         Q  W +  +E Q+LL SPQ       G G     VR S+DRTR+ M+A 
Sbjct: 1487 YQ--------KQETWMTSPKETQDLLQSPQFQQAQTFGRGP-STNVRSSLDRTREQMIAT 1537

Query: 1540 RELDNRYSVDRAR 1552
             +LDNRYSV+RAR
Sbjct: 1538 NQLDNRYSVERAR 1550

>Scas_576.8
          Length = 1591

 Score = 2270 bits (5882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1112/1584 (70%), Positives = 1289/1584 (81%), Gaps = 51/1584 (3%)

Query: 1    MSGSNKP--GNGDFITSPFDDAFEFEEX---XXXXXXXXXXXXXXXXXXXXXXDGHKM-- 53
            MSG+  P   NG+   SPFDD F+FE+                          D   +  
Sbjct: 1    MSGNTNPFEDNGNNPMSPFDDNFQFEDIDFDAQPNHSSNTTANNTSSSNAYHGDSTHLTS 60

Query: 54   ----EEKET-TLADDTDIEISSIQPTPHLGGAKTGMF--------XXXXXXXXXXXXSSR 100
                +EKE+ +  +D D +I S +PTP +G +  G F                    S  
Sbjct: 61   FDDSKEKESLSFHEDVDNDIHSFEPTPRIGTS-NGAFDDISLENDDHDPSSSHHHSTSEN 119

Query: 101  EMKRLRMGTRRVKGHKSQFGNMSRNKTLKWAKKNIKNPFDDFS-RDEEEENDRSTNRADQ 159
             MKRLRMGT+R K  K   G   R KTLKWA+K   NPF++ + RD+  ++   TNRA +
Sbjct: 120  IMKRLRMGTQRNKKGKPTVG---RAKTLKWAQKTFVNPFEESNNRDDIFDDAGLTNRASE 176

Query: 160  LRTVYHNLPLPEEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVL 219
            LRTVY+N+PLP+EM+DE+G PI +YPRNKIRTTKY+PL+FFPKN++FQFQNFANVYFLVL
Sbjct: 177  LRTVYYNMPLPKEMVDEDGKPITDYPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVL 236

Query: 220  IILGAFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEGXXXX 279
            IILGAFQIFGVTNPGL+AVPLIVIVIITAIKD IEDSRRT+LD+EVNNTRTHILEG    
Sbjct: 237  IILGAFQIFGVTNPGLAAVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRTHILEGVDNG 296

Query: 280  XXXXXXXXLWRRFKKANSRLLMQFIQWCKERMTEDGXXXXXXXXXXXXXXSTRNGHG--- 336
                    LWRRFKKAN+RLLM+FI++CK   TE+G               T   +G   
Sbjct: 297  NVSVDNVSLWRRFKKANTRLLMKFIEYCKSHFTEEGRQKRRQHKRHILRSQTAAINGGID 356

Query: 337  -PRNSLDSMDSYRPSADYYNRPSLDYDNMGHXXXXXXXXXXXXRTLPPRTDTRFARDYWK 395
              RNSLDS+ SYR S DY  RPSL+YD +G             R+LPPR+D +F++DYWK
Sbjct: 357  MARNSLDSIGSYRMSGDY-GRPSLEYDTVGQSALKTDNANIMDRSLPPRSDCKFSKDYWK 415

Query: 396  SVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTS 455
            +VKVGDIVRIHNNDEIPADIILLSTSDSDGGCY+ETKNLDGETNLKVR++LKCS+ I+ S
Sbjct: 416  NVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKCSHSIRNS 475

Query: 456  RDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAM 515
            RDIART+FW+ESEGPHANLYSYQGN+KW DS + +L+NEPVTINN+LLRGCTLRNTKWAM
Sbjct: 476  RDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTLRNTKWAM 535

Query: 516  GIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKHP 575
            G+VVFTGDDTKIMLN+G TPTKKSRISRELN SV +NFL LFI+CFIS + NG+DYDKHP
Sbjct: 536  GMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIINGVDYDKHP 595

Query: 576  RSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLY 635
            RSRDFFEFGTVAG+ +TNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLY
Sbjct: 596  RSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLY 655

Query: 636  NAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAG 695
            NAKLDYPCTPKSWNISDD+GQIEYIFSDKTGTLTQNVMEFKKCTING+SYGRAYTEALAG
Sbjct: 656  NAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGRAYTEALAG 715

Query: 696  LRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGRN 755
            LRKRQGIDVE EGRREKEEIAKDRD MIN LRNLS+N+QF+PD+ITFISKE V D KG +
Sbjct: 716  LRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKEFVNDLKGAS 775

Query: 756  GDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKT 815
            GD+Q+KCCEHFMLALALCHSVL EP+  +  KL++KAQSPDEAALV TARD+GF F+GKT
Sbjct: 776  GDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARDVGFSFIGKT 835

Query: 816  KTGMVVEIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYS 875
            KTG+++E+QG+QKEF+ILN LEFNS RKRMSCI+KIPGA P+DEPRALLICKGADS+IYS
Sbjct: 836  KTGLIIEVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYS 895

Query: 876  RLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTN 935
            RL TK G N E LLEKTALHLEQYATEGLRTLC+AQREL+W EY EWN RYDIAAAS+TN
Sbjct: 896  RLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTN 955

Query: 936  REEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINI 995
            REEQLE VSD IER+L LLGGTAIEDRLQDGVPESI++LA+AGIKLWVLTGDKVETAINI
Sbjct: 956  REEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINI 1015

Query: 996  GFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKG 1055
            GFSCNLLNNDMELLVVKT G+DV E+G DP E+  SLI+KYLREKFGL+GSEMEL +AK 
Sbjct: 1016 GFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEMELADAKK 1075

Query: 1056 DHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKN 1115
            +H FP+GDFAVVIDG+ALK+AL G+ ++RKFLLLCKNCKAVLCCRVSPAQKAAVVKLV  
Sbjct: 1076 NHDFPRGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVMT 1135

Query: 1116 TLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRW 1175
            +LDVMTLAIGDGSNDVAMIQSADVG+GIAGEEGRQAVMCSDYAIGQFRYLTRL+LVHGRW
Sbjct: 1136 SLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLVLVHGRW 1195

Query: 1176 SYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGI 1235
            SY+RL+EMIP FFYKNVIFTLALFWYGIYNNFDGSYLFEYT+LMFYNLAFTS+PVI +GI
Sbjct: 1196 SYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFTSLPVIFMGI 1255

Query: 1236 LDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVT 1295
            +DQDV+DT+SLV+PQLYR GILRL+WNQTKFLWYM DGLYQS ICFFFPY LY +N +V+
Sbjct: 1256 MDQDVSDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSCICFFFPYCLYHKNQIVS 1315

Query: 1296 KNGMGLEHRYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSS 1355
             NG+GL+HR+YVG++VT++AV +CN+Y+L+HQYRWDWFS  FI LSCI++  WTG+W+SS
Sbjct: 1316 NNGLGLDHRFYVGVMVTSLAVVSCNIYMLLHQYRWDWFSCLFIGLSCIILFFWTGVWSSS 1375

Query: 1356 FTSLDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGD 1415
             TS + +KA  RIY +PSFW VFF+G+ +CLLPRFT DC+ +FF P+DV+I+REMW+RGD
Sbjct: 1376 LTSKEFFKAASRIYGAPSFWGVFFVGIVYCLLPRFTLDCFRKFFYPTDVEIVREMWQRGD 1435

Query: 1416 YDHYPVGYDPTDPNRPKISKGAKFGERLGQGIVLEDETYAGGNVSRDSVFTEEIPMNIIS 1475
            + HYP GYDPTDPNRPK++K  KFGER+ +GI L  +++   N S +SV TEEIPMNI+ 
Sbjct: 1436 FSHYPPGYDPTDPNRPKVAKSGKFGERIVEGIHLS-QSFGENNFSHESVATEEIPMNILH 1494

Query: 1476 GTDGTPRGFEMSGRTPDIPQTQWESPEREEQNLLNSPQANVGLGTFEQTVRQ-------S 1528
                T  G  +   T D    QW S  +E Q+LL SP+ N      EQ  RQ       S
Sbjct: 1495 ----TDAGQTIRRDTQD----QWASSPKETQDLLFSPRLNQ-----EQEQRQKSNLGRSS 1541

Query: 1529 IDRTRDSMLANRELDNRYSVDRAR 1552
            ++RTR+ MLA  +LDNRYSV++AR
Sbjct: 1542 LERTREDMLATNQLDNRYSVEKAR 1565

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 2164 bits (5607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1042/1511 (68%), Positives = 1232/1511 (81%), Gaps = 24/1511 (1%)

Query: 49   DGHKMEEKETTLADDTDIEISSIQPTPHLGGAKTGMFXXXXXXXXXXXXSSREMKRLRMG 108
            +G K E  E     D D+      P P+ GG +  +             +  ++KR+R G
Sbjct: 97   NGKKTEIHEHENEVDDDLHSFQATPMPNTGGFE-DVELDNNEGSNNDSQADHKLKRVRFG 155

Query: 109  TRRVKGHKSQFGNMSRNKTLKWAKKNIKNPFDDFSRDEEE-ENDRSTNRADQLRTVYHNL 167
            TRR   +KS   +++R+KTLKWAKKN  N  D+FS  E+  EN    NR+D+LRTVY+NL
Sbjct: 156  TRR---NKSGRIDINRSKTLKWAKKNFHNAIDEFSTKEDSLENSALQNRSDELRTVYYNL 212

Query: 168  PLPEEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQI 227
            PLPE+MLDE+G P+  YPRNKIRTTKYTPL+FFPKN+LFQF NFAN+YFL+L+ILGAFQI
Sbjct: 213  PLPEDMLDEDGLPLAVYPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQI 272

Query: 228  FGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEGXXXXXXXXXXXX 287
            FGVTNPG ++VPLIVIVIITAIKDGIEDSRRT+LDLEVNNTRTHIL G            
Sbjct: 273  FGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNENVAVDNVS 332

Query: 288  LWRRFKKANSRLLMQFIQWCKERMTEDGXXXXXXXXXXXXXXSTRNGH--GPRNSLDSMD 345
            LWRRFKKAN+R L++  ++  E +T  G                RN    GPR SLDS+ 
Sbjct: 333  LWRRFKKANTRALIKIFEYFSENLTAAGREKKLQKKREELRRK-RNSRSFGPRGSLDSIG 391

Query: 346  SYRPSADYYNRPSLDYDN----MGHXXXXXXXXXXXXRTLPPRTDTRFARDYWKSVKVGD 401
            SYR SAD+  RPSLDY+N    M              RTL P  + RFA+DYWK+VKVGD
Sbjct: 392  SYRMSADF-GRPSLDYENLNQTMSQANRYNDGENLVDRTLQPNPECRFAKDYWKNVKVGD 450

Query: 402  IVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDIART 461
            IVR+HNNDEIPAD+ILLSTSD DG CYVETKNLDGETNLKVRQ+LKCS  IK+SRDI RT
Sbjct: 451  IVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSSRDITRT 510

Query: 462  RFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIVVFT 521
            +FW+ESEGPHANLYSYQGN KW+D+ N  +RNEPV INN+LLRGCTLRNTKWAMG+V+FT
Sbjct: 511  KFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMVIFT 570

Query: 522  GDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKHPRSRDFF 581
            GDDTKIM+NAGVTPTKKSRISRELNFSV++NF++LFILCF +G+ NG+ Y + PRSRD+F
Sbjct: 571  GDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQKPRSRDYF 630

Query: 582  EFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDY 641
            EFGT+ G+ +TNGFVSFWVAVILYQSLVPISLYISVEIIKTAQA FIY DVLLYNAKLDY
Sbjct: 631  EFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKLDY 690

Query: 642  PCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG 701
            PCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG
Sbjct: 691  PCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG 750

Query: 702  IDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKK 761
            +DVE+EGRREKEEIAKDR+ MI++LR++S+NTQF P+++TF+SKEIV+D KG +GD Q+K
Sbjct: 751  VDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKGSSGDHQQK 810

Query: 762  CCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVV 821
            CCEHF+LALALCHSVL EP+  +P KL++KAQSPDE+ALV+TAR LG+ F+G +K+G++V
Sbjct: 811  CCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSSKSGLIV 870

Query: 822  EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKA 881
            EIQG+QKEF++LN+LEFNS+RKRMSCIIKIPG+TP DEP+ALLICKGADSVIYSRL    
Sbjct: 871  EIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRT- 929

Query: 882  GENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLE 941
             +ND TLLEKTALHLE+YATEGLRTLCLAQRELTWSEY  W   YD+AAAS+TNREE+L+
Sbjct: 930  -QNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELD 988

Query: 942  IVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNL 1001
             V+D IER+LILLGGTAIEDRLQDGVP+SIALLAEAGIKLWVLTGDKVETAINIGFSCN+
Sbjct: 989  KVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNV 1048

Query: 1002 LNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPK 1061
            LNNDMELLVVK +GEDV E+G DP +VVN+L++KYLREKFG+SGSE EL  AK +H  P+
Sbjct: 1049 LNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQ 1108

Query: 1062 GDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMT 1121
            G+FAV+IDGDALK+AL G++M+RKFLLLCKNCKAVLCCRVSPAQKAAVVKLVK TLDVMT
Sbjct: 1109 GNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKKTLDVMT 1168

Query: 1122 LAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLS 1181
            LAIGDGSNDVAMIQSADVG+GIAGEEGRQAVMCSDYAIGQFRY+TRL+LVHG+W YKRL+
Sbjct: 1169 LAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLA 1228

Query: 1182 EMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVN 1241
            EMIP+FFYKNVIFTL+LFWYGIYNNFDGSYLFEYTYL FYNLAFTS+PVILL +LDQDV+
Sbjct: 1229 EMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQDVS 1288

Query: 1242 DTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGL 1301
            DT+S++VPQLYRVGILR EWNQTKFLWYM DG+YQSVICFFFPYL Y +N VVT+NG+GL
Sbjct: 1289 DTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENGLGL 1348

Query: 1302 EHRYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSLDL 1361
            +HRY+VG+ VT IAV +CN Y+ + QYRWDWF G FI LS  V  GWTGIWTSS +S + 
Sbjct: 1349 DHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVFYGWTGIWTSSSSSNEF 1408

Query: 1362 WKAGERIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGDYDHYPV 1421
            +K   R++  P++WAV F+GV FCLLPRFT DC  + F P D++I+REMW RGD+D YP 
Sbjct: 1409 YKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLRGDFDLYPQ 1468

Query: 1422 GYDPTDPNRPKISKGAKFGERLGQGIVLEDETYAGGNVSRDSVFTEEIPMNIISGTDGTP 1481
            GYDPTDP+RP+I++     +   + I L D  + G + S++++ TEEIPM+I++G  G+ 
Sbjct: 1469 GYDPTDPSRPRINEIRPLTD-FKEPISL-DTHFDGVSHSQETIVTEEIPMSILNGEQGSR 1526

Query: 1482 RGFEMSGRTPDIPQTQWESPEREEQNLLNSPQANVGLGTFEQTVRQSIDRTRDSMLANRE 1541
            +G+ +S     + +    SP     NL     A+         +R S+DRTR+ MLAN +
Sbjct: 1527 KGYRVS---TTLERRDQLSPVTTTNNLPRRSMASAR----GNKLRTSLDRTREEMLANHQ 1579

Query: 1542 LDNRYSVDRAR 1552
            LD RYSV+RAR
Sbjct: 1580 LDTRYSVERAR 1590

>Scas_636.16
          Length = 1554

 Score = 2155 bits (5585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1043/1551 (67%), Positives = 1235/1551 (79%), Gaps = 50/1551 (3%)

Query: 15   SPFDDAFEFEEXXXXXXXXXXXXXXXXXXXXXXXDGHKMEEKETTLADDTDIEISSIQPT 74
            SPFDD+F+FE+                       D   +E+ E T  DD+    SSI PT
Sbjct: 18   SPFDDSFQFEDKDKTNSFLKG-------------DAVTVEDVEETKYDDS----SSILPT 60

Query: 75   PHLGGAKTGMFXXXXXXXXXXXXSSREMKRLRMGTRRVKGHKSQFGNMSRNKTLKWAKKN 134
            P +GG  T  F            S  EMKRLR+GT+RVK  ++ F + ++ KT+KWA+KN
Sbjct: 61   PVVGG--TAQFEDIELNSELPNSSETEMKRLRLGTKRVK-RETNF-DRNKTKTIKWAQKN 116

Query: 135  IKNPFDDFSRDEEEENDRS--TNRADQLRTVYHNLPLPEEMLDEEGNPIMEYPRNKIRTT 192
            +  PF     D + +++ +   NR+D+ RT+YHN+PLP+EML E+G PIMEYPRNKIRTT
Sbjct: 117  VHIPFKKHDEDADVDDNETGLLNRSDEFRTIYHNMPLPDEMLYEDGLPIMEYPRNKIRTT 176

Query: 193  KYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVIVIITAIKDG 252
            KYTPL+FFPKN++ QF NFAN+YFL++IILGAFQIFGVTNPGL+AVPLIVI+I+TAIKD 
Sbjct: 177  KYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGLAAVPLIVIIILTAIKDA 236

Query: 253  IEDSRRTILDLEVNNTRTHILEGXXXXXXXXXXXXLWRRFKKANSRLLMQFIQWCKERMT 312
            IEDSRRT+LD+EVNNTRTHIL+G             WR+FKKAN++L+++F Q+  ER T
Sbjct: 237  IEDSRRTLLDMEVNNTRTHILQGPENPNVPIDNVSSWRKFKKANTKLMLKFFQFINERFT 296

Query: 313  EDGXXXXXXXXXXXXXXSTR-NGHGPRNSLDSMDSYRPSADYYNRPSLDYDNMGHXXXXX 371
              G                      PR SLDS  S R SADYY RPSL+  N+       
Sbjct: 297  ATGKEARKQRQMKRRRAKKLGKTELPRTSLDSYQSTRMSADYY-RPSLEQSNIDSTFENG 355

Query: 372  XXXXXXXRTLPPRTDTRFARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVET 431
                    +LPP  +++FA D+WK+V+VGDIVRIHNNDEIPAD+ILLSTSD DGGCYVET
Sbjct: 356  EISVLDP-SLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVET 414

Query: 432  KNLDGETNLKVRQALKCSYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNEL 491
            KNLDGE+NLKVRQ+L+C+  I+ SRDI RT+FW+ESEGPHANLY YQGNLKW DS + + 
Sbjct: 415  KNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQT 474

Query: 492  RNEPVTINNMLLRGCTLRNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLI 551
             NEP+TINNMLLRGCTLRNTKWAMGIVVFTGDDTK M+NAGVTPTKKSRISRELNFSVLI
Sbjct: 475  HNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKSRISRELNFSVLI 534

Query: 552  NFLVLFILCFISGLANGIDYDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPI 611
            NF+ LFILC I+G+ANG  Y K PRSRDFFEFGT+AGNP TNGFVSFWVAVILYQSLVPI
Sbjct: 535  NFVFLFILCLIAGVANGAYYRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPI 594

Query: 612  SLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQN 671
            SLYISVEIIKTAQA FIY DVLLYN +LDYPCTPKSW+ISDDLGQIEYIFSDKTGTLTQN
Sbjct: 595  SLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQN 654

Query: 672  VMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSN 731
            VMEFKKCTINGVSYGRAYTEALAGLRKRQGID E EGR E+E IA+DR++MI+DLR +SN
Sbjct: 655  VMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISN 714

Query: 732  NTQFFPDEITFISKEIVQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMK 791
            N+QF+P+E+TF+SKE  QD  G NG++Q+K C+HFMLALALCHSVL EP   +PNKLE+ 
Sbjct: 715  NSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELT 774

Query: 792  AQSPDEAALVTTARDLGFCFMGKTKTGMVVEIQGIQKEFEILNILEFNSARKRMSCIIKI 851
            AQSPDE ALVTTARD+GF F+GKTK G++VE+QGIQKEF+ILNILEFNS+RKRMSCI+K+
Sbjct: 775  AQSPDETALVTTARDMGFSFIGKTKQGLLVEVQGIQKEFQILNILEFNSSRKRMSCIVKL 834

Query: 852  PGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQ 911
            P AT  DEPRALLICKGADSVIYSRLS K G NDETLLEKTALHLEQYATEGLRTLC+ Q
Sbjct: 835  PPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQ 894

Query: 912  RELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESI 971
            RE++WSEY EWN +Y+IAAASL  REE+L+ V+D IERDL+LLGGTAIEDRLQDGVP+SI
Sbjct: 895  REISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSI 954

Query: 972  ALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNS 1031
            ALLAEAGIKLWVLTGDKVETAINIGFSCNLLN DMELLV+KT GEDV E+G+DP E+VN+
Sbjct: 955  ALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNA 1014

Query: 1032 LISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCK 1091
            L+SKYL EKF ++GSE EL  AK DHS P+G+FA++IDG+ALKIALTGD MKRKFLLLCK
Sbjct: 1015 LVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCK 1074

Query: 1092 NCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQA 1151
            NCKAVLCCRVSPAQKAAVVKLVK+TLDVMTLAIGDGSNDVAMIQSADVG+GIAGEEGRQA
Sbjct: 1075 NCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQA 1134

Query: 1152 VMCSDYAIGQFRYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSY 1211
            VMCSDYAIGQFRY+TRL+LVHG+W YKRL+EMIP+FFYKNVIFTLALFWYG++N+FDGSY
Sbjct: 1135 VMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSY 1194

Query: 1212 LFEYTYLMFYNLAFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMF 1271
            LFEYTYL FYNLAFTS+PVI LGILDQDV+ T+S++VPQLYR GILR EWNQTKFLWYMF
Sbjct: 1195 LFEYTYLTFYNLAFTSLPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMF 1254

Query: 1272 DGLYQSVICFFFPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAVFACNLYILIHQYRWD 1331
            DG+YQSVIC+FFPYL+Y++  ++T+NG+GL+HRYYVGI VT IAV +CN Y+L+ QYRWD
Sbjct: 1255 DGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWD 1314

Query: 1332 WFSGFFIFLSCIVVIGWTGIWTSSFTSLDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFT 1391
            WF+ FF FLS IV  GWTGIW+SS  S + WK   R+Y +PSFWAV+F+G  FC+LPRFT
Sbjct: 1315 WFTTFFAFLSTIVYFGWTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFT 1374

Query: 1392 WDCYTQFFNPSDVQIIREMWKRGDYDHYPVGYDPTDPNRPKISKGAKFG------ERLGQ 1445
            +D + ++  PSDV+IIREMW+ GD+  YP  YDPTDPN+PK+ K  ++G      E +G 
Sbjct: 1375 YDVFMKYLYPSDVEIIREMWQHGDFARYPDDYDPTDPNKPKVEKAHEWGQYKIVDESIGD 1434

Query: 1446 GIVLEDETYAGGNVSRDSVFTEEIPMNII----SGTDGTPRGFEMSGRTPDIPQTQWESP 1501
             +V   +       S+ ++ TEEIPM+ +      ++   R  ++S  + D    + +S 
Sbjct: 1435 AVVCASD-------SQGTIVTEEIPMSFLDVKKDSSNQVTREKQVSRDSLDEDDARRDSM 1487

Query: 1502 EREEQNLLNSPQANVGLGTFEQTVRQSIDRTRDSMLANRELDNRYSVDRAR 1552
                 ++   P ++         VR S+DRTRD MLA+ +LD RYSVDRAR
Sbjct: 1488 NNARNSMQFRPSSS-------SRVRTSLDRTRDEMLASNQLDTRYSVDRAR 1531

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 2012 bits (5213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1007/1569 (64%), Positives = 1198/1569 (76%), Gaps = 44/1569 (2%)

Query: 8    GNGDFITSPFDDAFEFEEXXXXXXXXXXXXXXXXXXXXXXXDGHKMEEKETTLADDTDIE 67
            G  + I+SPFDD+  F++                       DG   EE      DD D +
Sbjct: 12   GGKEPISSPFDDSNRFQDVEMVPMEEDVKDTNTTVYDEFG-DGPYKEE------DDMDDD 64

Query: 68   ISSIQPTPHLGGAKTGMFX---------------XXXXXXXXXXXSSREMKRLRMGTRRV 112
             S ++PTP +G +  G F                           S  ++KRLR GT+R 
Sbjct: 65   YS-MEPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRESKSGDQIKRLRWGTQRR 123

Query: 113  KGHKSQFGNMSRNKTLKWAKKNIKNPFDDFSRDEEEENDRS--TNRADQLRTVYHNLPLP 170
            +    ++ ++ R+KTLKWAKKNI++P ++   +E E  D +   N+AD+LR +Y N PLP
Sbjct: 124  RKSFKRY-DIGRSKTLKWAKKNIQDPLEELIGNENEATDETGMRNKADELRNIYFNQPLP 182

Query: 171  EEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGV 230
            ++MLDE+  P+  YPRNKIRTTKYTPL+F PKN+L QF NFAN+YFL+LIILGAFQIFGV
Sbjct: 183  QDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGV 242

Query: 231  TNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEGXXXXXXXXXXXXLWR 290
            TNPG SAVPLIVI+IITAIKDGIEDSRRT+LDLEVNNT+TH+L G            LWR
Sbjct: 243  TNPGFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNNTKTHVLTGIENYNVSADDISLWR 302

Query: 291  RFKKANSRLLMQFIQWCKERMTEDGXXXXXXXXXXXXXXSTRNGHGPRNSLDSMDSYRPS 350
            RFKKANSR++  F+Q C+E +T+ G                      RNSL+S  S R S
Sbjct: 303  RFKKANSRIIASFVQVCRETLTKKGRLEKAQRKRQMANHKKNLNRKFRNSLNSYRSNRMS 362

Query: 351  ADYYNRPSLDY----DNMGHXXXXXXXXXXXXRTLPPRTDTRFARDYWKSVKVGDIVRIH 406
             D   RPS+D+    D  G+            +TLP   + RF++DYWK+VKVGDIVRIH
Sbjct: 363  RDV--RPSMDFRPSTDINGYQQNEDTLIN---KTLPTDMEWRFSKDYWKNVKVGDIVRIH 417

Query: 407  NNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDIARTRFWIE 466
            NN+EIPADIILLSTSDSDG CYVETKNLDGETNLKVRQ++KC+  I++S DIARTRFWIE
Sbjct: 418  NNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSSIDIARTRFWIE 477

Query: 467  SEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIVVFTGDDTK 526
            SEGPHANLYSYQGN +W    +N+L+NEPV INN+LLRGCTLRNTKWAMG+V FTGDDTK
Sbjct: 478  SEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTK 537

Query: 527  IMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKHPRSRDFFEFGTV 586
            IMLNAGVTPTKKSRIS+ELN SVL NF +LF+LCFI+GL NGI ++KHPRSRDFF+FGT 
Sbjct: 538  IMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRDFFDFGTG 597

Query: 587  AGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPK 646
             G  AT+GFVSFWVAVILYQSLVPISLYISVEIIKTAQA FIY DV++YN KLDYPCTPK
Sbjct: 598  TGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPK 657

Query: 647  SWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEA 706
            SWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG+DV  
Sbjct: 658  SWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAH 717

Query: 707  EGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKKCCEHF 766
            E + EKE I +DR+ MIN L+NL+ N+QF+ DE+TF+SKE V D  G +G +Q+K C+HF
Sbjct: 718  ESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHF 777

Query: 767  MLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVVEIQGI 826
            MLALALCHSVLTEPS  +P KLE+KAQSPDEAALVTTARD+GF F+ KTK GMV+E+QGI
Sbjct: 778  MLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGI 837

Query: 827  QKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDE 886
            +KEF+ILNILEFNS+RKRMSCI+KIPG   N +P+ALLICKGADSVIYSRL  K G N+E
Sbjct: 838  EKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLD-KTGLNEE 896

Query: 887  TLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDS 946
            +LLEKTALHLEQYATEGLRTLCLAQREL+W EY  WN +YDIAAA++ +REE+LE VSD 
Sbjct: 897  SLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDE 956

Query: 947  IERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDM 1006
            IER LILLGGTAIEDRLQDGVP+SIALL EAGIKLWVLTGDKVETAINIGFSCNLLNNDM
Sbjct: 957  IERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDM 1016

Query: 1007 ELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAV 1066
            ELLV+KT G DV + G  P ++V++LIS+YL +KFG++GSE EL  AK +H  P+G+FAV
Sbjct: 1017 ELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAV 1076

Query: 1067 VIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGD 1126
            +IDG+ALK AL+ +DMKRKFLLLCKNCK+VLCCRVSPAQKAAVVKLVKNTLDVMTLAIGD
Sbjct: 1077 IIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGD 1136

Query: 1127 GSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLSEMIPE 1186
            GSNDVAMIQSA++G+GIAGEEGRQAVM SDYAIGQFRYLTRLLLVHG+W YKRL+EMIP+
Sbjct: 1137 GSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAEMIPQ 1196

Query: 1187 FFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVNDTISL 1246
            FFYKN+IFTLALFW+GIYN++DGSYLFEYTYL FYNLAFTSIPVILLGI DQDV+DTISL
Sbjct: 1197 FFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSDTISL 1256

Query: 1247 VVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLEHRYY 1306
            V PQLYRVGILR EW+QTKFLWYM DGLYQSVI FFFPYLLY+R+ +VT NG+GL+HRYY
Sbjct: 1257 VFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYY 1316

Query: 1307 VGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSLDLWKAGE 1366
            VG+ VT IA  +CNLYILI Q  WD F  FF+ +S ++   WTGIW+S+  S + +    
Sbjct: 1317 VGVPVTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSNEFYHGAA 1376

Query: 1367 RIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGDYDHYPVGYDPT 1426
            R++ +P+FWAV F+G+ FCLLPRFT D + ++F P D+ IIREMW RGD+D +P  YDPT
Sbjct: 1377 RVFGTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSFPKKYDPT 1436

Query: 1427 DPNRPKISKGAKFGERLGQGIVLED--ETYAGGNVSRDSVFTEEIPMNIISGTDGTPRGF 1484
            DP   KI   A    R+  G   ++        + S + + +EEIP+ +  G + + +  
Sbjct: 1437 DPEVHKI---AMSDIRVFSGAESKEFNSNSNTSSSSSEDILSEEIPLELGKGMNDSGKKS 1493

Query: 1485 EMSGRTPDIPQTQWESPEREEQNLLNSPQANVGLGTFEQTV-RQSIDRTRDSMLANRELD 1543
            E      D     +   +     +L   Q    L T+ +   R S+DRTR+ MLA  +LD
Sbjct: 1494 EYESGVGDEILKYYLGKDSNRNTILTDNQKR--LSTYSRASNRTSLDRTREDMLATNQLD 1551

Query: 1544 NRYSVDRAR 1552
             R+SV+RAR
Sbjct: 1552 TRFSVERAR 1560

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 1956 bits (5067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 950/1464 (64%), Positives = 1123/1464 (76%), Gaps = 65/1464 (4%)

Query: 99   SREMKRLRMGTRRVKGHKSQFGNMSRNKTLKWAKKNIKNPFDD---------FSRDEEEE 149
            S+ +KR+R GTRR K  K   G   R KTL+W KKN  NPF D          S D+ +E
Sbjct: 149  SKHVKRMRWGTRRDKKGKPAMG---RAKTLRWTKKNFHNPFADDTNLAAEGHSSDDDNDE 205

Query: 150  NDRSTNRADQLRTVYHNLPLPEEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQ 209
            N   ++R  + RT+Y+NLPLPE++LDE+GN  + YPRNKIRTTKYTPL+FFPKN+ FQF+
Sbjct: 206  NYDKSHRQRETRTIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFK 265

Query: 210  NFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTR 269
            N ANVYFLVLII+G FQIFGV NPGL+ VPLIVIV++T+ KD IEDSRRTILD+EVNN  
Sbjct: 266  NVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNAP 325

Query: 270  THILEGXXXXXXXXXXXXLWRRFKKANSRLLMQFIQWCKERMTEDGXXXXXXXXXXXXXX 329
            THIL+G            LWR+FKKAN+R+L +FI  C+E  TE+G              
Sbjct: 326  THILKGVENVNVSNDKVSLWRKFKKANTRVLFRFIHLCQELFTEEGKKQRAQRKRHEMHN 385

Query: 330  STRNGHGPRNSLDSMDSYRPSADYYNRPSLDYDNMGHXXXXXXXXXXXXRTLPPRTDTRF 389
              R    PRNSLDS+ SYR S +  +    D    G              +LP   D +F
Sbjct: 386  KIRQTQTPRNSLDSVGSYRNSME--SEFGGDLTERGKDDLCLLDP-----SLPVLPDCKF 438

Query: 390  ARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCS 449
            A+DYWKSV VGDIVR+HNNDEIPADIILLS+SDSDG CYVETKNLDGETNLKVRQ+LKCS
Sbjct: 439  AKDYWKSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKCS 498

Query: 450  YKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLR 509
            + I+ SR+I RT+F +ESEGPH+NLYSYQGNLKW D      +NEPV INN+LLRGCTLR
Sbjct: 499  HMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLR 558

Query: 510  NTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGI 569
            NTKWAMGIVVFTG DTKIMLNAGVTPTK SRISRELN SV +NF +LF+LCF +G+ NG+
Sbjct: 559  NTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNGV 618

Query: 570  DYDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIY 629
             Y     SR++FEFG++AG+ A NG VSFWVA+ILYQS+VPISLYIS+EIIKTAQA FIY
Sbjct: 619  YYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIY 678

Query: 630  GDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAY 689
            GDV LYN +LDYPCTPKSW ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAY
Sbjct: 679  GDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAY 738

Query: 690  TEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQ 749
            TEALAGLRKRQGIDVE EG  EKE IA+D+++M+ +L+ L  N+Q  P+ +TF+SKE VQ
Sbjct: 739  TEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQ 798

Query: 750  DFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDLGF 809
            D  G NG+ QKKC E+FMLALALCH+VL E +  +P  ++ KAQSPDEAALV TARD+GF
Sbjct: 799  DTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGF 858

Query: 810  CFMGKTKTGMVVEIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGA 869
             F+G+TK G++V+IQG+QKE+ +LN+LEFNS RKRMSCI+KIP   PN+EPRALLICKGA
Sbjct: 859  SFVGRTKNGVIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGA 918

Query: 870  DSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIA 929
            DS+IYSRLS     NDE LLEKTALHLEQYATEGLRTLC+AQREL+W EY EWN +++IA
Sbjct: 919  DSIIYSRLSKN---NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIA 975

Query: 930  AASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKV 989
            AA+L +RE+++E V+D IER+L LLGGTAIEDRLQDGVP+SIA L EAGIKLWVLTGDKV
Sbjct: 976  AAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKV 1035

Query: 990  ETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEME 1049
            ETAINIGFSCNLLNN+MELLV+K +G+DV  YG  P E+V +LI KYL+EKF +SGS  E
Sbjct: 1036 ETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEE 1095

Query: 1050 LDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAV 1109
            L+ AK  H  P G+F V+IDGDALK+AL  DD+KR+FLLLCK CKAVLCCRVSPAQKAAV
Sbjct: 1096 LEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAV 1155

Query: 1110 VKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLL 1169
            VKLVKNTLDVMTLAIGDGSNDVAMIQSAD+G+GIAGEEGRQAVM SDYAIGQFRYLTRL+
Sbjct: 1156 VKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLV 1215

Query: 1170 LVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIP 1229
            LVHGRWSYKR++EMIP FFYKNVIFTL+LFWYG+YNN+DGSYLFEYTYL  +NLAFTS+P
Sbjct: 1216 LVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLP 1275

Query: 1230 VILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYK 1289
            VI LGILDQDVND +S+VVPQLYRVGILR EWNQTKF  YMFD +YQSVICFF PYL Y 
Sbjct: 1276 VIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYY 1335

Query: 1290 RNGVVTKNGMGLEHRYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSCIVVIGWT 1349
            + G+VT+NG GL+HRY+VG+ V TIAV +CN Y+L+HQYRWDWFS  FI LSC+ +  WT
Sbjct: 1336 KTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCIFAWT 1395

Query: 1350 GIWTSSFTSLDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIRE 1409
            GIW+S  +S + +K+   IY  P FWA+ F G+ FCLLPRF  D + + + P D+ IIRE
Sbjct: 1396 GIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKDIDIIRE 1455

Query: 1410 MWKRGDYDHYPVGYDPTDPNRPKISKGAKFGERLGQGIVLEDETYAGGNVSRDSVFTEEI 1469
             WKRGD+DHYP GYDPTDP+RPK+     + + +                S DS+ TEEI
Sbjct: 1456 CWKRGDFDHYPEGYDPTDPDRPKVKNAFVYNKDIEM-----------AQSSTDSIQTEEI 1504

Query: 1470 PMNIISGTDGT-PRGFEMSGRTPDIPQTQWESPEREEQNLLNSPQANVGLGTFEQTVRQS 1528
            PM+ +  +  T PR +                P    Q                 + R S
Sbjct: 1505 PMDELFNSSATSPRSY----------------PHNRHQ---------------RSSGRPS 1533

Query: 1529 IDRTRDSMLANRELDNRYSVDRAR 1552
            ++ TR  M  + +LDNRYSV+RAR
Sbjct: 1534 LEITRAEMRNSNQLDNRYSVERAR 1557

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 1887 bits (4887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 930/1461 (63%), Positives = 1112/1461 (76%), Gaps = 56/1461 (3%)

Query: 98   SSREMKRLRMGTRRVKGHKSQFGNMSRNKTLKWAKKNIKN-PFDDFSRDEEEENDRS-TN 155
            S++EMK LR GT+R +  +     + R +TL+W KKN  N P D  S   + +   +  +
Sbjct: 119  SAKEMKILRWGTQRHRTGRP----VGRARTLRWGKKNYDNLPEDRGSGGSDTDAGVAGKS 174

Query: 156  RADQLRTVYHNLPLPEEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVY 215
            RA + R VY N+PLP E+  E G P++ YPRNKIRTTKYTPLSF PKNL +QF+N AN+Y
Sbjct: 175  RAAEKRAVYFNMPLPPELTGENGRPVVNYPRNKIRTTKYTPLSFLPKNLAYQFKNAANIY 234

Query: 216  FLVLIILGAFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEG 275
            FL+L+ L    IFGVTNP L+A+PLI IV+IT +KD  EDSRRTILDLEVNN R+HIL G
Sbjct: 235  FLLLVCLSFVSIFGVTNPALAAIPLIAIVVITGLKDAFEDSRRTILDLEVNNMRSHILHG 294

Query: 276  XXXXXXXXXXXXLWRRFKKANSRLLMQFIQWCKERMTEDGXXXXXXXXXX-XXXXSTRNG 334
                        LWR+FKK N+RLL+  +++ +E  TE G               ++R G
Sbjct: 295  VENNNVSADNVSLWRKFKKLNTRLLIATVRFFRESFTEAGRRRRAQRAREESQMAASRLG 354

Query: 335  HGPRNSLDSMDSYRPSADYYNRPSLDYDNMGHXXXXXXXXXXXXRTLPPRTDTRFARDYW 394
              PR SLDSM SYRPS        LD+DN+G             R LPP  D RF + +W
Sbjct: 355  SDPRMSLDSMGSYRPS--------LDFDNIGQLVSSDQVSVLN-RNLPPVPDCRFGKSHW 405

Query: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454
            K ++VGDIVRIHNNDEIPADIILLSTSD+DG CYVETKNLDGETNLKVRQ+LKCS++I+ 
Sbjct: 406  KDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKCSHRIRN 465

Query: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514
            S+DI+R +FW+ESEGPHANLYSYQGN KW DS    + NEPV INNMLLRGC+LRNTKWA
Sbjct: 466  SKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSLRNTKWA 525

Query: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574
            MGIV+FTG DTKIMLNAGVTPTK+SRISRELN+SV++NF+ LF+LC  +GL NGI Y + 
Sbjct: 526  MGIVMFTGTDTKIMLNAGVTPTKRSRISRELNYSVILNFVFLFVLCLAAGLVNGIYYRRD 585

Query: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634
              SR FFEFGTVAG P  NG ++F+VA+ILYQSLVPISLYIS+EIIKTAQAAFIYGDVLL
Sbjct: 586  ATSRTFFEFGTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAFIYGDVLL 645

Query: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 694
            YN KLDYPCTP++WNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA
Sbjct: 646  YNPKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 705

Query: 695  GLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGR 754
            GLRKRQG+D+E EG RE+ EI +D+  M+  L  L  N+Q  P  +TF+SKE+VQD  G 
Sbjct: 706  GLRKRQGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKELVQDLGGA 765

Query: 755  NGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGK 814
            N   QK+  EHFML+LALCHSV+ E +  NP KL++KAQSPDEAALV TARD+GF F+G+
Sbjct: 766  NSQEQKEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGFSFVGR 825

Query: 815  TKTGMVVEIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIY 874
            TK G+++EIQG+QKEF ILN+LEFNS RKRMSCI+KIP A  N +P+ALL+CKGADSVIY
Sbjct: 826  TKNGVIIEIQGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIY 885

Query: 875  SRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLT 934
            SRL      ND  LLE+TALHLEQ+ATEGLRTLC+AQRE+ W EY  WN R ++AAASL 
Sbjct: 886  SRLDRS--RNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLD 943

Query: 935  NREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAIN 994
            NREE LE V+D+IER L+LLGGTAIEDRLQDGVP+SI++LA+AGIKLWVLTGDKVETAIN
Sbjct: 944  NREEALERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAIN 1003

Query: 995  IGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAK 1054
            IGFSCNLL +DMELLV+K++GEDV   GE   +VV +LI KYL   F + GS  EL  A+
Sbjct: 1004 IGFSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEELAAAR 1063

Query: 1055 GDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVK 1114
             DH+ P+  F VVIDGDALK+AL G+D++RKFLLLCKNCKAVLCCRVSP+QKAAVVKLVK
Sbjct: 1064 KDHTPPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAVVKLVK 1123

Query: 1115 NTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGR 1174
             +LDV+TLAIGDGSNDVAMIQ+ADVGIGIAGEEGRQAVM +DYAIGQFRYLTRL+LVHGR
Sbjct: 1124 ESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLTRLVLVHGR 1183

Query: 1175 WSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLG 1234
            WSYKRL+EMIP+FFYKN+ FTLALFW+GI +N+DGSYLFEYTYLMFYNLAFTS+PVI LG
Sbjct: 1184 WSYKRLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAFTSLPVIFLG 1243

Query: 1235 ILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVV 1294
            I+DQD +D +S+VVPQLY+VGILR EW Q KF WY FDG+YQS+ICFFFPYL Y R G++
Sbjct: 1244 IMDQDASDVLSVVVPQLYKVGILRTEWTQNKFWWYCFDGVYQSIICFFFPYLCYYRTGLI 1303

Query: 1295 TKNGMGLEHRYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTS 1354
            TKN  GL+HRY  G+ VT+IAV +CNLY+LIHQYRWDWF+  FIFLSC ++  WTG+W+S
Sbjct: 1304 TKNAYGLDHRYTFGVFVTSIAVVSCNLYVLIHQYRWDWFTTLFIFLSCGILFFWTGVWSS 1363

Query: 1355 SFTSLDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRG 1414
            +  S + +K   R+Y  P FWAV F+GV FCLLPRFTWD   + F P D+ I+RE W RG
Sbjct: 1364 ATYSGEFYKTAVRLYAQPVFWAVLFVGVIFCLLPRFTWDAVQKLFFPRDIDIVRECWWRG 1423

Query: 1415 DYDHYPVGYDPTDPNRPKISKGAKFGERLGQGIVLEDETYAGGN---VSRDSVFTEEIPM 1471
            D+D YP  YDPTDPNRP+I+      +R       +DE    G+   V+R +V +E+IPM
Sbjct: 1424 DFDMYPEDYDPTDPNRPRINVSHTGVDRAS-----DDERSRTGSDLGVTRTTVISEDIPM 1478

Query: 1472 NIISGTDGTPRGFEMSGRTPDIPQTQWESPEREEQNLLNSPQANVGLGTFEQTVRQSIDR 1531
             +I  T    R        P  P                       LG+ E + R S++ 
Sbjct: 1479 GLIDKTAPHSRA------DPTTP-----------------------LGS-EDSARYSLEV 1508

Query: 1532 TRDSMLANRELDNRYSVDRAR 1552
            TR  ML   +LD+RYSV+RAR
Sbjct: 1509 TRREMLQTHQLDSRYSVERAR 1529

>Kwal_26.7070
          Length = 1315

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1075 (38%), Positives = 602/1075 (56%), Gaps = 121/1075 (11%)

Query: 389  FARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKC 448
            F    W ++ VGDI+++++ + IPAD+I++++S+ +G CY+ET NLDGETNLK++QA   
Sbjct: 293  FTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIE 352

Query: 449  SYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTL 508
            + K     D+A  R  + SE P+++LY+Y+G +      N   +N  ++   M+LRG TL
Sbjct: 353  TSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTM------NLNGKNISLSPEQMVLRGATL 406

Query: 509  RNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANG 568
            RNT W  G+VVFTG +TK+M NA  TP K++ + R +N  ++  F VL +L  IS + N 
Sbjct: 407  RNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNV 466

Query: 569  IDYDKHPRSRDFFEF-GTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 627
            I          +    GT          +++W   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 467  IKVTSDAEHLTYLYLQGTNKVGLFFKDILTYW---ILFSNLVPISLFVTVEMIKYYQAYM 523

Query: 628  IYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 687
            I  D+ LY+   D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK C+I G  Y  
Sbjct: 524  IASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIE 583

Query: 688  AYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEI 747
               E  A   +  GI++   G R+            + ++   N+TQ  PD        I
Sbjct: 584  TIPEDKAATTE-DGIEI---GFRK-----------FDSMKETLNDTQ-DPD------SHI 621

Query: 748  VQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDL 807
            + D               F+  LA CH+V+  P       ++ +A SPDE ALV  A  L
Sbjct: 622  IND---------------FLTLLATCHTVI--PEFQEDGSIKYQAASPDEGALVEGAASL 664

Query: 808  GFCFMGKTKTGMVVEIQ--GIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLI 865
            G+ F+ +    + V I+  G ++E+++LNI EFNS RKRMS I ++    PN E +  L 
Sbjct: 665  GYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRL----PNGEIK--LF 718

Query: 866  CKGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNAR 925
            CKGAD+VI  RL  KAGEN    +E T  HLE YA EGLRTLCLA R +T SEY EW   
Sbjct: 719  CKGADTVILERL--KAGEN--PYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDI 774

Query: 926  YDIAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLT 985
            YD A+ +L +R ++L+  ++ IE+DL LLG TAIED+LQDGVPE+I  L +AGIK+WVLT
Sbjct: 775  YDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLT 834

Query: 986  GDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSG 1045
            GD+ ETA+NIG SC LL+ DM LL++           E+  E       K L EK     
Sbjct: 835  GDRQETAVNIGMSCRLLSEDMNLLII----------NEEDKEATR----KNLTEKL---- 876

Query: 1046 SEMELDNAKGDHSFPKGD---FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVS 1102
                   A  DH   + D    A+VIDG +L  AL   D++   L + K CKAV+CCRVS
Sbjct: 877  ------KAISDHQISQQDMNSLALVIDGKSLGFALEA-DLEDYLLAIGKLCKAVICCRVS 929

Query: 1103 PAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQF 1162
            P QKA VVK+VK   D + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D+AI QF
Sbjct: 930  PLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQF 989

Query: 1163 RYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYN 1222
            +YL +LLLVHG WSY+R+S+ I   FYKN+   +  FWY   N + G  + E   + FYN
Sbjct: 990  KYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYN 1049

Query: 1223 LAFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLW-YMFDGLYQSVICF 1281
            + FT +P  ++G+ DQ V+  +    PQLY++G  R ++   +  W ++ +G Y S + F
Sbjct: 1050 VFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLG-QRGQFFSVRIFWGWVINGFYHSAVTF 1108

Query: 1282 FFPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAVFACNLYILIHQY-----RWDWFSGF 1336
                L Y+   V+  +G   +H  +       ++++ C++ I+I +      +W  F+ F
Sbjct: 1109 IGSTLFYRNGNVLNSHGETADHWAW------GVSIYTCSVIIVIGKAALVTNQWTKFTAF 1162

Query: 1337 FIFLSCIVVIGWTGIWTSSF----TSLDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFTW 1392
             I  S +  + +  I+ S       S + +     +Y S +FW +  +   F L+    W
Sbjct: 1163 AIPGSLVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVW 1222

Query: 1393 DCYTQFFNPSDVQIIREMWKR--GDYDHYPVGYDPTDPNRPKISKGAKFGERLGQ 1445
              Y + + P    +++EM K   GDY             RP+I +  K   R+ Q
Sbjct: 1223 KYYKRTYTPESYHVVQEMQKYNIGDY-------------RPRIEQFQKAIRRVRQ 1264

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 72/148 (48%), Gaps = 13/148 (8%)

Query: 129 KWAKKNIKNPFDD---FSRDEEEENDRSTNRADQLRTVYHNLPLPEEMLDEEGNPIMEYP 185
           ++AK   +N FD    F R     ND S +     R +Y N        D+E N    + 
Sbjct: 149 RYAKS--RNKFDIKIIFKRYILRRNDYSDDDKSSPRQIYIN--------DKEANRARGFG 198

Query: 186 RNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVIVI 245
            N I TTKY   +F PK L  +F  +AN++FL    +        TN   +   L++++I
Sbjct: 199 SNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIVLI 258

Query: 246 ITAIKDGIEDSRRTILDLEVNNTRTHIL 273
           ++AIK+ +ED +R   D E+N++R  + 
Sbjct: 259 VSAIKEIVEDLKRAQSDSELNDSRAQVF 286

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/1042 (38%), Positives = 581/1042 (55%), Gaps = 96/1042 (9%)

Query: 389  FARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKC 448
            F +  W  +KVGDI+R+++ + IPADII+LS+S+ +G CY+ET NLDGETNLK++QA   
Sbjct: 277  FIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTE 336

Query: 449  SYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTL 508
            + KI  SR++   +  I SE P+++LY+Y+G L+   +        P++   M+LRG TL
Sbjct: 337  TAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGT------KIPLSPEQMILRGATL 390

Query: 509  RNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANG 568
            RNT W  GIV+FTG +TK+M NA  TP K++ + + +N  ++  F VL +L  IS + N 
Sbjct: 391  RNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNV 450

Query: 569  IDYDKHPRSRDFFEF-GTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 627
            I      +   +    GT         F++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 451  IMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 507

Query: 628  IYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 687
            I  D+ LY  + D P   K+ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G  Y  
Sbjct: 508  IGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAE 567

Query: 688  AYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEI 747
               E  A   +  GI+V   G R  +++ K      +D                      
Sbjct: 568  HIPEDKAATFE-DGIEV---GYRSFDDLKKQLTTNSDDC--------------------- 602

Query: 748  VQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDL 807
                         K  + F+  LA CH+V+  P       ++ +A SPDE ALV     L
Sbjct: 603  -------------KIIDEFLTLLATCHTVI--PEFQADGSIKYQAASPDEGALVEGGALL 647

Query: 808  GFCFMGKTKTGMVVEI-QGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLIC 866
            G+ F+ +    + + I +  ++E+++LNI EFNS RKRMS I + P    +D  +  L+C
Sbjct: 648  GYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFP----DDSIK--LLC 701

Query: 867  KGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARY 926
            KGADSVI  RLS    E     ++ T  HLE YATEGLRTLCLA +++   EY  WN +Y
Sbjct: 702  KGADSVILERLS----ETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKY 757

Query: 927  DIAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTG 986
              AA +L +R E+L+ V++ IE  L L+G TAIED+LQ+GVP++I  L EAGIK+WVLTG
Sbjct: 758  MDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTG 817

Query: 987  DKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGS 1046
            DK ETAINIG SC LL+ DM LL++           E+  E       + + EK      
Sbjct: 818  DKQETAINIGMSCRLLSEDMNLLII----------SEETKEATR----RNMEEKLA---- 859

Query: 1047 EMELDNAKGDHSFPKGD---FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSP 1103
                  A  +HS  + D    A+VIDG +L  AL  D ++  FL + K CKAV+CCRVSP
Sbjct: 860  ------ALHEHSLSEHDMNTLALVIDGHSLSFALEAD-LEDYFLAIGKMCKAVICCRVSP 912

Query: 1104 AQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFR 1163
             QKA VVK+VK   + + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D ++GQFR
Sbjct: 913  LQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFR 972

Query: 1164 YLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNL 1223
            +L +LLLVHG WSY+R+S  I   FYKN    +  FWY   N F G  + E   +  YN+
Sbjct: 973  FLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNV 1032

Query: 1224 AFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFF 1283
             FT +P  ++G+ DQ VN  +    PQLY++G     ++ + F  ++ +G Y S + F  
Sbjct: 1033 FFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVG 1092

Query: 1284 PYLLYKRNGVVTKNGMGLEH-RYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFI---- 1338
              L Y+    + K+G   +H  + + I  +++ +      ++ +Q  W  F+ F I    
Sbjct: 1093 TILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQ--WTKFTLFAIPGSL 1150

Query: 1339 FLSCIVVIGWTGIWTSSFTSLDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQF 1398
            F   I    +  I+  +  S + +   E  Y S +FW    +   F L   F W  Y + 
Sbjct: 1151 FFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRM 1210

Query: 1399 FNPSDVQIIREMWKRGDYDHYP 1420
            + P    +I+EM K    D+ P
Sbjct: 1211 YAPESYHLIQEMQKYNVSDYRP 1232

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%)

Query: 168 PLPEEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQI 227
           P    + D E N    Y  N I TTKY   +F PK L  +F  +AN++FL    +     
Sbjct: 165 PREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPH 224

Query: 228 FGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHI 272
              TN   +   L+V++I++AIK+ +ED +R   D E+NN++  I
Sbjct: 225 VSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEI 269

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1042 (38%), Positives = 577/1042 (55%), Gaps = 95/1042 (9%)

Query: 389  FARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKC 448
            F R  W  + VGDI+R+ + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++QA + 
Sbjct: 298  FVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQE 357

Query: 449  SYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTL 508
            +      + + +    ++SE P+++LY+Y+G +    ST       P++ + MLLRG TL
Sbjct: 358  TANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTF------PLSPDQMLLRGATL 411

Query: 509  RNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANG 568
            RNT W  G++VFTG +TK+M NA  TP K++ + R +N  +L  F VL +L  IS   N 
Sbjct: 412  RNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNV 471

Query: 569  IDYDKHPRSRDFFEF-GTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 627
            I   +      +    GT          ++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 472  IMTKRDSAHLGYLYIEGTNKAGLFFKDILTFW---ILFSNLVPISLFVTVEMIKYYQAYM 528

Query: 628  IYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 687
            I  D+ LY+ + D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK  +I G    R
Sbjct: 529  IGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAG----R 584

Query: 688  AYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEI 747
             Y E                       I +DR   + D             EI F S E 
Sbjct: 585  CYIET----------------------IPEDRRATVED-----------GIEIGFHSFES 611

Query: 748  VQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDL 807
            ++D      D +      F+  LA CH+V+  P   +   ++ +A SPDE ALV  A DL
Sbjct: 612  LKDKMTDPEDDEAGIVIEFLTLLATCHTVI--PETQSDGTIKYQAASPDEGALVQGAADL 669

Query: 808  GFCFMGKTKTGMVVEIQ-GIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLIC 866
            GF F  +    + +      Q E+++LNI EFNS RKRMS I ++P  +        L C
Sbjct: 670  GFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIK------LFC 723

Query: 867  KGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARY 926
            KGAD+VI  RL ++        ++ T  HLE YA EGLRTLC+A R +   EY EW+  Y
Sbjct: 724  KGADTVILERLDSEFNP----YVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIY 779

Query: 927  DIAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTG 986
            + A+ ++ +R E+L+  ++ IE DL  LG TAIED+LQ+GVPE+I  L EAG+K+WVLTG
Sbjct: 780  EAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTG 839

Query: 987  DKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGS 1046
            D+ ETAINIG SC LL+ DM LL+V        E  ED    + S +             
Sbjct: 840  DRQETAINIGMSCRLLSEDMNLLIVNE------ETKEDTRTNLQSKL------------- 880

Query: 1047 EMELDNAKGDHSFPKGD---FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSP 1103
                 NA   H   + D    A+VIDG +L  AL  +D++ +FL + K CKAV+CCRVSP
Sbjct: 881  -----NAIESHQISQQDMNSLALVIDGKSLGYALE-EDLEDQFLTIGKLCKAVICCRVSP 934

Query: 1104 AQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFR 1163
             QKA VVK+VK     + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D+AIGQFR
Sbjct: 935  LQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFR 994

Query: 1164 YLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNL 1223
            +L +LL+VHG WSY+R+S  I   FYKN+   +  FWY   N F G  + E   L FYN+
Sbjct: 995  FLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNV 1054

Query: 1224 AFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFF 1283
             FT +P  ++GI DQ V   +    PQLY++G     ++ T F  ++ +G Y S + F  
Sbjct: 1055 FFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIG 1114

Query: 1284 PYLLYKRNGVVTKNGMGLEHRYY-VGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSC 1342
              L Y+    +   G   +H  + VGI  T+I +      ++  Q  W  F+   I  S 
Sbjct: 1115 SVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQ--WTKFTLVAIPGSL 1172

Query: 1343 IVVIGWTGIWTSSFTSLDLWKAGE----RIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQF 1398
            ++ + +   +++ F  +++ K        +Y S +FW +  +   F LL  F W  Y + 
Sbjct: 1173 VIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKRT 1232

Query: 1399 FNPSDVQIIREMWKRGDYDHYP 1420
            ++P    +++EM K    D+ P
Sbjct: 1233 YSPESYHVVQEMQKYNISDYRP 1254

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 88/185 (47%), Gaps = 21/185 (11%)

Query: 99  SREMKRLRMGTRRVKGHKSQFGNMSRN-----KTLKWA----KKNIKNPFDDFSRDEEEE 149
           +R M  ++       GHK QF +   N      T ++     K +IK  F+ +       
Sbjct: 120 NRFMSNVKSAVGMNGGHKGQFQSFEMNDYDQSNTNRYESSTRKFDIKVLFNRYIL----R 175

Query: 150 NDRSTNRADQLRTVYHNLPLPEEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQ 209
             +++ ++D+ RT+  N        D   N    Y  N I TTKY   +F PK L  +F 
Sbjct: 176 KGKTSCKSDEPRTILLN--------DSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFS 227

Query: 210 NFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTR 269
            +AN++FL   I+        TN   +   L+V++I++A+K+ +ED +R+  D E+N++ 
Sbjct: 228 KYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSL 287

Query: 270 THILE 274
             +L+
Sbjct: 288 CDVLD 292

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1042 (38%), Positives = 570/1042 (54%), Gaps = 94/1042 (9%)

Query: 389  FARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKC 448
            F    W  ++VGDI+R+ + + IPAD I+LS+S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 294  FVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVE 353

Query: 449  SYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTL 508
            + K    + +      + SE P+++LY+Y+G +   D      R  P++ + M+LRG TL
Sbjct: 354  TAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTMTLND------RQIPLSPDQMILRGATL 407

Query: 509  RNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANG 568
            RNT W  G+V+FTG +TK++ NA  TP K++ + + +N  ++  F VL +L  IS + N 
Sbjct: 408  RNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNV 467

Query: 569  IDYDKHPRSRDFFEF-GTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 627
            I      +   +    GT         F++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 468  IMSTADAKHLSYLYLEGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 524

Query: 628  IYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 687
            I  D+ LY  K D P   ++ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G  Y  
Sbjct: 525  IGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYID 584

Query: 688  AYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEI 747
               E      +  GI+V   G R+ +++ K     +ND                      
Sbjct: 585  KIPEDKTATVE-DGIEV---GYRKFDDLKKK----LND---------------------- 614

Query: 748  VQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDL 807
                     D        F+  LA CH+V+  P   +   ++ +A SPDE ALV    DL
Sbjct: 615  -------PSDEDSPIINDFLTLLATCHTVI--PEFQSDGSIKYQAASPDEGALVQGGADL 665

Query: 808  GFCFMGKTKTGMVV--EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLI 865
            G+ F+ +    + V  E  G +KE+++LNI EFNS RKRMS I + P  +        L 
Sbjct: 666  GYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIK------LF 719

Query: 866  CKGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNAR 925
            CKGAD+VI  RL  +A +     +E T  HLE YA+EGLRTLCLA R+++  EY EWN+ 
Sbjct: 720  CKGADTVILERLDDEANQ----YVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSI 775

Query: 926  YDIAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLT 985
            Y+ AA +L NR E+L+  ++ IE++LIL+G TAIED+LQDGVPE+I  L EAGIK+WVLT
Sbjct: 776  YNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLT 835

Query: 986  GDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSG 1045
            GD+ ETAINIG SC LL+ DM LL++     D  E              + L EK     
Sbjct: 836  GDRQETAINIGMSCRLLSEDMNLLIINEETRDDTE--------------RNLLEKI---- 877

Query: 1046 SEMELDNAKGDHSFPKGD---FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVS 1102
                  NA  +H     D    A+VIDG +L  AL   +++   L + K CKAV+CCRVS
Sbjct: 878  ------NALNEHQLSTHDMKSLALVIDGKSLGFALE-PELEDYLLTVAKLCKAVICCRVS 930

Query: 1103 PAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQF 1162
            P QKA VVK+VK     + LAI  G+NDV+MIQ+A VG+GI+G EG QA   +D A+GQF
Sbjct: 931  PLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQF 990

Query: 1163 RYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYN 1222
            ++L +LLLVHG WSY+R+S  I   FYKN    +  FWY   N F G  + E   + FYN
Sbjct: 991  KFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYN 1050

Query: 1223 LAFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFF 1282
            L FT  P  ++G+ DQ V+  +    PQLY++G     ++   F  ++ +G + S I F 
Sbjct: 1051 LFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFI 1110

Query: 1283 FPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSC 1342
               L+Y+    +  +G   +H  +   + TT  +       L+   +W  F+   I  S 
Sbjct: 1111 GTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALVTN-QWTKFTLIAIPGSL 1169

Query: 1343 IVVIGWTGIWTSSF----TSLDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQF 1398
            +  + +  I+ S F     S + +   +  Y S  FW    +   F L+  F W  Y + 
Sbjct: 1170 LFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRM 1229

Query: 1399 FNPSDVQIIREMWKRGDYDHYP 1420
            + P    +I+EM K    D  P
Sbjct: 1230 YEPETYHVIQEMQKYNISDSRP 1251

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 85/184 (46%), Gaps = 20/184 (10%)

Query: 110 RRVK--GHKSQFGNMSRNKTLKWAKKNIK----NPFDDFSRDEEEENDRSTNRADQLRTV 163
           R VK  G  ++FGN  +N      KK  +    N ++  + +E ++N   +     ++ +
Sbjct: 104 RAVKPPGLFARFGNGLKNAFTFKRKKGPESFEMNHYNAVTNNELDDNYLDSRNKFNIKIL 163

Query: 164 YHNLPLPEEMLDEEGN--------------PIMEYPRNKIRTTKYTPLSFFPKNLLFQFQ 209
           ++   L + + D EGN                  Y  N I TTKY   +F PK L  +F 
Sbjct: 164 FNRYILRKNVGDAEGNGEPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFS 223

Query: 210 NFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTR 269
            +AN++FL    +        TN   +   L+V++I++A+K+ IED +R   D E+NN+ 
Sbjct: 224 KYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNST 283

Query: 270 THIL 273
             I 
Sbjct: 284 AEIF 287

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/1069 (37%), Positives = 580/1069 (54%), Gaps = 107/1069 (10%)

Query: 388  RFARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALK 447
            +F    W  + VGDI+R+ + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++QA  
Sbjct: 289  QFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARP 348

Query: 448  CSYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCT 507
             + KI   R+++  R  I SE P+ +LY+Y+G +      NN +   P++ + +LLRG T
Sbjct: 349  ETSKILDVRELSAMRGKILSEQPNTSLYTYEGTMILH---NNRI---PLSPDQILLRGAT 402

Query: 508  LRNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLAN 567
            LRNT W  GIV+FTG +TK+  NA  TP K++ + R +N  ++  F VL  L  IS   N
Sbjct: 403  LRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGN 462

Query: 568  GID-YDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAA 626
             I  Y++       +  GT          ++FW   IL+ +LVPISL+++VE+IK  QA 
Sbjct: 463  LIVMYNQKENLSYLYLQGTNMVALFFKNILTFW---ILFSNLVPISLFVTVEMIKYYQAY 519

Query: 627  FIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYG 686
             I  D+ L++ + + P   ++ ++ ++LGQIEYIFSDKTGTLTQNVMEFK C+I G    
Sbjct: 520  MIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAG---- 575

Query: 687  RAYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKE 746
            R Y ++                      I +D+D   ++             E+ + + +
Sbjct: 576  RCYIQS----------------------IPEDKDAAFDE-----------GIEVGYRTYD 602

Query: 747  IVQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARD 806
             + +     G       + F+  L++CH+V+  P       ++ +A SPDE ALV  A D
Sbjct: 603  DMHELLHTPGSGDGAIIDEFLTLLSICHTVI--PEFQENGSIKYQAASPDEGALVQGAAD 660

Query: 807  LGFCFMGKTKTGMVVEIQGIQKE--FEILNILEFNSARKRMSCIIKIPGATPNDEPRALL 864
            LG+ F+ +    + +  + I +E  +E+LNI EFNS RKRMS I + P  +        L
Sbjct: 661  LGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIR------L 714

Query: 865  ICKGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNA 924
            +CKGAD+VI  RL+  +       +  T  HLE YA EGLRTLC+A R +  SEY EW+ 
Sbjct: 715  LCKGADTVILERLAATSN----PYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSK 770

Query: 925  RYDIAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVL 984
             YD AA ++ NR E+L+ V++ IE+ L+LLG TAIED+LQDGVPE+I  L +AGIK+WVL
Sbjct: 771  LYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVL 830

Query: 985  TGDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVV-NSLISKYLREKFGL 1043
            TGD+ ETAINIG SC LL+ DM LL+V           ED  E   N+LI K LR     
Sbjct: 831  TGDRQETAINIGMSCKLLSEDMNLLIVN----------EDTKESTRNNLIDK-LR----- 874

Query: 1044 SGSEMELDNAKGDHSFPKGD---FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCR 1100
                     A  DH   + D    A+VIDG +L  AL   D++   L + K C+AV+CCR
Sbjct: 875  ---------AINDHQISQQDMNTLALVIDGKSLGFALE-PDLEEFLLAIGKMCRAVICCR 924

Query: 1101 VSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIG 1160
            VSP QKA VVK+VK     + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D+A+G
Sbjct: 925  VSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALG 984

Query: 1161 QFRYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMF 1220
            QF+YL +LLLVHG WSY+R+S+ I   FYKN+   +  FWY +YN F G  + E   L F
Sbjct: 985  QFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTF 1044

Query: 1221 YNLAFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVIC 1280
            YN   T+ P       DQ     +     Q   VG     W  T F     +G Y + I 
Sbjct: 1045 YNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQFWPATIFRGSAINGNYHNWIT 1104

Query: 1281 FFFPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFL 1340
                 + Y+       +G   +H  +   I  T  +F      LI   +W  F+   I  
Sbjct: 1105 IDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSIIFVLGKAALITN-QWTKFTVLAIPG 1163

Query: 1341 SCIVVIGWTGIWTSSFTSLDLWKA----GERIYDSPSFWAVFFIGVFFCLLPRFTWDCYT 1396
            S +  + +  I+      L++ K        +Y S +FWA+ ++     LL    W  Y 
Sbjct: 1164 SLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVLPVLALLRDLLWKYYK 1223

Query: 1397 QFFNPSDVQIIREMWKRGDYDHYPVGYDPTDPNRPKISKGAKFGERLGQ 1445
            + + P    +++EM K          YD +D NRP+I +  K   ++ Q
Sbjct: 1224 RTYTPESYHVVQEMQK----------YDISD-NRPRIEQFQKAIRKVRQ 1261

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 70/141 (49%), Gaps = 11/141 (7%)

Query: 132 KKNIKNPFDDFSRDEEEENDRSTNRADQLRTVYHNLPLPEEMLDEEGNPIMEYPRNKIRT 191
           K N+K  FD +   +    D     A + R +Y N        +   N  M Y  N I T
Sbjct: 153 KFNLKALFDHYVLRKPAAADTG---AGEPRVIYIN--------ERRANGAMGYGDNHIST 201

Query: 192 TKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVIVIITAIKD 251
           TKY   +F PK L  +F  +AN++FL   I+        TN   +   LIV+++++AIK+
Sbjct: 202 TKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFTTIGTLIVVLVVSAIKE 261

Query: 252 GIEDSRRTILDLEVNNTRTHI 272
            +ED +R+  D E+N++R  +
Sbjct: 262 SVEDLKRSNSDKELNHSRADV 282

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  352 bits (904), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 290/1013 (28%), Positives = 485/1013 (47%), Gaps = 165/1013 (16%)

Query: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454
            K +KVGD++++H  D IPAD++LL +S+  G  +++T  LDGET+ K+R A  C      
Sbjct: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVA--CPLTQNL 325

Query: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514
            S +    R  I +  P  +++ + G + +KDST+N     P++++N L     L ++ + 
Sbjct: 326  SENDLINRISITASAPEKSIHKFLGKVTYKDSTSN-----PLSVDNTLWANTVLASSGFC 380

Query: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574
            +  VV+TG DT+  +N      K   +  E+N    I    +F L  +            
Sbjct: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSIL------------ 428

Query: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634
                        AG    + ++     +IL+ +++P+SL +++++ K+  A  I  D   
Sbjct: 429  --------LVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD--- 477

Query: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 694
               K       ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 478  ---KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY--------- 525

Query: 695  GLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGR 754
                 + +D+ ++    +  ++   D + N    LS                  +D   R
Sbjct: 526  ---TSETLDIVSD--YVQSLVSSKNDSLNNSKVALSTTR---------------KDMSFR 565

Query: 755  NGDIQKKCCEHFMLALALCHSVLTEPSPT-NPNKLEMKAQSPDEAALVTTARDLGFCFMG 813
              D+        +L LA+CH+V    +PT   ++L  +A SPDE A+V     +G     
Sbjct: 566  VRDM--------ILTLAICHNV----TPTFEDDELTYQAASPDEIAIVKFTESVGLSLFK 613

Query: 814  KTK--TGMVVEIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEP--RALLICKGA 869
            + +    ++ E  G    +EIL +  FNS  KRM  I++       DE       + KGA
Sbjct: 614  RDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVR-------DEQLDEYWFMQKGA 666

Query: 870  DSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIA 929
            D+V+     +K  E+++ L E+T       A EGLRTL + +++L    Y ++   Y+ A
Sbjct: 667  DTVM-----SKIVESNDWLEEETG----NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDA 717

Query: 930  AASLTNREEQL-EIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDK 988
            + S+ NR++Q+ ++++  +E DL LLG T +ED+LQ  V  SI LL  AGIK+W+LTGDK
Sbjct: 718  SLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDK 777

Query: 989  VETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEM 1048
            VETA  +  S  L++                  G+  H      I+K  R +    G+  
Sbjct: 778  VETARCVSISAKLISR-----------------GQYVHT-----ITKVTRPE----GAFN 811

Query: 1049 ELDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAA 1108
            +L+  K +      +  ++IDG++L + L     +++F  +  +   V+ CR +P QKA 
Sbjct: 812  QLEYLKINR-----NACLLIDGESLGMFL--KHYEQEFFDVVVHLPTVIACRCTPQQKAD 864

Query: 1109 VVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRL 1168
            V  +++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I QF +LT L
Sbjct: 865  VALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTEL 924

Query: 1169 LLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSI 1228
            LL HGR SYKR +++     ++ +I  +    Y I + F+   L++   ++ Y   +T  
Sbjct: 925  LLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMA 984

Query: 1229 PVILLGILDQDVNDTISLVVPQLYR--VGILRLEWNQTKFLWYMFDGLYQSVICFF---F 1283
            PV  L  LD D+ ++++ + P+LY+       L + +T F+W +      SVI  F   F
Sbjct: 985  PVFSLT-LDHDIEESLTKIYPELYKELTEGKSLSY-KTFFVWVLLSLFQGSVIQLFSQAF 1042

Query: 1284 PYLL---YKRNGVVTKNGMGLEHRYYVGI---------IVTTIAVFACNLYILIHQYRWD 1331
              LL   + R   ++   + +     V +         +VT IA      YI+   +  D
Sbjct: 1043 TSLLDTDFTRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLL--FYIVSVPFLGD 1100

Query: 1332 WFS-------GFFIFLSCIVVIGWTGIWTSSFTSLDLWKAGERIYDSPSFWAV 1377
            +F         ++  L  I++I    +WT+        KA  R    PS+  V
Sbjct: 1101 YFDLGYMTTVNYYAGLLVILLISIFPVWTA--------KAIYRRLHPPSYAKV 1145

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%)

Query: 184 YPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVI 243
           Y  N++   KY  ++F P  L  QF+ F N+YFLV+ +  A     +       VPL  +
Sbjct: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229

Query: 244 VIITAIKDGIEDSRRTILDLEVNNTRTHIL 273
           + +T  K+ I+D +R   D E NN   H++
Sbjct: 230 LTVTMAKEAIDDIQRRRRDRESNNELYHVI 259

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  352 bits (904), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 273/965 (28%), Positives = 466/965 (48%), Gaps = 148/965 (15%)

Query: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454
            K+++VGD+V++H +  IPAD+ILL +S+  G  +V+T  LDGET+ K+R A   +  +  
Sbjct: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL-- 343

Query: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514
            ++D   T+  I +  P  +++ + G L +K S+       P++++N L     L ++   
Sbjct: 344  TQDEMLTKVHITASAPEKSIHMFTGKLTYKGSS------APLSVDNTLWANTVLASSGTC 397

Query: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574
            +  V++TG DT+  +N   +  K   +  E+N    I  + +F L  +  +  G+D DK 
Sbjct: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDK- 456

Query: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634
                                +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 457  -------------------WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSI 497

Query: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRA------ 688
             +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ +K  +  VSY         
Sbjct: 498  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVT 551

Query: 689  -YTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEI 747
             Y + L          V   G R KE   + RD+++                        
Sbjct: 552  DYIQTLTSPANMGAAGVAVTGSR-KEVSQRVRDLVVT----------------------- 587

Query: 748  VQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPT-NPNKLEMKAQSPDEAALVTTARD 806
                                  LA CH+V    +P    N+L  +A SPDE A+V     
Sbjct: 588  ----------------------LATCHNV----TPNFEDNELAYQAASPDEIAIVKFTER 621

Query: 807  LGFCFMGKTKTGMVV--EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALL 864
            +G     + +  + +  E  G+  +++IL++  F S  KRM  I++    T N+      
Sbjct: 622  VGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVR--DRTKNE---IWF 676

Query: 865  ICKGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNA 924
            + KGAD+V+     +K  ++++ L E+ +      A EGLRTL +A+++L+   Y +++ 
Sbjct: 677  LQKGADTVM-----SKIVQSNDWLEEEVS----NMAREGLRTLVIARKKLSTRLYEQFSK 727

Query: 925  RYDIAAASLTNREEQL-EIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWV 983
             Y  A+ S+ NR+E + E+V   +E +L LLG T +ED+LQ  V  SI LL  AG+K+W+
Sbjct: 728  EYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWM 787

Query: 984  LTGDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGL 1043
            LTGDKVETA  +  S  L++                  G+  H      I+K  R    L
Sbjct: 788  LTGDKVETARCVCVSAKLISR-----------------GQYVHT-----ITKLTRRDGAL 825

Query: 1044 SGSEMELDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSP 1103
            S     L+  K +      +  ++IDGD+L I ++    + +F  +      V+ CR +P
Sbjct: 826  S----RLEYLKANR-----NSCLLIDGDSLAIYMS--HYRAEFFEIVICLPVVIACRCTP 874

Query: 1104 AQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFR 1163
             QKA V  L++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +DY+I QF 
Sbjct: 875  QQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFC 934

Query: 1164 YLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNL 1223
            +LT+LLL HGR SYKR +++     ++ ++ ++    Y I +N     L++   ++ Y  
Sbjct: 935  HLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYAT 994

Query: 1224 AFTSIPVILLGILDQDVNDTISLVVPQLYR-VGILRLEWNQTKFLWYMFDGLYQSVICFF 1282
             +T  PV  L  LD D++++++   P+LY+ +   R    +T F+W +   L+Q  +   
Sbjct: 995  CYTMAPVFSL-TLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVIL-SLFQGAVIQG 1052

Query: 1283 FPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSC 1342
            F  L       V K  + L    +  +++  + + A  +Y             F I++  
Sbjct: 1053 FSQLFIGVGSEVFKKMVALS---FTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLS 1109

Query: 1343 IVVIG 1347
            I ++G
Sbjct: 1110 IPLLG 1114

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 7/116 (6%)

Query: 165 HNLPLPEEMLDEE----GNPIME---YPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFL 217
           H++ L ++ +D E      PI +   YP N I   KY  ++F P  L  QF+ F N+YFL
Sbjct: 162 HSIELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFL 221

Query: 218 VLIILGAFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHIL 273
           ++ +  +     +       VPL  ++++T  K+ ++D +R   D E NN    +L
Sbjct: 222 LVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVL 277

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  348 bits (892), Expect = e-99,   Method: Compositional matrix adjust.
 Identities = 253/865 (29%), Positives = 429/865 (49%), Gaps = 134/865 (15%)

Query: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454
            K +KVGD+++IH    IPAD++LL +S+  G  +++T  LDGET+ K+R A  CS     
Sbjct: 264  KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVA--CSLTQNL 321

Query: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514
            S D    +  I +  P  +++ + G L +KDS++N L     +++N +     L +    
Sbjct: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNAL-----SVDNTMWANTVLASVGSC 376

Query: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574
            +G VV+TG DT+  +N  ++  K   +  E+N    I    +F+L  +            
Sbjct: 377  IGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIV------------ 424

Query: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634
                        AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 425  --------LVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATI 476

Query: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 694
             +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 477  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSY--------- 521

Query: 695  GLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGR 754
                                     D++ + ++ L +++   P   +   K    D   R
Sbjct: 522  --------------------TMDTMDIVTDYVQELVSSSTTTPMPQSTAKK----DLPNR 557

Query: 755  NGDIQKKCCEHFMLALALCHSVLTEPSPT-NPNKLEMKAQSPDEAALVTTARDLGFCFMG 813
              D+        ++ LA+CH+V    +PT    +L  +A SPDE A+V     +G     
Sbjct: 558  VRDL--------VVTLAICHNV----TPTFEDGELTYQAASPDEIAIVKFTESVGLSLFK 605

Query: 814  KTKTGMVVEIQ--GIQKEFEILNILEFNSARKRMSCII--KIPGATPNDEPRALLICKGA 869
            + +  + +  Q      E++IL +  FNS  KRM  I+  K+ G           + KGA
Sbjct: 606  RDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKG-------EHWFMQKGA 658

Query: 870  DSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIA 929
            D+V+      +  ++++ L E+        A EGLRTL + +++L+   Y ++   Y  A
Sbjct: 659  DTVM-----ARIVQSNDWLDEEVG----NMAREGLRTLVIGRKKLSPKSYEQFRKEYHDA 709

Query: 930  AASLTNREEQLE-IVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDK 988
            + S+ NR+E +  ++   +E +L LLG T +ED+LQ+ V  SI LL  AG+K+W+LTGDK
Sbjct: 710  SLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDK 769

Query: 989  VETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEM 1048
            VETA  +  S  L++                  G+  H V     +K  R +  L+  E 
Sbjct: 770  VETARCVSISAKLISR-----------------GQYVHTV-----TKLSRPEGALNALEY 807

Query: 1049 ELDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAA 1108
               N             ++IDG++L + LT    K++F  +  +  AV+ CR +P QKA 
Sbjct: 808  LKINKSS---------CLLIDGESLGMFLTY--YKQEFFDIVVDLPAVIACRCTPQQKAD 856

Query: 1109 VVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRL 1168
            V  L++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +D+++ QF +LT+L
Sbjct: 857  VALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKL 916

Query: 1169 LLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSI 1228
            LL HGR SYKR +++     ++ +I ++    Y + + F+   L++   ++ Y   +T  
Sbjct: 917  LLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMA 976

Query: 1229 PVILLGILDQDVNDTISLVVPQLYR 1253
            PV  L  LD D++++++ + P+LY+
Sbjct: 977  PVFSL-TLDHDIDESLTKIYPELYK 1000

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 61/125 (48%), Gaps = 8/125 (6%)

Query: 152 RSTNRADQLRTVYHNLPLPEEMLDEEGNPIME---YPRNKIRTTKYTPLSFFPKNLLFQF 208
           RSTN + +L   +      E  +  +  PI +   YP N I   KY P++F P  L  QF
Sbjct: 136 RSTNSSIELTDQH-----VEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQF 190

Query: 209 QNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNT 268
           + F N+YFL++ +  A     +       VPL  ++++T  K+ ++D +R   D E NN 
Sbjct: 191 KFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNE 250

Query: 269 RTHIL 273
              +L
Sbjct: 251 LYEVL 255

>Scas_704.38
          Length = 1161

 Score =  345 bits (885), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 256/865 (29%), Positives = 433/865 (50%), Gaps = 130/865 (15%)

Query: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454
            K +KVGD+++I   D +PAD++LL +S+  G  +++T  LDGET+ K+R A   +  + T
Sbjct: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNL-T 336

Query: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514
              D+   +  I +  P   ++++ G + +KD+++N     P++I+N L     L +T + 
Sbjct: 337  EPDLMN-KVSITASAPEKAIHNFLGKVTYKDTSSN-----PLSIDNTLWANTVLASTGFC 390

Query: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574
            +G VV+TG DT+  +N      K   +  E+N    I    +F L  I            
Sbjct: 391  IGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSII------------ 438

Query: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634
                        AG   ++ ++     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 439  --------LVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTI 490

Query: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 694
                +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 491  PETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY--------- 535

Query: 695  GLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGR 754
                            E  +I  D    ++ L N SN+       +   S+   +D   R
Sbjct: 536  --------------TSETLDIVSD---YVDALVNSSNSANPSGKSVPSTSR---KDLSAR 575

Query: 755  NGDIQKKCCEHFMLALALCHSVLTEPSPT-NPNKLEMKAQSPDEAALVTTARDLGFCFMG 813
              D+        ++ LA+CH+V    +PT   ++L  +A SPDE A+V     +G     
Sbjct: 576  VRDM--------VVTLAICHNV----TPTFEDDELTYQAASPDEIAIVKFTESVGLSLFK 623

Query: 814  KTK--TGMVVEIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPR--ALLICKGA 869
            + +    ++    G    +EIL +  FNS  KRM  I+       +DE +     + KGA
Sbjct: 624  RDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIV-------HDEQKDEYWFMQKGA 676

Query: 870  DSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIA 929
            D+V+      +  EN++ L E+T       A EGLRTL + +++L+ + Y ++   YD A
Sbjct: 677  DTVM-----ARIVENNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDYDDA 727

Query: 930  AASLTNREEQLE-IVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDK 988
            + S+ NR++Q+  +++  +E DL LLG T +ED+LQ+ V  SI LL  AGIK+W+LTGDK
Sbjct: 728  SLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDK 787

Query: 989  VETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEM 1048
            VETA  +  S  L++    + ++    +        P   +N L  +YL+   G      
Sbjct: 788  VETARCVSISAKLISRGQYVHIITKLTK--------PEGALNQL--EYLKVNKGA----- 832

Query: 1049 ELDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAA 1108
                             ++IDG++L + L     KR+F  +      V+ CR +P QKA 
Sbjct: 833  ----------------CLLIDGESLGMFLRY--YKREFFDVVICLPTVVACRCTPQQKAD 874

Query: 1109 VVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRL 1168
            V  +++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I +F +LT L
Sbjct: 875  VALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTEL 934

Query: 1169 LLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSI 1228
            LL HGR SYKR +++     ++ ++  +    Y I + F+   L++   ++ Y   +T  
Sbjct: 935  LLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMA 994

Query: 1229 PVILLGILDQDVNDTISLVVPQLYR 1253
            PV  +  LD D+ ++++ + P+LY+
Sbjct: 995  PVFSM-TLDHDIEESLTKIYPELYK 1018

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%)

Query: 184 YPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVI 243
           YP N+I   KY   +F P  L  QF+ F N+YFLV+ +  A     +       VPL  +
Sbjct: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239

Query: 244 VIITAIKDGIEDSRRTILDLEVNNTRTHIL 273
           + +T  K+ ++D +R   D E N+   H+L
Sbjct: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVL 269

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score =  338 bits (868), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 255/866 (29%), Positives = 423/866 (48%), Gaps = 133/866 (15%)

Query: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454
            K +KVGD+++I     +PAD+ILL +S+  G  +++T  LDGET+ K+R A  C+     
Sbjct: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIA--CTLTQNL 319

Query: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514
            + D    +  I +  P  +++S+ G + +KD+  + L     TI+N L     L ++ + 
Sbjct: 320  NEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGL-----TIDNTLWANTVLASSGFC 374

Query: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574
            +G V++TG DT+  +N      K   +  E+N    I    +FIL  +  +  G+  D  
Sbjct: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHND-- 432

Query: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634
                              + +V     +IL+ +++P+SL +++++ K+  A  I  D   
Sbjct: 433  ------------------DWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD--- 471

Query: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 694
               K       ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 472  ---KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSY--------- 519

Query: 695  GLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGR 754
                            E  +I  D    + + +N         D +T +         G 
Sbjct: 520  --------------TTETADIVSDYIQGMIESKN---------DSVTNL---------GP 547

Query: 755  NGDIQKKCCEH---FMLALALCHSVLTEPSPT-NPNKLEMKAQSPDEAALVTTARDLGFC 810
                +K    H    +  LA+CH+V    +PT   ++L  +A SPDE A+V     +G  
Sbjct: 548  RSTTRKDAATHVIDLITTLAICHNV----TPTFEDDELTYQAASPDEIAIVKFTESVGLS 603

Query: 811  FMGKTKTGMVV--EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKG 868
               + +  M +  E  G    +++L +  FNS  KRM  I+         + +   + KG
Sbjct: 604  LFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWFLQKG 658

Query: 869  ADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDI 928
            AD+V+      +   N++ L E+T       A EGLRTL + +++LT   Y ++   Y+ 
Sbjct: 659  ADTVM-----NRIVANNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKKEYEE 709

Query: 929  AAASLTNREEQL-EIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGD 987
             +AS+ NRE+++   +S  +E DL LLG T +ED+LQ  V  SI LL  AGIK+W+LTGD
Sbjct: 710  VSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGD 769

Query: 988  KVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSE 1047
            KVETA  +  S  L++    + VV    +        P    N L  +YL+         
Sbjct: 770  KVETARCVSISAKLISRGQYVHVVTKLSK--------PEGAFNQL--EYLKVN------- 812

Query: 1048 MELDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKA 1107
                NA            ++IDG++L + L     +++F  +  +   V+ CR +P QKA
Sbjct: 813  ---KNA-----------CLLIDGESLGMFLKY--YRQEFFDVVVHLPTVIACRCTPQQKA 856

Query: 1108 AVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTR 1167
             V  +++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I QF +LT 
Sbjct: 857  DVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTE 916

Query: 1168 LLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTS 1227
            LLL HGR SYKR +++     ++ +I  +    + + + F+   L++   ++ Y   +T 
Sbjct: 917  LLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTM 976

Query: 1228 IPVILLGILDQDVNDTISLVVPQLYR 1253
             PV  L  LD D++++++ + P+LY+
Sbjct: 977  APVFSL-TLDHDIDESLTKMYPELYK 1001

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%)

Query: 184 YPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVI 243
           +P N++   KY  ++F P  L  QF+ F N+YFL++ +  A     +       VPL  +
Sbjct: 164 FPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFV 223

Query: 244 VIITAIKDG 252
           + +T  K+ 
Sbjct: 224 LTVTMAKEA 232

>Kwal_23.5789
          Length = 1133

 Score =  337 bits (864), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 253/863 (29%), Positives = 422/863 (48%), Gaps = 131/863 (15%)

Query: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454
            K +KVGD+++I      PAD++LL +S+  G  +++T  LDGET+ K+R A  C      
Sbjct: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIA--CPLTQHL 311

Query: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514
            S+D    R  I +  P  ++ ++ G L     T  E++++P++++N +       +   A
Sbjct: 312  SQDDLLYRISITASVPEKSINNFLGKL-----TFGEIQSQPLSVDNTMWANTVFASAGTA 366

Query: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574
            +  VV+TG DT+  +N  ++  K   +  E+N    I    +FIL               
Sbjct: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSV------------- 413

Query: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634
                        AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 414  -------ALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTI 466

Query: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 694
                +      ++  I +DLG+IEY+ SDKTGTLTQN ME KK  +  VSY         
Sbjct: 467  PETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY--------- 511

Query: 695  GLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGR 754
                                     D++ + +R +S+N       +   SK   +D  GR
Sbjct: 512  --------------------TMDTMDIVTDYVRAMSDNLN--SSAVPSASK---KDLPGR 546

Query: 755  NGDIQKKCCEHFMLALALCHSVLTEPSPT-NPNKLEMKAQSPDEAALVTTARDLGFCFMG 813
              D+        +L LALCH V    +PT    +L  +A SPDE A+V     +G     
Sbjct: 547  VRDL--------VLTLALCHQV----TPTFEDGELTYQAASPDEIAIVKFTESVGLTLFR 594

Query: 814  KTKTGMVV--EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADS 871
            + +  + +  +  G   E++IL++  FNS  KRM  +I         +     + KGAD 
Sbjct: 595  RDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVI-----FDKQKDEYWFLQKGADV 649

Query: 872  VIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAA 931
            V+     +K  + ++ L E+T       A EGLRTL + ++ L+      +   Y+ A+ 
Sbjct: 650  VM-----SKIVQKNDWLEEETG----NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASL 700

Query: 932  SLTNREEQLE-IVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVE 990
             + NRE  +  ++S  +E DL +LG T +ED+LQ+ V  SI LL  AGIK+W+LTGDKVE
Sbjct: 701  MMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVE 760

Query: 991  TAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMEL 1050
            TA  +  S  L++                  G+  H V     +K  + +  L+  E+  
Sbjct: 761  TARCVSISAKLVSR-----------------GQYVHTV-----TKVNKPEGALTHLELLK 798

Query: 1051 DNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVV 1110
             N             ++IDG++L + L  +  +++F  +  N  AV+ CR +P QKA V 
Sbjct: 799  INTNS---------CLLIDGESLGLYL--EYYRQQFFEIVVNLPAVIACRCTPQQKADVA 847

Query: 1111 KLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLL 1170
              ++         IGDG NDV+MIQSADVG+GI G+EG+QA + +D++I QF +L++LLL
Sbjct: 848  TFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLL 907

Query: 1171 VHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPV 1230
             HGR SYKR +++     ++ ++ ++    Y I + F+   L++   ++ Y   +T  PV
Sbjct: 908  WHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPV 967

Query: 1231 ILLGILDQDVNDTISLVVPQLYR 1253
              L  LD D++++++   P+LY+
Sbjct: 968  FSL-TLDHDIDESLTKTYPELYK 989

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 7/110 (6%)

Query: 171 EEMLDEEGNPIM-------EYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILG 223
           ++ LD E +P         +Y  N I   KY P++F PK L  QF+ F N+YFL++ +  
Sbjct: 136 DQQLDREIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQ 195

Query: 224 AFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHIL 273
           A     +       VPL  ++ +T  K+ ++D +R   D E NN    +L
Sbjct: 196 AIPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVL 245

>Kwal_56.23467
          Length = 280

 Score =  295 bits (756), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 147/301 (48%), Positives = 189/301 (62%), Gaps = 43/301 (14%)

Query: 1257 LRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAV 1316
            +R EWN TKF  YM DGLYQSVI FFFP+L Y + G+V+ NG+GL+HRY+VGI+V +IA 
Sbjct: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60

Query: 1317 FACNLYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSLDLWKAGERIYDSPSFWA 1376
             +CNLYILIHQ+RWDWFS  FI LSC+VV GWTGIW++  TS + +K+   +Y SP +WA
Sbjct: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120

Query: 1377 VFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGDYDHYPVGYDPTDPNRPKISKG 1436
            +FF+GV FCLLPRFT+D + + F P D+ IIRE W +G +D YP  YDPTDPNRP+I+K 
Sbjct: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180

Query: 1437 AKFGERLGQGIVLEDETYA-----GGNVSRDSVFTEEIPMNIISGTDGTPRGFEMSGRTP 1491
                 +L    V E   YA       + SRD+V+TEEIPM  +   D  P  F       
Sbjct: 181  ---DTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPMTFMEADDNNPEPFH------ 231

Query: 1492 DIPQTQWESPEREEQNLLNSPQANVGLGTFEQTVRQSIDRTRDSMLANRELDNRYSVDRA 1551
                                P++N+         R S+DRTR  M A+ ELD RYS++RA
Sbjct: 232  --------------------PRSNI---------RTSLDRTRMQMRASNELDGRYSIERA 262

Query: 1552 R 1552
            R
Sbjct: 263  R 263

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score =  318 bits (816), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 249/900 (27%), Positives = 433/900 (48%), Gaps = 136/900 (15%)

Query: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454
            K +KVGDI+++     +PAD+++L T++ +G  +++T  LDGET+ K+R  L CS     
Sbjct: 271  KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLR--LACSLTQSL 328

Query: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514
            + +       I +  P  +++++ G + +KDST++     P++++N +     L ++   
Sbjct: 329  TENDLLNNITITASAPEHSIHNFLGKITYKDSTSS-----PLSVDNTMWENTVLASSAAC 383

Query: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574
            +  +V+TG +T+  LN   +  K   +  E+N    I    +F+L  +            
Sbjct: 384  ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIM------------ 431

Query: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634
                        AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 432  --------LVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQI 483

Query: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 694
             +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 484  EDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY--------- 528

Query: 695  GLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGR 754
                            E  +I  D    I  + + ++N+               ++   R
Sbjct: 529  --------------TNETMDIVTD---FIQSMNSRTSNST---------PTTTRKNISDR 562

Query: 755  NGDIQKKCCEHFMLALALCHSVLTEPSPT-NPNKLEMKAQSPDEAALVTTARDLGFCFMG 813
              D+        +  LA+CH+V    +PT    +L  +A SPDE A+V     +G     
Sbjct: 563  VIDL--------VTTLAICHNV----TPTFEDGELTYQAASPDEIAIVKFTESVGLSLFR 610

Query: 814  KTKTGMVV--EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADS 871
            + +  + +  +  G++ E++I  +  FNS  KRM  II         +     + KGAD+
Sbjct: 611  RDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVII-----FDKLKQEYWFLQKGADT 665

Query: 872  VIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAA 931
            V+ S +       +ET            ATEGLRTL + +++L+ + + ++   Y  A+ 
Sbjct: 666  VMSSIVVRNDWLEEET---------SNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASL 716

Query: 932  SLTNREEQLE-IVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVE 990
            ++ +RE  ++ +V   +E DL LLG T +ED+LQ  V  SI LL  AGIK+W+LTGDKVE
Sbjct: 717  TMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVE 776

Query: 991  TAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMEL 1050
            TA  +  S  L++    +  V    +        P   ++ L  +YL+            
Sbjct: 777  TARCVSISAKLISRGQYVHTVTKVNK--------PEGALHHL--EYLQ------------ 814

Query: 1051 DNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVV 1110
                        +  ++IDG++L + L       +F  +  N   V+ CR +P QKA V 
Sbjct: 815  ---------VNQNSCLLIDGESLGLYL--QYFPDEFFDIVVNLPTVVACRCTPQQKADVA 863

Query: 1111 KLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLL 1170
              ++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I QF +LT+LLL
Sbjct: 864  VFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLL 923

Query: 1171 VHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPV 1230
             HGR SYK  +++     ++ +I ++    Y I + F+   L++   ++ Y   +T  PV
Sbjct: 924  WHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPV 983

Query: 1231 ILLGILDQDVNDTISLVVPQLYRVGILRLEWN-QTKFLWY---MFDGLYQSVICFFFPYL 1286
              L  LD D++++++ + P+LY+   L    + +T F+W    +F G    +   FF  L
Sbjct: 984  FSL-TLDHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSL 1042

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 56/120 (46%), Gaps = 8/120 (6%)

Query: 153 STNRAD--QLRTVYHNLPLPEEMLDEEGNPIME---YPRNKIRTTKYTPLSFFPKNLLFQ 207
           STN  D  ++    HN+   E  +     PI +   YP N I   KY P +F P  L  Q
Sbjct: 140 STNSVDGNKIELNDHNV---EREIHPATTPIYDRKKYPSNVISNAKYNPFTFIPLILYEQ 196

Query: 208 FQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNN 267
           F+ F N+YFL++ +  A     +       VPL  ++ +T  K+ ++D  R   D E NN
Sbjct: 197 FKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANN 256

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  316 bits (810), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 195/542 (35%), Positives = 292/542 (53%), Gaps = 39/542 (7%)

Query: 880  KAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQ 939
            K  +N+E +LEKT   +++++TEGLRTL  + + +   EY  W A+Y  A  SLTNR  Q
Sbjct: 928  KLIKNEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQ 987

Query: 940  LEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSC 999
            +  V   IE DL LLG TAIED+LQ+GVPE+I  +  AGIK+W+LTGDK ETAINIG++C
Sbjct: 988  IAEVGGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYAC 1047

Query: 1000 NLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSF 1059
             L+ +   ++++K   ++              LISK       ++    ELD  K  H  
Sbjct: 1048 KLIYDYSTVVILKKNDDN--------------LISK-------MTALGEELDTGKIAHC- 1085

Query: 1060 PKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVK-NTLD 1118
                  +VIDG +L +      M   F+ LC    +V+CCR SP+QKA +V  ++    D
Sbjct: 1086 -----VLVIDGASLAVFENNPTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKD 1140

Query: 1119 VMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYK 1178
            ++TLAIGDG+ND+AMIQSAD+G+GI G+EG QA   SDY+I QFRYL +LL VHGR++Y 
Sbjct: 1141 LVTLAIGDGANDIAMIQSADIGVGITGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYV 1200

Query: 1179 RLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQ 1238
            R S+ +   FYK V+F L    Y     F G+ L+E   L  +N  FTS+PVI +G+ ++
Sbjct: 1201 RTSKFVLCTFYKEVLFYLTQMIYQRQTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEK 1260

Query: 1239 DVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNG 1298
            D+     L VP+LY +G     +N   FL +M      SV+  F  + ++   G   ++ 
Sbjct: 1261 DLKPMTLLAVPELYTMGQKCQAFNLKIFLVWMLTAAGISVLITFLNFEIW---GFTAQSD 1317

Query: 1299 MGLEHRYYVGIIVTTIAVFACNLYI-LIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFT 1357
              +   Y +G+I  T   F  N+    I     +W +   + +SCI  I W  +    + 
Sbjct: 1318 NSI---YPIGVINFTSICFLINVKCQFIETRNRNWLAFASLLISCIGWILWCCLLPGIYG 1374

Query: 1358 SLDLWKAGERIYDS----PSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKR 1413
               ++     +Y       ++WA   I + F ++       +     P+D  I  E+ ++
Sbjct: 1375 ENAIYDVLIGLYHQFGRDITWWASCLILIMFPMMIDIVCQTFRAMIWPTDGDIFAELEQK 1434

Query: 1414 GD 1415
             D
Sbjct: 1435 DD 1436

 Score =  251 bits (642), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 174/549 (31%), Positives = 286/549 (52%), Gaps = 75/549 (13%)

Query: 381 LPPRTDTRFARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNL 440
           L  + D    +  WK +KVG+ V ++++D +PADI+LLST   +   +VET  LDGETNL
Sbjct: 261 LRSQFDIHIKKKEWKDLKVGEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNL 320

Query: 441 KVRQAL-KCSYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTIN 499
           K +  L + + ++ ++  ++        E P+ +LY+++G ++     + EL   P+  +
Sbjct: 321 KSKNPLPELAKRMTSATGLSMHSATTTLEDPNNDLYNFEGTVE----IDGELY--PLGSD 374

Query: 500 NMLLRGCTLRNTKWAMGIVVFTGDDTKIMLNAGVTP-TKKSRISRELNFSVLINFLVLFI 558
           N++ RG  LRNT+  +GIV+FTG++TKI +NA   P TK  ++  ++N  VL    V+  
Sbjct: 375 NVVYRGSILRNTQSIVGIVIFTGEETKIRMNAIKNPRTKAPKLQGKINLIVLFMVFVVAA 434

Query: 559 LCFISGLANGIDYDKH-PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISV 617
           +   S L   I    +   +R ++ F   AG   T   +SF   +I+Y +L+P+SLY++ 
Sbjct: 435 MAMFSYLGQHILKKNYVDNNRAWYLFQEDAGTAPT--IMSF---IIMYNTLIPLSLYVTT 489

Query: 618 EIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKK 677
           EIIK  Q+  +  D+ +Y+ + D PC  ++  I ++LGQ+ YIFSDKTGTLT N M F+K
Sbjct: 490 EIIKAMQSKLMEWDIDMYHIESDTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRK 549

Query: 678 CTINGVSY----------------------GRAYTEAL---AGLRKRQGIDVEAEGRR-- 710
            +I G S+                       R++       +   K     +E +G    
Sbjct: 550 FSICGSSWLHEIDEDLIDPIDDDIDVISIEDRSFLNEFDLRSTHSKNPRTSIEYKGNSGA 609

Query: 711 ------------EKEEIAKDRDVMINDLRNLS---NNTQFFPDEITFISKEIVQDFKGRN 755
                       +++E+A+D +    +    S   N  +   D + +I K    +F  R 
Sbjct: 610 VYSGRPSMALQIQRQELAEDLNTTRTNSSRSSEEKNGLKTTVDLLLYIQKHPNTEFSIR- 668

Query: 756 GDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKT 815
                   + F+L+LALCH+ L + +    + +  ++ SPDE ALVT ARD+GF    + 
Sbjct: 669 -------AKFFILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRN 721

Query: 816 KTGMVVEI-------QGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKG 868
            + + +         Q I +++E+L  + F+S RKRMS  +K+    PND+ R LLICKG
Sbjct: 722 SSTLSIATYPNGFDDQPIVEDYEVLEYINFDSQRKRMSVAVKM----PNDDDRVLLICKG 777

Query: 869 ADSVIYSRL 877
           AD+VI  RL
Sbjct: 778 ADNVILERL 786

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 71/158 (44%), Gaps = 7/158 (4%)

Query: 121 NMSRNKTLKWAKKNIKNPFDDFSRDEEEENDRSTNRA-----DQLRTVYHNLPLPEEMLD 175
           N+  N+T K  K +++    D   +        + R      D+   +Y        ++D
Sbjct: 50  NLPSNQTKKRKKLSLRTKIMDLILNRTTHLSSESGRVIPICLDKNSVLYQQYARSNLLID 109

Query: 176 EEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGL 235
           E  +    Y  N I +++YT  SF P+ L  QF   AN YFL++ IL     +  T    
Sbjct: 110 ERTD--RPYRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYT 167

Query: 236 SAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHIL 273
           + VPL + + I+  ++  +D +R  LD E NN  T +L
Sbjct: 168 TIVPLSIFLSISMAREAWDDFKRHRLDKEENNKSTKVL 205

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  315 bits (808), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 189/545 (34%), Positives = 294/545 (53%), Gaps = 53/545 (9%)

Query: 884  NDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIV 943
            N+E +LEKT   +E ++TEGLRTL  A + ++  ++ +W  RY  A  SL+ R+++++ V
Sbjct: 953  NEEYVLEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEV 1012

Query: 944  SDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN 1003
               IE +L LLG TAIED+LQ+GV E+I  +  AGIK+W+LTGDK ETAINIG+SC L++
Sbjct: 1013 GAQIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIH 1072

Query: 1004 NDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGD 1063
            +   ++++ T+ E++              ISK       ++    E+D+    H      
Sbjct: 1073 DYSTVVILTTSDENI--------------ISK-------MNAISQEVDSGNVAHC----- 1106

Query: 1064 FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNT-LDVMTL 1122
              +VIDG  L +      +   F  LC    +V+CCR SPAQKA +V  ++NT   ++TL
Sbjct: 1107 -VIVIDGATLAMFEDNPTLMSVFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTL 1165

Query: 1123 AIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLSE 1182
            AIGDG+ND+AMIQSAD+G+GIAG+EG QA   +DY+IGQFR++ +LLLVHGR++Y R ++
Sbjct: 1166 AIGDGANDIAMIQSADIGVGIAGKEGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTAK 1225

Query: 1183 MIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVND 1242
             I   FYK + F L    Y  Y  F G+ L+E   L  YN  FTS+PV+ +G+ ++D+  
Sbjct: 1226 FILCTFYKELTFYLTQLIYQRYTMFSGTSLYEPWSLSMYNTLFTSLPVLCVGMFEKDLKP 1285

Query: 1243 TISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLE 1302
               L VP+LY +G L   +N + F  ++F G   ++I  F   + +     ++ N +   
Sbjct: 1286 VTLLTVPELYSMGRLSKAFNWSIFAEWVFLGTANALIITFLNIVAWGETS-LSDNTL--- 1341

Query: 1303 HRYYVGIIVTTIAVFACNLYI-LIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSLDL 1361
              Y +G +  +  V   N+    I     +W +   + LSC       G W     +L +
Sbjct: 1342 --YPLGFVNFSATVALINVKAQFIEMRNRNWLAFTSVILSC-------GGWLVWCCALPI 1392

Query: 1362 WKAGERIYDSP-----------SFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREM 1410
                + IYD             +FW    I     ++    +  +     PSD  I  E+
Sbjct: 1393 LNRSDGIYDVTYGLYHHFGRDITFWCTSLILAVLPIIVDVVYKTFKIMLAPSDSDIFAEL 1452

Query: 1411 WKRGD 1415
             ++ +
Sbjct: 1453 EQKSE 1457

 Score =  258 bits (659), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 217/774 (28%), Positives = 362/774 (46%), Gaps = 150/774 (19%)

Query: 174 LDEEGNPIME-----YPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIF 228
           +D  GN + E     Y  N I +++YT +SFFP+ L  QF   ANVYF    I+   Q+ 
Sbjct: 108 VDRHGNLVDERYGYAYCNNLITSSRYTIISFFPRQLYAQFSKLANVYFF---IVAILQMI 164

Query: 229 GVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEGXXXXXXXXXXXXL 288
               PG S       ++   +   I  +R    D      R H L+              
Sbjct: 165 ----PGWSTTGTYTTIVPLCVFMAISMAREAYDDY-----RRHKLD-------------- 201

Query: 289 WRRFKKANSRLLMQFIQWCKERMTEDGXXXXXXXXXXXXXXSTRNGHGPRNSLDSMDSYR 348
               K+ N++L  + +Q   ER   D                  N     N+ +S+ +  
Sbjct: 202 ----KEENNKL-TKVLQILHEREDND-------------LDLENNAQHSANNPESISNL- 242

Query: 349 PSADYYNRPSLDYDNMGHXXXXXXXXXXXXRTLPPRTDTRFARDYWKSVKVGDIVRIHNN 408
               Y+N   L                     L  + + R     WK ++VGD V +  +
Sbjct: 243 ----YFNNFDL---------------------LAKKYNVRIVEKKWKDIRVGDFVLLQQD 277

Query: 409 DEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKI-KTSRDIARTRFWIES 467
           D +PADI++L++   +   ++ET  LDGETNLK +       K+ K++  +A     +  
Sbjct: 278 DWVPADILILTSDGDNSEVFIETMALDGETNLKGKVPHPEINKLTKSASGLANINAQVTV 337

Query: 468 EGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIVVFTGDDTKI 527
           E P+ +LY+++GNL+    ++++ +  P+  +N++ RG  +RNT+  +G+V+FTG+++KI
Sbjct: 338 EDPNNDLYNFEGNLELNSGSSSK-KKYPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKI 396

Query: 528 MLNAGVTP-TKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH-PRSRDFFEFGT 585
            +NA   P TK  ++ R++N  V+    V+  +   S L + I   ++   ++ ++    
Sbjct: 397 RMNALRNPRTKAPKLQRKINMIVVFMVFVVACMSLFSYLGHTIQIKRYVNNNKAWYLLQE 456

Query: 586 VAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTP 645
            AG   T   +SF   +I+Y +++P+SLY+++E+IK AQ+  +  D+ +Y+A+ D PC  
Sbjct: 457 DAGTAPT--IMSF---IIMYNTIIPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTPCAV 511

Query: 646 KSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEAL-----AGLRKRQ 700
           ++  I ++LGQ+ YIFSDKTGTLT N M F+K +  G S+    T+ +     A L  + 
Sbjct: 512 RTATILEELGQVSYIFSDKTGTLTDNKMLFRKLSFCGTSWVHNATQDISEFKPAQLSNKN 571

Query: 701 GIDV---------------------------EAEGRREKEEIAKDRDVMIN---DLRNL- 729
            IDV                           +   RR   E   +  V       +R+L 
Sbjct: 572 DIDVISIDDQSFLSKLGYTSQSNPKRYMDINDFPDRRTSVEYKGNATVKYTGRPSMRSLY 631

Query: 730 -----------SNNTQFFPDEI--TFISKEIVQDFKGRNGDIQKKCCEHFMLALALCHSV 776
                      S +    P++I  TF   E++   +     +  K  + F+L+LA+CH  
Sbjct: 632 VPPKKETNASNSQDASDIPEDIKSTF---ELIYYIQSNPKSLFAKKAKMFILSLAICHIC 688

Query: 777 L---TEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVVEI--QGIQ---- 827
           L   TE      + +E ++ SPDE ALVT ARD+G+    +    + ++    G      
Sbjct: 689 LPKRTEEGNDEDDIIEYQSSSPDELALVTAARDMGYIVYNRNANILTLKTFPDGFDELPR 748

Query: 828 -KEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTK 880
            + FEIL +++FNS RKRMS I+++    P ++ R LL CKGAD+VI  RL  K
Sbjct: 749 FENFEILELVDFNSQRKRMSVIVRV----PEEKDRVLLFCKGADNVILERLHNK 798

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  308 bits (789), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 191/547 (34%), Positives = 292/547 (53%), Gaps = 57/547 (10%)

Query: 884  NDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIV 943
            N+E ++E+T   +++++TEGLRTL  A + +   +Y  WN RY  A  SLT+R+ +++  
Sbjct: 1013 NEEYVIERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEA 1072

Query: 944  SDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN 1003
               IE  L LLG TAIED+LQDGV E+I  +  AGIK+W+LTGDK ETAINIG+SC L+ 
Sbjct: 1073 GAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIK 1132

Query: 1004 NDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGD 1063
            +   ++++ T  E++              ISK       ++    E+D+    H      
Sbjct: 1133 DYSTVVILTTTDENI--------------ISK-------MNAVSQEVDSGNIAHC----- 1166

Query: 1064 FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNT-LDVMTL 1122
              VVIDG  + +          F+ LC    +V+CCR SP+QKA +V  ++NT  +++TL
Sbjct: 1167 -VVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTL 1225

Query: 1123 AIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLSE 1182
            AIGDG+ND+AMIQSAD+G+GIAG+EG QA   SDY+IGQFR+L +LL VHGR++Y R S+
Sbjct: 1226 AIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLLFVHGRYNYIRTSK 1285

Query: 1183 MIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVND 1242
             +   FYK + F      Y  Y  F GS L+E   L  +N  FTS+PV+ +G+ ++D+  
Sbjct: 1286 FMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKP 1345

Query: 1243 TISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLE 1302
               L VP+LY  G L   +N   F+ ++      S+I  F   +++  +  ++ N M   
Sbjct: 1346 MTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLNVVMWGMSS-LSDNTM--- 1401

Query: 1303 HRYYVGIIVTTIAVFACNL---YILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSL 1359
              Y +G+I  T  V   N+   ++ +H   W  F+   + LSC       G W     +L
Sbjct: 1402 --YPLGLINFTAIVALINVKSQFVEMHNRNWLAFTS--VVLSC-------GGWLVWCCAL 1450

Query: 1360 DLWKAGERIYDSP-----------SFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIR 1408
             +    ++IYD             +FW    +     +     +  +     PSD  I  
Sbjct: 1451 PILNNTDQIYDVAYGFYNHFGKDITFWCTSLVLALLPITLDIVYKTFKVMIWPSDSDIFA 1510

Query: 1409 EMWKRGD 1415
            E+ ++ D
Sbjct: 1511 ELEQKSD 1517

 Score =  236 bits (601), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 205/781 (26%), Positives = 344/781 (44%), Gaps = 135/781 (17%)

Query: 172 EMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVT 231
            ++DE  N    Y  N+I +++YT  SF P+ L  QF   AN YF ++ +L     +  T
Sbjct: 128 HLIDERFNK--PYCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTT 185

Query: 232 NPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEGXXXXXXXXXXXXLWRR 291
               + +PL V +       GI  +R    D      R H L+                 
Sbjct: 186 GTYTTIIPLCVFM-------GISMTREAWDDF-----RRHRLD----------------- 216

Query: 292 FKKANSRLLMQFIQWCKERMTEDGXXXXXXXXXXXXXXSTRNGHGPRNSLDSMDSYRPSA 351
            K+ N++ +   ++        DG                     P + + S      SA
Sbjct: 217 -KEENNKPVGVLVK--------DGNNDAQEVYTL-----------PSSVVSSTAYLTKSA 256

Query: 352 DYYNRPSLDYDNMGHXXXXXXXXXXXXRTLPPRTDTRFARDYWKSVKVGDIVRIHNNDEI 411
              N P L+ D                  L  + +    +  W+ ++VGD V +  +D +
Sbjct: 257 AAENNPPLNDDRNSSQGHFLDTHFNNFELLKNKYNVHIHQKKWEKLRVGDFVLLTQDDWV 316

Query: 412 PADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKI-KTSRDIARTRFWIESEGP 470
           PAD++LL+    +  C+VET  LDGETNLK +Q      K+ K +  +A     +  E P
Sbjct: 317 PADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAASGLANINAQVTVEDP 376

Query: 471 HANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIVVFTGDDTKIMLN 530
           + +LY+++GNL+ K+  N+ +   P+  +N++ RG  LRNT+  +G+V+F+G++TKI +N
Sbjct: 377 NIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNVVGMVIFSGEETKIRMN 436

Query: 531 AGVTP-TKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH-PRSRDFFEFGTVAG 588
           A   P TK  ++ R++N  ++    V+  +   S L + +   K+  +++ ++ F   AG
Sbjct: 437 ALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHKKKYIDQNKAWYLFQADAG 496

Query: 589 NPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPK-- 646
              T   +SF   +I+Y +++P+SLY+++EIIK  Q+  +  D+ +Y+A+ + PC  +  
Sbjct: 497 VAPT--IMSF---IIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTA 551

Query: 647 -----------------------------------SWNISDDLGQIEYIFSDK---TGTL 668
                                              SW  + DLG  E  F D    T +L
Sbjct: 552 TILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSWLHNVDLGNSEDNFEDNRDNTNSL 611

Query: 669 TQNVMEFKKCTINGVSYGR-------AYTEALAGLRKRQGIDVEAEGRREKEEIAKD--- 718
                     +I+ VS G         +++A      R  +D   + R   E        
Sbjct: 612 RLPPKAHNGSSIDVVSIGDQNVLDRLGFSDAPIEKGHRPSLDNFPKSRNSIEYKGNSSAI 671

Query: 719 -------RDVMINDLRNLSNNTQFFPDEITFI-----SKEIVQDFKGRNGDIQKKCCEHF 766
                  R +   D  +LS          TF      S +++Q  +     +  +  + F
Sbjct: 672 YTGRPSMRSLFGKDNSHLSKQASVISPSETFSENIKSSFDLIQFIQRYPTALFSQKAKFF 731

Query: 767 MLALALCHSVL---TEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVVEI 823
            L+LALCHS L   T       + +E ++ SPDE ALVT ARDLG+  + +    + ++ 
Sbjct: 732 FLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQILTIKT 791

Query: 824 -------QGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSR 876
                  +   + +EILN ++FNS RKRMS ++++P   PN   + LLICKGAD+VI  R
Sbjct: 792 FPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQ-PN---QVLLICKGADNVIMER 847

Query: 877 L 877
           L
Sbjct: 848 L 848

>Kwal_23.3556
          Length = 1597

 Score =  304 bits (779), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 202/638 (31%), Positives = 326/638 (51%), Gaps = 80/638 (12%)

Query: 883  ENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEI 942
            +N+E +LE+T   +E ++T GLRTL  + + +   +Y +W+ +Y  A  SL NR+E++  
Sbjct: 951  QNEEFVLERTLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHS 1010

Query: 943  VSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLL 1002
            V + +E  L LLG TAIED+LQ+GV ++I  +  AGIK+W+LTGDK ETAINIG+SCNL+
Sbjct: 1011 VGELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLI 1070

Query: 1003 NNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKG 1062
            ++   ++++    E++                        L+    E++     H     
Sbjct: 1071 HDYSTVVILSAKDENI---------------------SSKLTAVSQEIERGNIAHC---- 1105

Query: 1063 DFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNT-LDVMT 1121
               VVIDG  L    +   +   F+ LC    +V+CCR SP+QKA +V  ++NT   ++T
Sbjct: 1106 --VVVIDGSTLTTFESNPTLMSVFVELCTKTDSVICCRASPSQKALMVTHIRNTDKKLVT 1163

Query: 1122 LAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLS 1181
            LAIGDG+ND+AMIQSAD+G+GIAG+EG QA   SDY+I QFR+L +LLLVHGR++Y R +
Sbjct: 1164 LAIGDGANDIAMIQSADIGVGIAGKEGLQASRSSDYSIAQFRFLLKLLLVHGRYNYVRTT 1223

Query: 1182 EMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVN 1241
            + +   FYK ++F L    Y  +  F G+ L+E   L  +N  FTS+PV+ +G+ ++D+ 
Sbjct: 1224 KFVLCTFYKELLFYLTQMIYQRHTMFSGTSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLK 1283

Query: 1242 DTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGL 1301
                L +P+LY +G L   +N   FL++MF     S+I  F  + ++  +  ++ N +  
Sbjct: 1284 PMTLLAIPELYSIGRLSQSFNLRVFLYWMFLAALNSLIITFLNWKIWAVSS-LSDNTV-- 1340

Query: 1302 EHRYYVGII----VTTIAVFACNLYILIHQYRWDWFSGFFIFLSCIVVIG----WTGIWT 1353
               Y +G+I    + T+    C L +  H              S ++ +G    W  +  
Sbjct: 1341 ---YPIGVINFTAIITLVNVKCQL-LETHN------RNVLAICSLVISVGGWLLWCCLLP 1390

Query: 1354 SSFTSLDLWKAGERIY----DSPSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIRE 1409
              ++   ++     +Y    +  +FW    + V   L+    +        PSD +I  E
Sbjct: 1391 GIYSEDGMYDVLTGLYFQFGNDITFWCACLVLVVLPLIIDVVFKTVKIMIFPSDSEISME 1450

Query: 1410 MWKRGD---------YDHYPVGYDPTDPNRPKISKGAKFGERLGQGIVLEDETYAGGNVS 1460
            + ++ +         Y+    G+   D +R  ISK  +   + G   V   E    GN +
Sbjct: 1451 LEQKDEIRKKLEFKAYNELKQGW-TWDRDRSTISKYTEKFLKWGPSSV---EVNDSGNHT 1506

Query: 1461 RD------SVFTEEIP------MNIISGTDGTPRGFEM 1486
            R       S F  E+P      + + SGT   P  +EM
Sbjct: 1507 RSRKNTIPSAF--ELPAGSPSKVTVRSGTKFDPEQYEM 1542

 Score =  292 bits (747), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 232/785 (29%), Positives = 373/785 (47%), Gaps = 117/785 (14%)

Query: 175 DEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPG 234
           +  G P   Y  N I +++YT  +F P+ L  QF   AN YF ++ +L     +  T   
Sbjct: 102 ERSGKP---YISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTY 158

Query: 235 LSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEGXXXXXXXXXXXXLWRRFKK 294
            + VPL++ + I+  ++  +D RR  LD E N+    +L                  F +
Sbjct: 159 TTIVPLLIFMGISMSREAWDDFRRHKLDREENDKTARVLVKSSSPHT---------EFSR 209

Query: 295 ANSRLLMQFIQWCKERMTEDGXXXXXXXXXXXXXXSTRNGHGPRNSLDSMDSYRPSADYY 354
            NS  L    QW +                     ST     P     +++S   +A   
Sbjct: 210 PNS--LYSLPQWQQS------------------ATSTSMLTNP-----TLESTAEAATSQ 244

Query: 355 NRPSLDYDNMGHXXXXXXXXXXXXRTLPPRTDTRFARDYWKSVKVGDIVRIHNNDEIPAD 414
           N    ++D                  L  +         WK +KVGD V +  ++ +PAD
Sbjct: 245 NDDHTNWD-----------------LLKSKYGVEAVEKKWKDIKVGDYVVLEQDEWVPAD 287

Query: 415 IILLSTSDSDGGCYVETKNLDGETNLKVRQAL-KCSYKIKTSRDIARTRFWIESEGPHAN 473
           +++L+ SD    C+VET  LDGETNLK +Q L + S  +KT+  +   +  +  E P+ +
Sbjct: 288 MLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKTAAGLTEFKAKVTVEDPNID 347

Query: 474 LYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIVVFTGDDTKIMLNAGV 533
           L++++GNL+       E R   +  ++++ RG  +RNT  A+G+VVFTG++TKI +NA  
Sbjct: 348 LHNFEGNLELL----GENRKLTIGPDHIIYRGSIIRNTSNAVGMVVFTGEETKIRMNAIK 403

Query: 534 TP-TKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH-PRSRDFFEFGTVAGNPA 591
            P  K  ++ R +N  VL    V+  +   S L   I   K+   +R ++ F + AG   
Sbjct: 404 NPRIKAPKLQRAINLIVLFMVFVVASMALFSLLGQRIIKKKYVDNNRAWYLFNSDAGLAP 463

Query: 592 TNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNIS 651
           T   +SF   +I+Y +L+P+SLY+++EIIK  Q+  +  D+ +Y+A+ + PC  ++  I 
Sbjct: 464 T--VMSF---IIMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATIL 518

Query: 652 DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGID------VE 705
           ++LGQ+ YIFSDKTGTLT N M F+  ++ G S+   +  A   L K +  D      V 
Sbjct: 519 EELGQVSYIFSDKTGTLTDNKMVFRALSVCGSSWIHDFDPAAEKLTKSESSDSNTVEVVS 578

Query: 706 AEGRREKEEI-AKDRDVMINDLRNL---SNNTQFFPDEITFISKEIVQDFKGRNGDIQK- 760
            + R   +   A DR V  N   ++    N++  +    +  S+   +D   +  + +K 
Sbjct: 579 VDDRSFLQNFGAADRKVPSNHKTSIDYKGNSSAIYTGRPSMASRICEEDKNPKKIEPEKS 638

Query: 761 ------------------------KCCEHFMLALALCHSVLTEPSP--TNPNKLEMKAQS 794
                                   K    F+L+LALCH+ L + S      + +E +A S
Sbjct: 639 SKTGLRSSTELIRYIQQNPNTHFAKKVSFFILSLALCHACLPKSSSGVEGEDCVEYQASS 698

Query: 795 PDEAALVTTARDLGFCFMGKTKTGMVVEI--QGIQKE-----FEILNILEFNSARKRMSC 847
           PDE ALVT ARD+G+  M +    + ++    G   E     +EILN +EF+S RKRMS 
Sbjct: 699 PDELALVTAARDMGYAVMNRNSDVLTIKTYPNGFDAEPHLDKYEILNNIEFSSHRKRMSV 758

Query: 848 IIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTL 907
           ++++    P++E R LLICKGAD+VI  RL      N + ++E      E+ A E    L
Sbjct: 759 LVRL----PHEENRILLICKGADNVILERLHNSDLAN-QKIVELQETTSERKAAEA--DL 811

Query: 908 CLAQR 912
            L QR
Sbjct: 812 VLKQR 816

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  298 bits (763), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 187/536 (34%), Positives = 281/536 (52%), Gaps = 39/536 (7%)

Query: 884  NDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIV 943
            N+E ++E+T   ++ + TEGLRTL  + + +   EY  WN+RY  A A+L NR EQ++ V
Sbjct: 933  NEEYVIERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDTV 992

Query: 944  SDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN 1003
             + IERDL LLG   IED+LQ+GVP++I  L  AGIK+W+LTGDK ETAINIG+SC L++
Sbjct: 993  GEIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIH 1052

Query: 1004 NDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGD 1063
            +   ++++    E+                   +  K      E+E  N           
Sbjct: 1053 DYSTVIILAPNDEN-------------------MASKITTITQEIEAGNV--------AH 1085

Query: 1064 FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVV-KLVKNTLDVMTL 1122
              VVIDG  L I      +   F+ LC    +V+CCR SP+QKA +V K+ K    ++TL
Sbjct: 1086 CVVVIDGATLTIFEGNLTLMTLFIELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTL 1145

Query: 1123 AIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLSE 1182
            AIGDG+ND+AMIQSAD+G+ I G+EG QA   SDY+I QFRYL +LLLVHGR++Y R S+
Sbjct: 1146 AIGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIAQFRYLLKLLLVHGRYNYIRTSK 1205

Query: 1183 MIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVND 1242
             +   FYK  +F L    + I   F G+  +E   L  +N  FTS+PV+ +G+ ++D+  
Sbjct: 1206 FVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTVFNTLFTSLPVLCIGMFEKDLKS 1265

Query: 1243 TISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLE 1302
               L +P+LY  G     +N   FL +M      SVI  F  +  +      + N +   
Sbjct: 1266 VTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALSSVIICFTNWQCWSLTA-QSDNTL--- 1321

Query: 1303 HRYYVGIIVTTIAVFACNLYI-LIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSLDL 1361
              Y +G+I  T  V   N+   L+     +W +    F+S    + W  +  + +    +
Sbjct: 1322 --YPIGLINYTAVVVLVNVKCQLLEMANRNWLAFASFFISVCGWLCWCLLLPAIYKETLV 1379

Query: 1362 WKAGERIYDS----PSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKR 1413
            +   E +Y       +FWA   + V   ++    +        PSD +I  E+ +R
Sbjct: 1380 YDVREGLYHQFGPDITFWATNLVLVLLPVMLDLLFKTCKVIIYPSDTEIFAELEQR 1435

 Score =  191 bits (485), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 181/295 (61%), Gaps = 9/295 (3%)

Query: 394 WKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQAL-KCSYKI 452
           WK V+VG+ V ++ +D +PAD+ LL+T   +  CYVET  LDGETNLK +  L K + + 
Sbjct: 241 WKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGETNLKCKHVLPKIASQT 300

Query: 453 KTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTK 512
           +T+  +A  R     E P+ +LY+++G ++  ++ + E +   + ++N+L RG  +RNT+
Sbjct: 301 RTASGLATFRGMTTVEDPNIDLYNFEGKIE-VETDSGEQQAYSIGLDNVLFRGSIIRNTQ 359

Query: 513 WAMGIVVFTGDDTKIMLNAGVTPTKKS-RISRELNFSVLINFLVLFILCFIS-GLANGID 570
             +G+VVFTG++TKI +NA   P  KS ++  ++N  VL   LV+ I  F+S GL     
Sbjct: 360 TVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLFMILVVAIFSFLSFGLQRFFK 419

Query: 571 YDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYG 630
             +    R ++     AG   T   +SF   +I+Y +L+P+SLY+++EIIK  Q+  +  
Sbjct: 420 NREVDSDRAWYLMKVDAGLAPT--IMSF---IIMYNTLIPLSLYVTMEIIKDMQSRLMEW 474

Query: 631 DVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY 685
           D+ +Y+ + +  CT ++  I ++LGQ+ YIFSDKTGTLT N M F+K +  G ++
Sbjct: 475 DIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRKFSFCGTAW 529

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 75/124 (60%), Gaps = 17/124 (13%)

Query: 766 FMLALALCHSVLTE----PSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVV 821
           F+LALALCH+ L +        + + +E ++ SPDE ALVT ARD+G+  + +    + +
Sbjct: 653 FILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGDELTI 712

Query: 822 -------EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEP-RALLICKGADSVI 873
                  E   + +++E+LN ++F+S RKRMS ++++     +  P + LLICKGAD+VI
Sbjct: 713 KTYPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRM-----HQHPEKVLLICKGADNVI 767

Query: 874 YSRL 877
             RL
Sbjct: 768 LERL 771

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 46/92 (50%)

Query: 182 MEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLI 241
           + Y  N I +++Y+  SF P+ L  QF    N YF  + IL     +  T    + VPL 
Sbjct: 108 LPYIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTIVPLS 167

Query: 242 VIVIITAIKDGIEDSRRTILDLEVNNTRTHIL 273
           + + I+  ++G ED RR  LD E NN    +L
Sbjct: 168 IFMGISIAREGWEDFRRHKLDREENNKLVKVL 199

>Scas_669.3
          Length = 1638

 Score =  296 bits (759), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 203/627 (32%), Positives = 321/627 (51%), Gaps = 74/627 (11%)

Query: 884  NDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIV 943
            ND  ++EKT   +++++TEGLRTL  + + +   EY +W  RY  A  SLTNR+ ++  V
Sbjct: 987  NDGYVIEKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEV 1046

Query: 944  SDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN 1003
             + IE+DL LLG TAIED+LQ+GV E+I  +  AGIK+W+LTGDK ETAINIG+SC L+ 
Sbjct: 1047 GEEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIY 1106

Query: 1004 NDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGD 1063
             D   +V+   G++             ++ISK       ++    E+D+    H      
Sbjct: 1107 -DYSTVVILAKGDE-------------NIISK-------MNAISQEVDSGNVAHC----- 1140

Query: 1064 FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNT-LDVMTL 1122
              ++IDG  L +      +   F+ LC    +V+CCR SP+QK+ +V  ++N+  +++TL
Sbjct: 1141 -VIIIDGSTLAMFEGNPTLMSVFIELCTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTL 1199

Query: 1123 AIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLSE 1182
            AIGDG+ND+AMIQSAD+GIGI G+EG QA   +DY+I QFR++ +LLLVHGR++Y R ++
Sbjct: 1200 AIGDGANDIAMIQSADIGIGIGGKEGLQASRTADYSIAQFRFILKLLLVHGRYNYIRTAK 1259

Query: 1183 MIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVND 1242
             I   F+K + F L    +  Y  F GS L+E   L  +N  FTS+PV+ +G+ ++D+  
Sbjct: 1260 FILCTFFKEITFYLTQLIFQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKP 1319

Query: 1243 TISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLE 1302
               L +P+LY +G L   +N   F  ++      +++  F   +++    +        +
Sbjct: 1320 MTLLTIPELYSMGRLSQGFNLIIFGEWVIQAAAYALLITFLNIIIWGETALS-------D 1372

Query: 1303 HRYY-VGIIVTTIAVFACNL---YILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTS 1358
            H  Y +G+I  T  V   N+   +I ++   W  F+   + LSC       G W     +
Sbjct: 1373 HTMYPLGVINFTAIVALVNVKCQFIEMNNRNWVVFTS--VILSC-------GGWLVWCCA 1423

Query: 1359 LDLWKAGERIYDSP-----------SFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQI- 1406
            L +    + IYD P           ++W   F+     +     +  +     PSD  I 
Sbjct: 1424 LPILNRSDVIYDVPYGFFYHFGKDITWWCSCFVLAVLPITIDIVYQTFKTMIWPSDADIF 1483

Query: 1407 --------IREMWKRGDYDHYPVGYD-PTDPNRPKISKGAKFGERLGQGIVLEDETYAGG 1457
                    IR+  + G Y+    G+    DPN  K  K          G   ++E   G 
Sbjct: 1484 SVLEQKSEIRKKLEMGAYNEMKQGWTWEHDPNAFKRYKEKILTAHSRSGSYTDEEMEIGT 1543

Query: 1458 NVSRDSVFTE-----EIPMNIISGTDG 1479
                  VF++     E+P+N+ S  +G
Sbjct: 1544 REGNPKVFSKTTMKAEVPLNVQSKMNG 1570

 Score =  261 bits (666), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 181/564 (32%), Positives = 293/564 (51%), Gaps = 77/564 (13%)

Query: 381 LPPRTDTRFARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNL 440
           L  R   R     W ++ VGD V +  ++ +PADI++L++   +  C+VET  LDGETNL
Sbjct: 272 LEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNECFVETMALDGETNL 331

Query: 441 KVRQALKCSYKIKTSRD-IARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTIN 499
           KV+Q      K+  S   +A     I  E P+++LY+++GNL+  D+ NN L+  PV  +
Sbjct: 332 KVKQPHPELNKLACSASGLANINALITVEDPNSDLYNFEGNLELTDNNNNSLKKYPVGPD 391

Query: 500 NMLLRGCTLRNTKWAMGIVVFTGDDTKIMLNAGVTP-TKKSRISRELNFSVLINFLVLFI 558
           N+  RG  +RNT   +G+V++TG +TKI +NA   P TK  ++ + +N  +     V+ +
Sbjct: 392 NVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALNNPRTKAPKLQKNINIIITFMVFVVAV 451

Query: 559 LCFISGLANGIDYDKH-PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISV 617
           +   S L + +   K    ++ ++     AG   T   +SF   +I+Y +++P+SLY+++
Sbjct: 452 ISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAAPT--IMSF---IIMYNTIIPLSLYVTM 506

Query: 618 EIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKK 677
           EIIK  Q+  +  D+ +Y+++ + PC  ++  I ++LGQ+ Y+FSDKTGTLT N M F+K
Sbjct: 507 EIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTGTLTDNKMIFRK 566

Query: 678 CTINGVSYGRAYTEALAGLRK------RQGIDVEAEGRRE------KEEIAKDRDVMIN- 724
            +I G S+  +       L K         IDV +   +       K E + + D   N 
Sbjct: 567 FSICGSSWLHSTDLGSNALYKGSPNSNNSDIDVVSLENQSLLDKFVKTEGSTELDARTNF 626

Query: 725 ---------------------DLRNL--------------SNNTQFFPDEITFISKEIVQ 749
                                 +R+L              S  T   PD I   S +++Q
Sbjct: 627 PNFRASVEYKGTSSAVYTGRPSMRSLYPQDLHLTPNPSRSSRGTSDAPDNIK-TSFDLIQ 685

Query: 750 DFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTN-----PNKLEMKAQSPDEAALVTTA 804
             +     +  K  + F+L+LALCH+ L  P  +N      + +E ++ SPDE ALVT A
Sbjct: 686 FIQHNPNTLFAKKAKFFILSLALCHTCL--PKKSNFPEGGEDVIEYQSSSPDELALVTAA 743

Query: 805 RDLGFCFMGKTKTGMVV-------EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPN 857
           RDLG+  + K    + +       E + I ++++ILN ++FNS RKRMS ++K P     
Sbjct: 744 RDLGYVVLNKNADVLTIKTYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLVKTP----- 798

Query: 858 DEP-RALLICKGADSVIYSRLSTK 880
           DEP + LLICKGAD++I  RL  +
Sbjct: 799 DEPNKVLLICKGADNMILERLQDR 822

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 54/101 (53%), Gaps = 2/101 (1%)

Query: 173 MLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTN 232
           ++DE  + +  Y  N I +++YT  SFFPK L  QF   ANVYF V+ IL     +  T 
Sbjct: 131 LIDERTSSV--YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTG 188

Query: 233 PGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHIL 273
              + VPL + + I+  ++  +D RR  LD E NN    IL
Sbjct: 189 TYTTIVPLCIFMGISMAREAWDDFRRHRLDKEENNKTCSIL 229

>Scas_505.4
          Length = 1025

 Score =  230 bits (586), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 144/444 (32%), Positives = 230/444 (51%), Gaps = 18/444 (4%)

Query: 989  VETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLRE----KFGLS 1044
            VE  IN+     L    + L+++ + G  ++   ++ H  ++ L  +Y R     +F   
Sbjct: 479  VERVINLQIVA-LFGVLIVLVLISSLGNAIISSTQEKH--LSYLYGRYSRPVVEFEFHTR 535

Query: 1045 GSEMELDNAKGDHSFPKGD---FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRV 1101
             +  +   A  +H   + +    A+VIDG +L  AL  D ++   L L K CKAV+CCRV
Sbjct: 536  KNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESD-LEDYLLALGKICKAVVCCRV 594

Query: 1102 SPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQ 1161
            SP QKA VVK+VK     + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D A+GQ
Sbjct: 595  SPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQ 654

Query: 1162 FRYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFY 1221
            FR+L +LLLVHG WSY+R+S  I   FYKN    +  FW+   N F G  + E   + +Y
Sbjct: 655  FRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYY 714

Query: 1222 NLAFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICF 1281
            N+ FT  P  ++G+ DQ V+  +    PQLY++G     ++   F  ++ +G Y S + +
Sbjct: 715  NVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVY 774

Query: 1282 FFPYLLYKRNGVVTKNGMGLEH-RYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFL 1340
                L Y+    +  +G   +H  + + +  ++I +      ++ +Q  W  F+ F I  
Sbjct: 775  IGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQ--WTKFTLFAIPG 832

Query: 1341 SCIVVIGWTGIWTSSF----TSLDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFTWDCYT 1396
            S I  + +  I+ S F     S + +   +  Y S +FW    +   F L+  F W  Y 
Sbjct: 833  SFIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYR 892

Query: 1397 QFFNPSDVQIIREMWKRGDYDHYP 1420
            + + P    +++EM K    D+ P
Sbjct: 893  RMYEPESYHLVQEMQKFNISDNRP 916

 Score =  158 bits (399), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 74/181 (40%), Positives = 118/181 (65%), Gaps = 6/181 (3%)

Query: 389 FARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKC 448
           F    W  ++ GD++R+ + + IPAD+I++S+S+ +G CY+ET NLDGETNLK++QA   
Sbjct: 333 FIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPE 392

Query: 449 SYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTL 508
           + ++  SR +   +  + SE P+++LY+Y+G L++ +      R  P++   M+LRG TL
Sbjct: 393 TAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNN------RKIPLSPEQMILRGATL 446

Query: 509 RNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANG 568
           RNT W  G+V+FTG +TK+M NA  TP K++ + R +N  ++  F VL +L  IS L N 
Sbjct: 447 RNTSWMFGLVIFTGHETKLMRNATATPIKRTAVERVINLQIVALFGVLIVLVLISSLGNA 506

Query: 569 I 569
           I
Sbjct: 507 I 507

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 2/105 (1%)

Query: 170 PEEML--DEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQI 227
           P E+   D   N    Y  N I TTKY   +F PK L  +F  +AN++FL    +     
Sbjct: 221 PREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPH 280

Query: 228 FGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHI 272
              TN   +   L+V++I++A K+ IED +R   D E+NN++T I
Sbjct: 281 VSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEI 325

>Scas_89.1
          Length = 271

 Score =  160 bits (404), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 157/290 (54%), Gaps = 34/290 (11%)

Query: 919  YTEWNARYDIAAASLTNREEQLE-IVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEA 977
            Y ++   Y  A+ S+ N +E +  ++   +E +L LLG T +ED+LQ+ V  SI LL  A
Sbjct: 2    YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 978  GIKLWVLTGDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYL 1037
            G+K+W+LTGDKVETA  +  S  L++                  G+  H V     +K  
Sbjct: 62   GVKIWMLTGDKVETARCVSISAKLISR-----------------GQYVHTV-----TKLS 99

Query: 1038 REKFGLSGSEMELDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVL 1097
            R +  L+  E    N             ++IDG++L + LT    K++F  +  +  AV+
Sbjct: 100  RPEGALNALEYLKINKSS---------CLLIDGESLGMFLT--YYKQEFFDIVVDLPAVI 148

Query: 1098 CCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDY 1157
             CR +P QKA V  L++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +D+
Sbjct: 149  ACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADF 208

Query: 1158 AIGQFRYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNF 1207
            ++ QF +LT+LLL HGR SYKR +++     ++ +I ++    Y + +  
Sbjct: 209  SVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKL 258

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 136/323 (42%), Gaps = 49/323 (15%)

Query: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891
            I+   EF S  +RMS I+K     PN+E       KGA  VI          N  TL   
Sbjct: 916  IIRSFEFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVIIDIC------NPATLPSD 964

Query: 892  TALHLEQYATEGLRTLCLAQREL---TWSEYTEWNARYDIAAASLTNREEQLEIVSDSIE 948
                L  Y   G R +  A + L   TW              +    REE        +E
Sbjct: 965  YDDILNFYTHSGYRVIACAGKTLPKNTW------------LYSQKVRREE--------VE 1004

Query: 949  RDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMEL 1008
             ++  LG    +++L+D    +++ L  A I+  + TGD V TAI++G  C L+  D   
Sbjct: 1005 SNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVY 1064

Query: 1009 LVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVI 1068
            +      +  ++     +E+ N   ++++ + F L   +        D+S   G + + I
Sbjct: 1065 VPTVAYSDMTVQPVIHWNEISN---AEHILDTFTLQPID--------DYS---GPYTLAI 1110

Query: 1069 DGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGS 1128
             G+  +I  +  D   +  +     K  +  R+SP +K  +V+ ++  +D      GDG+
Sbjct: 1111 TGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQK-MDYTVGFCGDGA 1169

Query: 1129 NDVAMIQSADVGIGIAGEEGRQA 1151
            ND   +++ADVGI ++  E   A
Sbjct: 1170 NDCGALKAADVGISLSEAEASVA 1192

>Kwal_26.9207
          Length = 1469

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 143/323 (44%), Gaps = 50/323 (15%)

Query: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891
            ++   EF S  +RMS I+K     P  E       KGA  VI S +  K+     TL   
Sbjct: 934  VIRSFEFVSELRRMSVIVK-----PYGENVFWGFTKGAPEVI-SEICNKS-----TLPAN 982

Query: 892  TALHLEQYATEGLRTLCLAQREL---TWSEYTEWNARYDIAAASLTNREEQLEIVSDSIE 948
                L+QY   G R +  A + L   TW        R+    A   +REE        +E
Sbjct: 983  YEQILQQYTHNGYRVIACAGKTLPKRTW--------RF----AQKVSREE--------VE 1022

Query: 949  RDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMEL 1008
             ++  LG    E++L+     ++A L +AGI+  + TGD V TAI++G    L+      
Sbjct: 1023 SNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESH-- 1080

Query: 1009 LVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVI 1068
            + V    +++     DP+E  + +I +       +   ++ LD    +      D+ + +
Sbjct: 1081 VFVPQINDNM-----DPNE--DLIIWR------DVDDCDLILDGVTLEPMNGSSDYTIAV 1127

Query: 1069 DGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGS 1128
             GD  ++    +++  +  +     K+ +  R+SP +K  +V  ++  LD +    GDG+
Sbjct: 1128 TGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQG-LDYVVGFCGDGA 1186

Query: 1129 NDVAMIQSADVGIGIAGEEGRQA 1151
            ND   +++ADVG+ ++  E   A
Sbjct: 1187 NDCGALKAADVGVSLSEAEASVA 1209

>Scas_665.30
          Length = 1439

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 84/333 (25%), Positives = 143/333 (42%), Gaps = 67/333 (20%)

Query: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891
            I+   EF S  +RMS I+K     P++E       KGA  VI +++  KA     TL   
Sbjct: 704  IIRSFEFLSELRRMSVIVK-----PSNEDVYWAFTKGAPEVI-TQICNKA-----TLPAN 752

Query: 892  TALHLEQYATEGLRTLCLAQREL---TWSEYTEWNARYDIAAASLTNREEQLEIVSDSIE 948
                L  Y  +G R +  A R L   TW              +   +REE        +E
Sbjct: 753  FEEMLNYYTHKGYRVIACAGRVLPRNTW------------LYSQKVSREE--------VE 792

Query: 949  RDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDM-- 1006
             ++  LG    E++L+    +++  L EA I+  + TGD V TAI++G  CNL+ +    
Sbjct: 793  SNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVY 852

Query: 1007 --ELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDF 1064
               L  + + G+  + +  D   + ++L S+ L          + ++N+          +
Sbjct: 853  VPSLEEIDSTGQTSIIW-RDVDNMDDTLDSRTL----------LPINNSSST------SY 895

Query: 1065 AVVIDGDALKIAL------TGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLD 1118
             + I GD  +I          +D     LL     K  +  R+SP +K  +++ ++  L+
Sbjct: 896  TLAITGDIFRIIFGDENNSISEDYINTVLL-----KGTIYARMSPDEKHELMEQLQR-LN 949

Query: 1119 VMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQA 1151
                  GDG+ND   +++ADVGI ++  E   A
Sbjct: 950  YTVGFCGDGANDCGALKAADVGISLSEAEASVA 982

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/324 (24%), Positives = 136/324 (41%), Gaps = 50/324 (15%)

Query: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891
            I+   EF S  +RMS I+K     P  E   +   KGA  VI+   S +    D   L  
Sbjct: 912  IVRSFEFLSNLRRMSVIVK-----PFSENVFMSFTKGAPEVIFELCSKQTLPLDYEAL-- 964

Query: 892  TALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIERDL 951
                L  Y   G R +  A ++LT         R     +   +REE        IE +L
Sbjct: 965  ----LHHYTHNGYRVIACAGKKLT---------RQSWLYSQKVSREE--------IESNL 1003

Query: 952  ILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVV 1011
              LG    E++L+    E++  L  A I+  + TGD V TAI++G    L+ +    + V
Sbjct: 1004 EFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSV 1063

Query: 1012 ----KTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVV 1067
                 T+ E  +   ++     ++L S  LR    LSG                 D+ + 
Sbjct: 1064 INDIDTSQEGDIITWQNVANSSDTLDSVTLRP---LSGD--------------TDDYTLA 1106

Query: 1068 IDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDG 1127
            + G+  ++    D  + + ++     K  +  R+SP +K  +V+ ++ ++       GDG
Sbjct: 1107 VTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQ-SIGYQVGFCGDG 1165

Query: 1128 SNDVAMIQSADVGIGIAGEEGRQA 1151
            +ND   +++AD+GI ++  E   A
Sbjct: 1166 ANDCGALKAADIGISLSEAEASVA 1189

>CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharomyces
            cerevisiae YEL031w SPF1 P-type ATPase, hypothetical start
          Length = 1214

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 91/332 (27%), Positives = 138/332 (41%), Gaps = 74/332 (22%)

Query: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891
            IL   +F+SA KR S +    G       +     KGA   I  RL T     DE     
Sbjct: 574  ILRRFQFSSALKRSSSVATHDG-------KLYSAVKGAPETIRERLFTIPANYDEIY--- 623

Query: 892  TALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIERDL 951
                 + +   G R L LA ++L      E  ++  I  A   +RE          ERDL
Sbjct: 624  -----KSFTRSGSRVLALASKKL------EKMSQSQIEDA---DREH--------FERDL 661

Query: 952  ILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVV 1011
               G       L+    E+I +L E+  +  ++TGD   TA+++     ++    E L+V
Sbjct: 662  EFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKG--ETLIV 719

Query: 1012 KTAGEDVLEYGEDPHEVVNSL---------ISKYLREKFGLSGSEMELDNAKGDHSFPKG 1062
                 D+++ G D   V  ++         +SK   EK+G+               F K 
Sbjct: 720  -----DMVDNGNDDKLVFRNVEETLSFEFVVSKDSFEKYGI---------------FDKY 759

Query: 1063 DFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTL 1122
            D AV   G AL+ AL G    +  +       A +  RVSPAQK  ++  +K+ +   TL
Sbjct: 760  DLAVT--GHALE-ALKGHHQLQDLIR-----HAWIYARVSPAQKEFILNNLKD-MGYQTL 810

Query: 1123 AIGDGSNDVAMIQSADVGIGI--AGEEGRQAV 1152
              GDG+NDV  ++ A VG+ +    EEG + V
Sbjct: 811  MCGDGTNDVGALKQAHVGVALLNGTEEGLKKV 842

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
            (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 85/323 (26%), Positives = 138/323 (42%), Gaps = 58/323 (17%)

Query: 829  EFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETL 888
            +  IL   +F+SA KR S I     A  N +  + +  KGA   I  RLS    + D+  
Sbjct: 574  DISILRRFQFSSALKRSSTI-----AVHNKQHYSAV--KGAPETIRERLSQVPTDYDQVY 626

Query: 889  LEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNRE-EQLEIVSDSI 947
                    + +   G R L LA ++L                 S++ ++ E+LE   +++
Sbjct: 627  --------KSFTRAGSRVLALASKKL----------------PSMSIKQIEKLE--REAV 660

Query: 948  ERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDME 1007
            E DL   G       L+D   E+I +L E+  +  ++TGD   TA+++     ++  +  
Sbjct: 661  ESDLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETL 720

Query: 1008 LLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVV 1067
            +L     G          H +V   I + +   F       E D  +    F K D AV 
Sbjct: 721  ILDEPIDGSS--------HALVFRNIEETIVNPFN-----PEKDTFEHSKLFAKYDIAVT 767

Query: 1068 IDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDG 1127
              G AL++ L+G     + +         +  RVSPAQK  ++  +K+ +   TL  GDG
Sbjct: 768  --GHALQL-LSGHSQLNELIR-----HTWVYARVSPAQKEFIMNSLKD-MGYQTLMCGDG 818

Query: 1128 SNDVAMIQSADVGIGI--AGEEG 1148
            +NDV  ++ A VGI +    EEG
Sbjct: 819  TNDVGALKQAHVGIALLNGTEEG 841

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 178/901 (19%), Positives = 326/901 (36%), Gaps = 224/901 (24%)

Query: 399  VGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDI 458
            VGD++++   D +PAD +L+      G C  +   L GE+N            IK     
Sbjct: 177  VGDLLKLQTGDVVPADCVLVR-----GECETDESALTGESN-----------TIK----- 215

Query: 459  ARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIV 518
                     + P A+   Y      +D  +          ++     C L +     G  
Sbjct: 216  ---------KLPLADALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLIS-----GSR 261

Query: 519  VFTGDDTKIMLNAGV-----------------TP--TKKSRISRELNFSVLINFLVLFIL 559
            V +G  + I+ N GV                 TP   + S+++  ++    +  + LF++
Sbjct: 262  VLSGLASAIVTNVGVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITLFVV 321

Query: 560  CFISGLA----NGIDYDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYI 615
             F   L+    +G  Y   P +    +F  +           F  A+ +    VP  L +
Sbjct: 322  LFARYLSYILPSGGKYHDLPPAEKGSKFMDI-----------FITAITVIVVAVPEGLPL 370

Query: 616  SVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEF 675
            +V +        +  D  L   ++   C        + +G    + SDKTGTLT+N+M  
Sbjct: 371  AVTLALAFATTRMTKDGNLV--RVLRSC--------ETMGSATAVCSDKTGTLTENIMTV 420

Query: 676  KKCTINGVSYGRAYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMIN------DLRNL 729
             + T+     GRA  + +     +  +  + +       +  D  V+ +      D ++ 
Sbjct: 421  VRGTL-----GRAGFDDIGADPSKSNLVFKKKCSDLLRTVIYDNIVLNSTAFENKDYKDP 475

Query: 730  SNNTQFFPDEITFISKEIVQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLE 789
            +N       +   + + I Q  + +  D ++    H                     + E
Sbjct: 476  NNYNSIDDSQPRRLIRRITQTLQKKKPDDEENLLAH-----------------AAEGRQE 518

Query: 790  MKAQSPDEAALVTTAR-DLGFCFMGKTKTGMVVEIQGIQKEFE----ILNILEFNSARKR 844
                S  E AL++ AR   G  F      G +   +G  ++      I+ I+ F S+RK 
Sbjct: 519  PYIGSKTETALLSLARKSFGLKF------GALQSFRGHPEKLPTVETIVQIIPFESSRKW 572

Query: 845  MSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTK--AGENDETLLEKTALHLEQ---- 898
             + ++K+     N+  +  L  KGA  ++    + K    E    + +K+   +E+    
Sbjct: 573  SAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGISEIDQKSKDDIEEQIFS 632

Query: 899  YATEGLRTLCLAQRELTWSEYTEW---------NARYDIAAASLTNREEQLEIVSDSIER 949
             A + LR + LA  +    +  EW         N+   +A   +  ++  LE        
Sbjct: 633  LAKDALRAISLAHMDF---DVNEWPPKELADPENSHEALAVKLIDPKKPHLE-------- 681

Query: 950  DLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL 1009
             L L     I+D L++ V  S+A   +AG+ + ++TGD + TA  I  +C +L+      
Sbjct: 682  GLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILS------ 735

Query: 1010 VVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVID 1069
                                    SK L                         D A  ++
Sbjct: 736  ------------------------SKSL------------------------NDSACAME 747

Query: 1070 GDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1129
            G A +      D +RK +L     K  +  R SP  K  +V+ +K   +V+ +  GDG+N
Sbjct: 748  GPAFR---KLSDSERKRIL----PKLRVLARSSPEDKKILVRALKEMGEVVAVT-GDGTN 799

Query: 1130 DVAMIQSADVG--IGIAGEE-GRQA----VMCSDYA--IGQFRYLTRLLLVHGRWSYKRL 1180
            D   ++ ADVG  +GI G E  R+A    +M  D++  +   ++        GR     +
Sbjct: 800  DAPALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKW--------GRCVAASI 851

Query: 1181 SEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDV 1240
             + I      NV   L  F   + ++ D   +     L++ NL   ++  + L     D 
Sbjct: 852  KKFIQFQLIVNVTAVLLTFVTSVISS-DVKSVLTAVQLLWVNLIMDTLAALALATDKPDP 910

Query: 1241 N 1241
            N
Sbjct: 911  N 911

>Kwal_47.17547
          Length = 1240

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 142/650 (21%), Positives = 244/650 (37%), Gaps = 129/650 (19%)

Query: 399  VGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDI 458
            VGDI+ +   D +PAD IL+      G C  +   L GE+    + A+   Y+    + +
Sbjct: 206  VGDILSLQTGDVVPADCILVK-----GSCECDESALTGESATIKKAAIDVCYE--KYKQL 258

Query: 459  ARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIV 518
            + T   I+   P A                 E   +P+ I+   L     R    ++G+ 
Sbjct: 259  SATDAAIDIGTPGA-----------------EKVPDPMLISGSKLLSGLGRAVVTSVGVN 301

Query: 519  VFTGDD-TKIMLNAGVTPTKKSRISRELNFSVL--INFLVLFILCFISGLAN----GIDY 571
               G     + + A  TP ++   S   + SV      L+LF + F+  LAN    G  +
Sbjct: 302  SMHGRTLMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGGELH 361

Query: 572  DKHPRSRDFFEFGTVAGNPATNGF-VSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYG 630
            D  P  +         G+   N F V   V V+     +P+++ +++    T  A    G
Sbjct: 362  DLTPAQK---------GSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAK--DG 410

Query: 631  DVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 690
            +++            +     + +G    + SDKTGTLT+N M   K  +    +  A  
Sbjct: 411  NLV------------RVLRACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDEA-- 456

Query: 691  EALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQD 750
            E++        +D+ A      EE+ KD       L N++ N+  F +      KE  +D
Sbjct: 457  ESVGPSDSETDVDL-AIANECSEELKKDV------LTNITLNSTAFEN------KENEED 503

Query: 751  FKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFC 810
                     K     F               P + N    K  +  E      A      
Sbjct: 504  KVSNENPFHKPRKSLF---------------PWSRNNKSKKPATAKELVENAAADQPKEP 548

Query: 811  FMG-KTKTGMVVEIQ------------------GIQKEFEILNILEFNSARKRMSCIIKI 851
            F+G KT+T ++   Q                  GI+K   I+ I+ F S+RK    ++K 
Sbjct: 549  FLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLGIEK---IVQIIPFESSRKWGGIVVKY 605

Query: 852  PGATPNDEPRALLICKGADSVIYSR-LSTKAGENDETLLEKTALHLEQ-----YATEGLR 905
                           KGA  ++  R +  +A ++  TL+ +     E       A E LR
Sbjct: 606  KNGLHR------FYIKGAAELLLRRCMQKRASDSKLTLISQKDFDEESQTITNLAAEALR 659

Query: 906  TLCLAQREL----TW------SEYTEWNARYDIAAASLTNREEQLEIVSDSIERDLILLG 955
             + LA R+      W       E     A  D+      +R + +   +  +   ++L G
Sbjct: 660  AISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQELVSPMVLDG 719

Query: 956  GTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNND 1005
               I+D L+ GV +S+    +AG+ + ++TGD + TA  I   C++L+ +
Sbjct: 720  IVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEE 769

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 69/154 (44%), Gaps = 19/154 (12%)

Query: 1097 LCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVG--IGIAGEE-GRQA-- 1151
            +  R SP  K  +V+ +K   DV+ +  GDG+ND   ++ ADVG  +GIAG E  R+A  
Sbjct: 800  VLARSSPEDKRILVETLKKMGDVVAVT-GDGTNDAPALKLADVGFSMGIAGTEVAREASD 858

Query: 1152 --VMCSDYA--IGQFRYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNF 1207
              +M  D++  +   ++        GR     + + I      NV   +  F   + ++ 
Sbjct: 859  IILMTDDFSAIVNAIKW--------GRCVSTSIKKFIQFQLTVNVTAVVLTFVSAVASSE 910

Query: 1208 DGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVN 1241
            + S L     L++ NL   ++  + L     D N
Sbjct: 911  EASVL-TAVQLLWVNLIMDTLAALALATDKPDEN 943

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transporting
            ATPase, member of the P-type ATPase superfamily of
            membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 137/324 (42%), Gaps = 60/324 (18%)

Query: 829  EFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETL 888
            + +I+   +F+SA KR + I     A+ ND   A +  KGA   I  RLS      DE  
Sbjct: 573  KLDIIRRFQFSSALKRSASI-----ASHNDALFAAV--KGAPETIRERLSDIPKNYDEIY 625

Query: 889  LEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIE 948
                    + +   G R L LA + L     ++ +                 ++  D +E
Sbjct: 626  --------KSFTRSGSRVLALASKSLPKMSQSKID-----------------DLNRDDVE 660

Query: 949  RDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMEL 1008
             +L   G       L+D   E+I +L E+  +  ++TGD   TA+++     ++    E 
Sbjct: 661  SELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFG--ET 718

Query: 1009 LVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKG--DHSFPKGDFAV 1066
            L++  AG+      +D     N L+ + + E   +       D +K   DHS     + +
Sbjct: 719  LILDRAGK-----SDD-----NQLLFRDVEETVSIP-----FDPSKDTFDHSKLFDRYDI 763

Query: 1067 VIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGD 1126
             + G AL  AL G    R  L         +  RVSP+QK  ++  +K+ +   TL  GD
Sbjct: 764  AVTGYALN-ALEGHSQLRDLLR-----HTWVYARVSPSQKEFLLNTLKD-MGYQTLMCGD 816

Query: 1127 GSNDVAMIQSADVGIGI--AGEEG 1148
            G+NDV  ++ A VGI +    EEG
Sbjct: 817  GTNDVGALKQAHVGIALLNGTEEG 840

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 78/330 (23%), Positives = 132/330 (40%), Gaps = 63/330 (19%)

Query: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891
            ++   EF S  +RMS I+K  G   N         KGA  VI          N  T+ + 
Sbjct: 903  VIRSFEFLSELRRMSVIVK--GFKEN---TYWSFTKGAPEVIADIC------NPATIPKD 951

Query: 892  TALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIERDL 951
                L  Y   G R +  A + L  S +           +   +REE        +E +L
Sbjct: 952  FHELLHHYTHNGFRIIACAGKTLPKSSWL---------YSQKVSREE--------VEDNL 994

Query: 952  ILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNL---------- 1001
              LG    E++L+     ++  L  A I+  + TGD V TA+++G    L          
Sbjct: 995  EFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPF 1054

Query: 1002 LNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPK 1061
            LN+++E      +  DV E G     V++++  K L +                    P+
Sbjct: 1055 LNDNLEESRHLLSWRDVDEEGS----VLDAVTLKPLND--------------------PE 1090

Query: 1062 GDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMT 1121
              + + I GD  +I    D++     +     K  +  R+SP +K  +V+ ++  LD   
Sbjct: 1091 KSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQK-LDYNV 1149

Query: 1122 LAIGDGSNDVAMIQSADVGIGIAGEEGRQA 1151
               GDG+ND   +++A++GI ++  E   A
Sbjct: 1150 GFCGDGANDCGALKAANIGISLSEAEASVA 1179

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 139/333 (41%), Gaps = 61/333 (18%)

Query: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891
            ++   EF S  +RMS I+K      N++       KGA  VI S +  K+     TL   
Sbjct: 928  VVRSFEFLSELRRMSVIVKT-----NNDDVYWSFTKGAPEVI-SEICNKS-----TLPAD 976

Query: 892  TALHLEQYATEGLRTLCLAQREL---TWSEYTEWNARYDIAAASLTNREEQLEIVSDSIE 948
                L  Y   G R +  A + L   TW              +   +REE        +E
Sbjct: 977  FEEVLRCYTHNGYRVIACAGKTLPKRTW------------LYSQKVSREE--------VE 1016

Query: 949  RDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN----- 1003
             +L  LG    +++L+    E++  L +A I+  + TGD + TAI++G    L+      
Sbjct: 1017 SNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVY 1076

Query: 1004 ----NDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLRE-KFGLSGSEMELDNAKGDHS 1058
                ND  L      GE V+ +  D +E    L +K L+  K G +  E          S
Sbjct: 1077 VPSINDTPL-----HGEPVIVW-RDVNEPDKILDTKTLKPVKLGNNSVE----------S 1120

Query: 1059 FPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLD 1118
              + ++ + + GD  ++    ++   +  L      + +  R+SP +K  ++  ++  LD
Sbjct: 1121 LRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQK-LD 1179

Query: 1119 VMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQA 1151
                  GDG+ND   +++ADVGI ++  E   A
Sbjct: 1180 YTVGFCGDGANDCGALKAADVGISLSEAEASVA 1212

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 138/645 (21%), Positives = 253/645 (39%), Gaps = 135/645 (20%)

Query: 399  VGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCS---YKIKTS 455
            VGD++ +   D +PAD +L+S     G C  +   L GE++   + ALK +   YK    
Sbjct: 259  VGDVISLQTGDVVPADAVLIS-----GSCECDESALTGESDTIKKVALKPALEKYKQIFE 313

Query: 456  RDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTIN-NMLLRGCTLRNTKWA 514
            +D            P  ++ S+    K  D         P+ I+ + LL G         
Sbjct: 314  KD------------PTIDIGSHGVGEKVPD---------PLLISGSKLLSGI-------G 345

Query: 515  MGIVVFTGDDT---KIML----NAGVTPTKKSRISRELNFSV------LINFLVLFILCF 561
              ++   G+++   +IM+     +  TP ++   +   N S+      L+ F++LFI  F
Sbjct: 346  NAVITSVGENSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMAALVLFIILFIR-F 404

Query: 562  ISGLANGIDYDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIK 621
            ++ L NG  Y   P ++   +F  +           F  AV +    VP  L ++V +  
Sbjct: 405  LTYLPNGKKYHDLPPAQKGSKFMNI-----------FITAVTVIVVAVPEGLPLAVTLAL 453

Query: 622  TAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTIN 681
                  +  D  L           +     + +G    I SDKTGTLT+N M   K    
Sbjct: 454  AFATTRMTKDGNLV----------RVLRACETMGSATAICSDKTGTLTENRMTVVK---- 499

Query: 682  GVSYGRAYTEALAGLRKRQGID--VEAEGRREKEEIAK----DRDVMINDLRNLS-NNTQ 734
                         G     G D    AE +  K  +      D  ++ + L N+S N+T 
Sbjct: 500  -------------GFAGNLGFDDTTHAENKEIKSAVVLRSNCDASLLTDILSNISLNSTA 546

Query: 735  FFPDEITFISKEIVQD--FKGRNGDI--QKKCCEHFMLALALCHSVLTEPSPTNPNKLEM 790
            F   E     K++ ++   K R       +      ++A A+             N  + 
Sbjct: 547  FENKESQHKDKDVDENPYHKSRKSLFPWSRNNRTSQLIADAM-----------KENDEQF 595

Query: 791  KAQSPDEAALVTTARDLGFCFMGKTKTGMVVEIQGIQKEFEILNILEFNSARKRMSCIIK 850
                 + A L    + LG   + K +T       GI K   ++ ++ F S+RK  +  ++
Sbjct: 596  LGSKTETALLAFAQKSLGMKDVHKLRTK--PSDLGIDK---VVQVIPFESSRKWGAIAVQ 650

Query: 851  IPGATPNDEPRALLICKGADSVIYSRLSTKAGEND------ETLLEKTALHLEQYATEGL 904
            +      D        KGA  ++    S +   ++      + L +++   ++  A+  L
Sbjct: 651  LA-----DNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDLYDESFKKIQDMASHAL 705

Query: 905  RTLCLAQRELTWSEYTEWNARYDIAAAS----LTNREEQLEIVSDSIERDLILLGGTAIE 960
            RT+ L  R+       E+    D + AS    + +  +   + S+ +  D ++     ++
Sbjct: 706  RTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDHKNLSSEGMTLDAMV----GLQ 761

Query: 961  DRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNND 1005
            D L++GV ES+     AG+ + ++TGD + TA  I  +CN+L+ +
Sbjct: 762  DPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEE 806

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 1094 KAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVG--IGIAGEE-GRQ 1150
            K  +  R SP  K  +V+ +K   +V+ +  GDG+ND   ++ ADVG  +GI+G E  R+
Sbjct: 834  KLRVLARSSPEDKRILVETLKKMGEVVAVT-GDGTNDAPALKLADVGFSMGISGTEVARE 892

Query: 1151 A----VMCSDY 1157
            A    +M  D+
Sbjct: 893  ASDIILMTDDF 903

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
            Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
            start by similarity
          Length = 1206

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 76/312 (24%), Positives = 126/312 (40%), Gaps = 54/312 (17%)

Query: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891
            IL   +F+S+ KR + I        +   R     KGA   I  RL++   + D+     
Sbjct: 574  ILRRFQFSSSLKRSASI-------ASQSNRFFAAVKGAPETIRERLNSVPSDYDDIY--- 623

Query: 892  TALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIERDL 951
                 + +   G R L LA ++L        N++ D              I  D IE  L
Sbjct: 624  -----KSFTRSGSRVLALAYKDLPKMS----NSQID-------------NIDRDEIETGL 661

Query: 952  ILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVV 1011
                       L+D   E+I +L E+  +  ++TGD   TA+++     +++ +  +L  
Sbjct: 662  TFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDRETLILDE 721

Query: 1012 KTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVIDGD 1071
               G          H +V   +++ + + F       + D       F K D AV   G 
Sbjct: 722  PIDGSS--------HALVMRDVNETIVKPFN-----PDADTFDEKEIFQKYDLAVT--GH 766

Query: 1072 ALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDV 1131
            ALK+ L G    R  +         +  RVSP+QK  ++  +K+ +   TL  GDG+NDV
Sbjct: 767  ALKL-LQGHKQLRDVIR-----HTWIYARVSPSQKEFILITLKD-MGYQTLMCGDGTNDV 819

Query: 1132 AMIQSADVGIGI 1143
              ++ A VGI +
Sbjct: 820  GALKQAHVGIAL 831

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 91/190 (47%), Gaps = 28/190 (14%)

Query: 831  EILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLE 890
            +++  + F S+RK    ++K      N +P      KGA  ++    S K   +D+TL E
Sbjct: 608  KVVQTIPFESSRKWAGLVVKYKEGK-NKKPFYRFFIKGAAEIVSKNCSYKRN-SDDTLEE 665

Query: 891  -------KTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARY-------DIAAASLTNR 936
                   +T   ++  A++ LR + +A ++  + E   W           +IAA      
Sbjct: 666  INEDNKKETDDEIKNLASDALRAISVAHKD--FCECDSWPPEQLRDKDSPNIAA------ 717

Query: 937  EEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIG 996
               L+++ +S ++ LIL G   I+D L+ GV ES+     AG+ + ++TGD + TA  I 
Sbjct: 718  ---LDLLFNS-QKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIA 773

Query: 997  FSCNLLNNDM 1006
             +C +L+ D+
Sbjct: 774  RNCAILSTDI 783

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (57%), Gaps = 8/69 (11%)

Query: 1097 LCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVG--IGIAGEE-GRQA-- 1151
            +  R SP  K  +V+ +K   DV+ +  GDG+ND   ++ ADVG  +GI+G E  R+A  
Sbjct: 813  VLARSSPEDKRLLVETLKGMGDVVAVT-GDGTNDAPALKLADVGFSMGISGTEVAREASD 871

Query: 1152 --VMCSDYA 1158
              +M  D++
Sbjct: 872  IILMTDDFS 880

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 5/43 (11%)

Query: 397 VKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETN 439
           V VGD++ +   D +PAD +++S     G C  +  ++ GE+N
Sbjct: 210 VLVGDVISLQTGDVVPADCVMIS-----GKCEADESSITGESN 247

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 115/271 (42%), Gaps = 42/271 (15%)

Query: 822  EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKA 881
            E+  ++ E+  +  L FNS RK M+  I+      ++E +  L  KGA   I  + S+  
Sbjct: 464  ELADVRSEYTKVKELSFNSKRKMMATKIQ------DNEKKTTLFIKGAFERILDKSSSYL 517

Query: 882  GENDETLLEK-TALHLEQ-------YATEGLRTLCLAQRELTWSEYTEWNARYDIAAASL 933
             E  +  +EK TA H E         A+EGLR L  A+R +T S                
Sbjct: 518  TEKGK--IEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTDSSS-------------- 561

Query: 934  TNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAI 993
                   ++V D I  DL+  G   + D  +  V  +I    + GI + ++TGD   TA+
Sbjct: 562  -------KLVEDDIS-DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAV 613

Query: 994  NIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNA 1053
            NI     +   D +L V+  +G+ + E  +D    V   ++ + R       + +     
Sbjct: 614  NIARQIGIPVIDPKLSVL--SGDKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRR 671

Query: 1054 KGDHSFPKGDFAVVIDGDALKIALTGDDMKR 1084
            +GD     GD   V D  ALK+A  G  M R
Sbjct: 672  RGDVVAMTGDG--VNDAPALKLADIGVSMGR 700

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 1099 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIA 1144
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ AD+G+ + 
Sbjct: 655  ARATPEHKLNIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMG 699

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 184/891 (20%), Positives = 323/891 (36%), Gaps = 215/891 (24%)

Query: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454
            K V  GDI  +   D IPAD+ L           +ETKN D + +L   ++L  S     
Sbjct: 144  KDVVPGDICLVKVGDTIPADLRL-----------IETKNFDTDESLLTGESLPVSKD--- 189

Query: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLR--GCTLRNTK 512
                A   F  E E    +    + NL +  S   + R + + I   L    G   ++ +
Sbjct: 190  ----ANLVFGKEEETSVGD----RLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQ 241

Query: 513  WAMGIVVFTGDDTKIMLNAGVTPTKK-----------SRISRELNFSVLINFLVLFILCF 561
               G++  + D +K  L      TKK           + + R+L+   ++ F +  +   
Sbjct: 242  GDSGLI--SRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAI 299

Query: 562  ISGLANGIDYDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIK 621
            I   +   D DK                      V+ + A+ +  S++P SL + + I  
Sbjct: 300  IVMASQKFDVDKR---------------------VAIY-AICVALSMIPSSLVVVLTITM 337

Query: 622  TAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVM-------- 673
            +  AA +    ++   KLD           + LG +  I SDKTGTLTQ  M        
Sbjct: 338  SVGAAVMVSRNVIVR-KLDS---------LEALGAVNDICSDKTGTLTQGKMLARQIWIP 387

Query: 674  EFKKCTINGVSYGRAYTEALAGLRKR-------------QGIDVEAEGRREKEEIAKDRD 720
             F   TI+         E    L  R              GI    + R  ++++ +D D
Sbjct: 388  RFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDID 447

Query: 721  VMIN----DLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKKCCEHFMLALALCHSV 776
            + +     +   L+N    F D+ T        D    +GD  +   + F   + L H+ 
Sbjct: 448  MDLFQKWLETATLANIATVFKDDAT--------DCWKAHGDPTEIAIQVFATKMDLPHNA 499

Query: 777  LTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVVEIQGIQKEFEILNIL 836
            LT    TN      ++   D+++L       G                    +FE +   
Sbjct: 500  LTGEKSTN------QSNENDQSSLSQHNEKPG------------------SAQFEHIAEF 535

Query: 837  EFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEKTALHL 896
             F+S  KRMS +        N      +  KGA   I S  S+  G++   +   T   +
Sbjct: 536  PFDSTVKRMSSVYY-----NNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDV 590

Query: 897  E-------QYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSD--SI 947
            E         + EGLR L  A +  T  +                N ++   I S+  + 
Sbjct: 591  ETIRKNVYSLSNEGLRVLGFASKSFTKDQ---------------VNDDQLKNITSNRATA 635

Query: 948  ERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDME 1007
            E DL+ LG   I D  ++    ++    +AGI + +LTGD V TA  I     +L  ++ 
Sbjct: 636  ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNL- 694

Query: 1008 LLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVV 1067
                         Y +   E+V+S++         ++GS+ +                  
Sbjct: 695  -----------YHYSQ---EIVDSMV---------MTGSQFD------------------ 713

Query: 1068 IDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDG 1127
                     L+ +++    +L       ++  R SP  K  +++ +       T+  GDG
Sbjct: 714  --------GLSEEEVDDLPVL------PLVIARCSPQTKVRMIEALHRRKKFCTMT-GDG 758

Query: 1128 SNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLV-HGRWSYKRLSEMIPE 1186
             ND   ++ A+VGI +       +   SD  +    + + L  V  GR     + + + +
Sbjct: 759  VNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQ 818

Query: 1187 FFYKNVIFTLALFWYGIYNNFDGSYLFEYTYL-MFYNLAFTS-IPVILLGI 1235
               +NV   L L    ++ + +G  +F  + + + + +  TS  P + LG+
Sbjct: 819  LLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGL 869

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 183/891 (20%), Positives = 322/891 (36%), Gaps = 215/891 (24%)

Query: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454
            K V  GDI  +   D IPAD+ L           +ETKN D + +L   ++L  S     
Sbjct: 144  KDVVPGDICLVKVGDTIPADLRL-----------IETKNFDTDESLLTGESLPVSKD--- 189

Query: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLR--GCTLRNTK 512
                A   F  E E    +    + NL +  S   + R + + I   L    G   ++ +
Sbjct: 190  ----ANLVFGKEEETSVGD----RLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQ 241

Query: 513  WAMGIVVFTGDDTKIMLNAGVTPTKK-----------SRISRELNFSVLINFLVLFILCF 561
               G++  + D +K  L      TKK           + + R+L+   ++ F +  +   
Sbjct: 242  GDSGLI--SRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAI 299

Query: 562  ISGLANGIDYDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIK 621
            I   +   D DK                      V+ + A+ +  S++P SL + + I  
Sbjct: 300  IVMASQKFDVDKR---------------------VAIY-AICVALSMIPSSLVVVLTITM 337

Query: 622  TAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVM-------- 673
            +  AA +    ++   KLD           + LG +  I SDKTGTLTQ  M        
Sbjct: 338  SVGAAVMVSRNVIVR-KLDSL---------EALGAVNDICSDKTGTLTQGKMLARQIWIP 387

Query: 674  EFKKCTINGVSYGRAYTEALAGLRKR-------------QGIDVEAEGRREKEEIAKDRD 720
             F   TI+         E    L  R              GI    + R  ++++ +D D
Sbjct: 388  RFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDID 447

Query: 721  VMIN----DLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKKCCEHFMLALALCHSV 776
            + +     +   L+N    F D+ T        D    +GD  +   + F   + L H+ 
Sbjct: 448  MDLFQKWLETATLANIATVFKDDAT--------DCWKAHGDPTEIAIQVFATKMDLPHNA 499

Query: 777  LTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVVEIQGIQKEFEILNIL 836
            LT    TN      ++   D+++L       G                    +FE +   
Sbjct: 500  LTGEKSTN------QSNENDQSSLSQHNEKPG------------------SAQFEHIAEF 535

Query: 837  EFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEKTALHL 896
             F+S  KRMS +        N      +  KGA   I S  S+  G++   +   T   +
Sbjct: 536  PFDSTVKRMSSVYY-----NNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDV 590

Query: 897  E-------QYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSD--SI 947
            E         + EGLR L  A +  T  +                N ++   I S+  + 
Sbjct: 591  ETIRKNVYSLSNEGLRVLGFASKSFTKDQ---------------VNDDQLKNITSNRATA 635

Query: 948  ERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDME 1007
            E DL+ LG   I D  ++    ++    +AGI + +LTGD V TA  I     +L  ++ 
Sbjct: 636  ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNL- 694

Query: 1008 LLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVV 1067
                         Y +   E+V+S++         ++GS+ +                  
Sbjct: 695  -----------YHYSQ---EIVDSMV---------MTGSQFD------------------ 713

Query: 1068 IDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDG 1127
                     L+ +++    +L       ++  R SP  K  +++ +        +  GDG
Sbjct: 714  --------GLSEEEVDDLPVL------PLVIARCSPQTKVRMIEALHRRKKFCAMT-GDG 758

Query: 1128 SNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLV-HGRWSYKRLSEMIPE 1186
             ND   ++ A+VGI +       +   SD  +    + + L  V  GR     + + + +
Sbjct: 759  VNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQ 818

Query: 1187 FFYKNVIFTLALFWYGIYNNFDGSYLFEYTYL-MFYNLAFTS-IPVILLGI 1235
               +NV   L L    ++ + +G  +F  + + + + +  TS  P + LG+
Sbjct: 819  LLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGL 869

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 183/891 (20%), Positives = 322/891 (36%), Gaps = 215/891 (24%)

Query: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454
            K V  GDI  +   D IPAD+ L           +ETKN D + +L   ++L  S     
Sbjct: 144  KDVVPGDICLVKVGDTIPADLRL-----------IETKNFDTDESLLTGESLPVSKD--- 189

Query: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLR--GCTLRNTK 512
                A   F  E E    +    + NL +  S   + R + + I   L    G   ++ +
Sbjct: 190  ----ANLVFGKEEETSVGD----RLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQ 241

Query: 513  WAMGIVVFTGDDTKIMLNAGVTPTKK-----------SRISRELNFSVLINFLVLFILCF 561
               G++  + D +K  L      TKK           + + R+L+   ++ F +  +   
Sbjct: 242  GDSGLI--SRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAI 299

Query: 562  ISGLANGIDYDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIK 621
            I   +   D DK                      V+ + A+ +  S++P SL + + I  
Sbjct: 300  IVMASQKFDVDKR---------------------VAIY-AICVALSMIPSSLVVVLTITM 337

Query: 622  TAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVM-------- 673
            +  AA +    ++   KLD           + LG +  I SDKTGTLTQ  M        
Sbjct: 338  SVGAAVMVSRNVIVR-KLDSL---------EALGAVNDICSDKTGTLTQGKMLARQIWIP 387

Query: 674  EFKKCTINGVSYGRAYTEALAGLRKR-------------QGIDVEAEGRREKEEIAKDRD 720
             F   TI+         E    L  R              GI    + R  ++++ +D D
Sbjct: 388  RFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDID 447

Query: 721  VMIN----DLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKKCCEHFMLALALCHSV 776
            + +     +   L+N    F D+ T        D    +GD  +   + F   + L H+ 
Sbjct: 448  MDLFQKWLETATLANIATVFKDDAT--------DCWKAHGDPTEIAIQVFATKMDLPHNA 499

Query: 777  LTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVVEIQGIQKEFEILNIL 836
            LT    TN      ++   D+++L       G                    +FE +   
Sbjct: 500  LTGEKSTN------QSNENDQSSLSQHNEKPG------------------SAQFEHIAEF 535

Query: 837  EFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEKTALHL 896
             F+S  KRMS +        N      +  KGA   I S  S+  G++   +   T   +
Sbjct: 536  PFDSTVKRMSSVYY-----NNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDV 590

Query: 897  E-------QYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSD--SI 947
            E         + EGLR L  A +  T  +                N ++   I S+  + 
Sbjct: 591  ETIRKNVYSLSNEGLRVLGFASKSFTKDQ---------------VNDDQLKNITSNRATA 635

Query: 948  ERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDME 1007
            E DL+ LG   I D  ++    ++    +AGI + +LTGD V TA  I     +L  ++ 
Sbjct: 636  ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNL- 694

Query: 1008 LLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVV 1067
                         Y +   E+V+S++         ++GS+ +                  
Sbjct: 695  -----------YHYSQ---EIVDSMV---------MTGSQFD------------------ 713

Query: 1068 IDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDG 1127
                     L+ +++    +L       ++  R SP  K  +++ +        +  GDG
Sbjct: 714  --------GLSEEEVDDLPVL------PLVIARCSPQTKVRMIEALHRRKKFCAMT-GDG 758

Query: 1128 SNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLV-HGRWSYKRLSEMIPE 1186
             ND   ++ A+VGI +       +   SD  +    + + L  V  GR     + + + +
Sbjct: 759  VNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQ 818

Query: 1187 FFYKNVIFTLALFWYGIYNNFDGSYLFEYTYL-MFYNLAFTS-IPVILLGI 1235
               +NV   L L    ++ + +G  +F  + + + + +  TS  P + LG+
Sbjct: 819  LLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGL 869

>Scas_583.14*
          Length = 875

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 83/336 (24%), Positives = 135/336 (40%), Gaps = 70/336 (20%)

Query: 811  FMGKTKTGMVVEIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGAD 870
            F  + KTG          + +IL   +F+SA KR S +     A+  D  +     KGA 
Sbjct: 219  FTSRPKTG----------KLQILRRFQFSSALKRSSSV-----ASHKD--KLFTAVKGAP 261

Query: 871  SVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAA 930
              I  RL+      DE          + +   G R L LA + L            ++++
Sbjct: 262  ETIRERLAVVPKNYDEIY--------KSFTRSGSRVLALASKSLP-----------NLSS 302

Query: 931  ASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVE 990
              L + +       D IE  L   G       L+    E+I +L E+  +  ++TGD   
Sbjct: 303  KQLDDLDR------DEIETGLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPL 356

Query: 991  TAINIGFSCNLLNNDMELL-VVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEME 1049
            TA+++     ++  +  +L   +T G+  L +           + + ++  F  +     
Sbjct: 357  TAVHVAKEVAIVTGETLILDKSETVGDGKLLFFN---------VEETIKIPFDPASD--- 404

Query: 1050 LDNAKGDHS--FPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKA 1107
                K DH   F K D AV   G AL   L  D  + K L+      A    RVSP+QK 
Sbjct: 405  ----KFDHRELFDKYDIAVT--GYALN--LLEDHSQLKDLIRHTWVYA----RVSPSQKE 452

Query: 1108 AVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGI 1143
             ++  +K  +   TL  GDG+NDV  ++ A VG+ +
Sbjct: 453  FILNNLKE-MGYQTLMCGDGTNDVGALKQAHVGVAL 487

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 82/191 (42%), Gaps = 27/191 (14%)

Query: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891
            I+ ++ F S+RK    ++++               KGA   I+         ND+ +   
Sbjct: 574  IVQMIPFESSRKWAGLVVRLVDGNYR------FFIKGASETIFKSCHYMRSSNDDVIKLS 627

Query: 892  TALHLEQY------ATEGLRTLCLAQRELTWSEYTEWN-ARYDIAAASLTNREEQL---E 941
               H E +      A++ LRT+ LA ++ T  + + W  A    A+   T   + L   E
Sbjct: 628  PQKHGEIFGLINNLASDALRTISLAHKDFT--DISSWPPAELRDASDPSTASPDLLLGDE 685

Query: 942  IVSDSIERD---------LILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETA 992
             V  + +R          LIL G   I D L+ GV ES+    ++G+ + ++TGD + T 
Sbjct: 686  YVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTG 745

Query: 993  INIGFSCNLLN 1003
              I  +C +L+
Sbjct: 746  RAIARACGILS 756

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 108/289 (37%), Gaps = 57/289 (19%)

Query: 399 VGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDI 458
           VGD++ +   D +P D IL+     +G C  +   + GE++   + +L  S ++  +   
Sbjct: 203 VGDLLSLQTGDVVPVDCILV-----EGKCECDESGITGESDTIKKVSLAMSLQVYRT--- 254

Query: 459 ARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIV 518
                 + ++ P A++ S            + L  +P+ I+   L          A+G  
Sbjct: 255 ------VAADNPSADIGS--------SDNGHSLVPDPMLISGSKLLSGIGHAVVTAVGPH 300

Query: 519 VFTGDDTKIMLNAGVTP----------TKKSRISRELNFSVLINFLVLFILCFISGLANG 568
              G   K+ML     P          T    IS   + +  + F+VLF L F+S L  G
Sbjct: 301 SVHG---KMMLALKSEPETTPLQERLNTLADDISIYGSVAAFLLFVVLF-LRFLSYLPKG 356

Query: 569 IDYDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFI 628
             Y   P +R    F  +           F  AV +    VP  L ++V +        +
Sbjct: 357 RLYHDLPSARKGSRFMDI-----------FITAVTVIVVAVPEGLPLAVTLALAFATTRM 405

Query: 629 YGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKK 677
             D  L           +     + +G    + SDKTGTLTQN M   K
Sbjct: 406 TKDGNLV----------RVLRACETMGSATTVCSDKTGTLTQNKMVVVK 444

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 1094 KAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVG--IGIAG 1145
            K  +  R SP  K   V ++K   +V+ +  GDG+ND   +  ADVG  +GI+G
Sbjct: 786  KLKVLARSSPEDKRIFVDILKKMNEVVAVT-GDGTNDAPALTLADVGFSMGISG 838

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 77/170 (45%), Gaps = 39/170 (22%)

Query: 836 LEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLST---------KAGENDE 886
           L FNS RK M+  +     +P +  + ++  KGA   I  R ++         K  ++ +
Sbjct: 483 LTFNSKRKYMAVKVD----SPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHK 538

Query: 887 TLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDS 946
           +L+   A  L   A+EGLRTL  AQ E +                  TN+      ++DS
Sbjct: 539 SLINDCAKSL---ASEGLRTLAFAQLECS------------------TNKP-----MNDS 572

Query: 947 IERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIG 996
             ++L  +G   ++D  +  V  +I  L + G+ + ++TGD   TA+NI 
Sbjct: 573 TIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIA 622

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 1099 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIA 1144
             R +P  K  +V+ ++   D++ +  GDG ND   ++ AD+G+ + 
Sbjct: 661  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVAMG 705

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 96/426 (22%), Positives = 165/426 (38%), Gaps = 91/426 (21%)

Query: 830  FEILNILEFNSARKRMSCIIKIP--GATPNDE-------PRALLICKGADSVIYSRLSTK 880
            FE +    F+S+ KRMS I K     ATP  E        R L  C    +    + S  
Sbjct: 516  FEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPL 575

Query: 881  AGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQL 940
            + E+ ET+ +    +++  ++EGLR L  A++    SE+   NA  D           +L
Sbjct: 576  SKEDLETIQK----NVDTLSSEGLRVLAFAKKSFNESEF---NANKD-----------KL 617

Query: 941  EIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCN 1000
                D +E  L  LG   I D  +     ++    +AGI + +LTGD   TA +I     
Sbjct: 618  LKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVG 677

Query: 1001 LLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFP 1060
            +L +++              Y   P EVVN ++                           
Sbjct: 678  ILPHNL------------YHY---PKEVVNFMV-------------------------MA 697

Query: 1061 KGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLV--KNTLD 1118
              DF  + D +        DD++   L++          R +P  K  +++ +  ++   
Sbjct: 698  ATDFDALSDQEI-------DDLRVLPLVI---------ARCAPQTKVRMIEALHRRSKFC 741

Query: 1119 VMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLV-HGRWSY 1177
             MT   GDG ND   ++ A+VGI +       A   SD  +    + + L  V  GR   
Sbjct: 742  AMT---GDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMS 798

Query: 1178 KRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYL-MFYNLAFTS-IPVILLGI 1235
              + + + +   +NV   L L     + + +G  +F  + + + + +  TS  P + LG+
Sbjct: 799  DNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEVLWIIVVTSCFPAMGLGL 858

Query: 1236 LDQDVN 1241
                V+
Sbjct: 859  EKASVD 864

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 138/668 (20%), Positives = 254/668 (38%), Gaps = 147/668 (22%)

Query: 601  AVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYI 660
            A+ +  S++P SL + + I  +A A  +    ++   KLD           + LG +  I
Sbjct: 317  AICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIR-KLDS---------LEALGAVNDI 366

Query: 661  FSDKTGTLTQNVMEFKKC------TINGVSYGRAYTEALAGLRKRQGIDVEAEGRREKEE 714
             SDKTGTLTQ  M  K+       TIN  +    +   +  ++             ++E+
Sbjct: 367  CSDKTGTLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEED 426

Query: 715  IAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKKCCEHFMLALALCH 774
            +      MI D +     ++++ DE+  ++  +   +              +   LA   
Sbjct: 427  VG-----MITDFK-----SKYYADELGPLNVSLFTQWL-------------YTATLANIA 463

Query: 775  SVLTEPSPTNPNKLEMKAQS-PDEAALVTTARDLGF---CFMGKTKTGMVVEIQGIQKEF 830
            +V  +P        + KA   P E A+   A  +        G+       + + I  + 
Sbjct: 464  TVFRDPETQ-----DWKAHGDPTEIAIQVFATRMDLPRRVLTGEDND----DEKNIHNDI 514

Query: 831  EILNILE--FNSARKRMSCIIKIPGATPNDEPRALL---ICKGADSVIY----SRLSTKA 881
               ++ E  F+S+ KRMS I K       +EP+A +     KGA   +     S  +T  
Sbjct: 515  TFEHVAEYPFDSSVKRMSAIYK-----NVEEPKAPIYEVFTKGAFERVLQCCNSWYTTPD 569

Query: 882  GEND---ETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREE 938
            G      E  LE    +++  ++EGLR L  A++    S++T              N+++
Sbjct: 570  GSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKKTFNESQFT-------------INKDK 616

Query: 939  QLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFS 998
             L+   D +E +L  LG   I D  +     ++     AGI + +LTGD   TA +I   
Sbjct: 617  LLK-ERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIAQE 675

Query: 999  CNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHS 1058
              +L +++              Y   P EVVN ++                         
Sbjct: 676  VGILPHNL------------YHY---PKEVVNFMV------------------------- 695

Query: 1059 FPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLV--KNT 1116
                DF  + D +  ++ +                  ++  R +P  K  +++ +  +N 
Sbjct: 696  MTATDFDALSDKEIDELPVL----------------PLVIARCAPQTKVRMIEALHRRNR 739

Query: 1117 LDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLV-HGRW 1175
               MT   GDG ND   ++ A+VGI +       A   SD  +    + + L  V  GR 
Sbjct: 740  FCAMT---GDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRR 796

Query: 1176 SYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYL-MFYNLAFTS-IPVILL 1233
                + + + +   +NV   L L     + + +G  +F  + + + + +  TS  P + L
Sbjct: 797  MSDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGFSVFPLSPVEVLWVIVVTSCFPAMGL 856

Query: 1234 GILDQDVN 1241
            G+   +V+
Sbjct: 857  GLEKANVD 864

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 119/325 (36%), Gaps = 102/325 (31%)

Query: 836  LEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLS---TKAGENDETLLEKT 892
            L FNS RK M+        +  +    +L  KGA   I  + S    KAGE  E      
Sbjct: 474  LSFNSKRKYMAI------KSSKESGEHVLYIKGAFERILDKSSYYLDKAGEVREFDEHSK 527

Query: 893  ALHLEQY---ATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIER 949
             + LE     A++GLRT+  A +  T S+                       ++S+    
Sbjct: 528  VMVLEAAHSCASDGLRTIACAFKP-TDSD----------------------NVISEDDIN 564

Query: 950  DLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL 1009
             L   G   + D  +  V  SI  L   G+ + ++TGD V TA++I              
Sbjct: 565  GLTFTGLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIA------------- 611

Query: 1010 VVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVID 1069
                                         EK GLS  + E               + V+ 
Sbjct: 612  -----------------------------EKIGLSVQDRE---------------SSVMT 627

Query: 1070 GDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1129
            GD +   LT D++ +         K  +  R +P  K  +VK ++   D++ +  GDG N
Sbjct: 628  GDKVS-ELTEDELSKVI------DKVNIFARATPENKLNIVKALRKRGDIVAMT-GDGVN 679

Query: 1130 DVAMIQSADVGI--GIAGEEGRQAV 1152
            D   ++ AD+GI  GI+G +  + V
Sbjct: 680  DAPALKLADIGIAMGISGTDVAKEV 704

>Scas_707.48*
          Length = 741

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 111/269 (41%), Gaps = 38/269 (14%)

Query: 822  EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLS--- 878
            ++  I+  F+ +  + FNS RK M+  I       N E +  L  KGA   + S+ S   
Sbjct: 456  DLSDIRPTFKKVQEIPFNSKRKFMAVKIV------NSEGKYSLCVKGAFEKVLSQCSHYL 509

Query: 879  TKAGENDETLLEKTALHLE---QYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTN 935
             + G+ ++    +  + +E     A+EGLR L  A+  L  S                  
Sbjct: 510  NQKGKTEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLPDSPT---------------- 553

Query: 936  REEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINI 995
                  ++++    DLI  G   + D  +  V  +I  L + G+ + ++TGD   TA+NI
Sbjct: 554  ------LLTEESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTAVNI 607

Query: 996  GFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKG 1055
                 +   D +L V+  +G+ + E  +D    V   ++ + R       + +     +G
Sbjct: 608  ARQIGIPVLDPKLSVL--SGDKLNEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRG 665

Query: 1056 DHSFPKGDFAVVIDGDALKIALTGDDMKR 1084
            D     GD   V D  ALK+A  G  M R
Sbjct: 666  DVVAMTGDG--VNDAPALKLADIGVSMGR 692

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 1099 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIA 1144
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ AD+G+ + 
Sbjct: 647  ARATPEHKLNIVRALRKRGDVVAMT-GDGVNDAPALKLADIGVSMG 691

>Scas_297.1
          Length = 800

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 8/69 (11%)

Query: 1097 LCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVG--IGIAGEE-GRQA-- 1151
            +  R SP  K  +V+ +K   DV+ +  GDG+ND   ++ ADVG  +GI+G E  R+A  
Sbjct: 51   VMARSSPEDKRLLVETLKGMGDVVAVT-GDGTNDAPALKLADVGFSMGISGTEVAREASD 109

Query: 1152 --VMCSDYA 1158
              +M  D+A
Sbjct: 110  IILMTDDFA 118

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 9/53 (16%)

Query: 399 VGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETN----LKVRQALK 447
           VGDI+ +   D IPAD +L+     +G C V+  ++ GE++    +KV  ALK
Sbjct: 618 VGDIITLQTGDVIPADGVLV-----EGQCEVDESSITGESDTIKKVKVFNALK 665

>Kwal_23.3160
          Length = 1100

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 89/410 (21%), Positives = 152/410 (37%), Gaps = 86/410 (20%)

Query: 890  EKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIER 949
            E+   ++E  ++EGLR L  A +  T S+  + +              E L    D +E 
Sbjct: 598  EEVFKNVETLSSEGLRVLAFATKSFTESQALKVS--------------EDLRKNRDFVES 643

Query: 950  DLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL 1009
            DLI  G   I D  +     ++    +AGI + +LTGD   TA  I     +L  ++   
Sbjct: 644  DLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNL--- 700

Query: 1010 VVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVID 1069
                       Y   P EVV+S++                +  A+ D             
Sbjct: 701  ---------YHY---PKEVVDSMV----------------MTAAQFDQ------------ 720

Query: 1070 GDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLV--KNTLDVMTLAIGDG 1127
                   LT +++    LL       ++  R +P  K  ++  +  +     MT   GDG
Sbjct: 721  -------LTDEEIDNLLLL------PLVIARCAPQTKVRMIDALHRREKFCAMT---GDG 764

Query: 1128 SNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLV-HGRWSYKRLSEMIPE 1186
             ND   ++ A+VGI +       A   SD  +    + + L  V  GR     + + + +
Sbjct: 765  VNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQ 824

Query: 1187 FFYKNVIFTLALFWYGIYNNFDGSYLFEYTYL-MFYNLAFTS-IPVILLGILDQDVNDTI 1244
               +NV   L L     + + D   +F  + + + + +  TS  P + LG L++   D +
Sbjct: 825  LLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLG-LEKSAPDIM 883

Query: 1245 SLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICF--FFPYLLYKRNG 1292
                PQ  + GI   E      L  +  G + +  C   F   +  K NG
Sbjct: 884  EK-EPQDSKAGIFTWEI----ILDMLIYGTWMAACCLACFITVIYGKGNG 928

>Scas_710.41
          Length = 904

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 652 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSYGR-AYTEALAGLRKRQGID 703
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 354 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAATRKKKGLD 407

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 652 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGID 703
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 351 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLD 404

>Scas_688.1
          Length = 913

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 652 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSYGR-AYTEALAGLRKRQGID 703
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 362 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLD 415

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 652 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGID 703
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 396 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLD 449

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 47/121 (38%), Gaps = 26/121 (21%)

Query: 1099 CRVSPAQKAAVVKLVKNT--LDVMTLAIGDGSNDVAMIQSADVGIGIAG--EEGRQAVMC 1154
              V P  K  VV++++N   L  MT   GDG ND   ++ AD GI + G  +  R A   
Sbjct: 637  AEVFPQHKYRVVEILQNRGYLVAMT---GDGVNDAPSLKKADTGIAVEGATDAARSAADI 693

Query: 1155 SDYAIGQFRYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLAL---------FWYGIYN 1205
               A G    +  L          + S  I    Y  V++ +AL          W  I N
Sbjct: 694  VFLAPGLSAIIDAL----------KTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAILN 743

Query: 1206 N 1206
            N
Sbjct: 744  N 744

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 652 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSYGR-AYTEALAGLRKRQGID 703
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 367 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLD 420

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 142/655 (21%), Positives = 240/655 (36%), Gaps = 158/655 (24%)

Query: 400  GDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDIA 459
            GD+V +   D IPAD+ L+S                 + N +  +AL     +  S+D  
Sbjct: 145  GDLVVVKVGDTIPADLRLVS-----------------QQNFETDEALLTGESLPVSKDAN 187

Query: 460  RTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNML----------LRGCTLR 509
                  + E P  +    + NL +  ST  + R + + I   L          LRG    
Sbjct: 188  EI---FDDETPVGD----RINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNEL 240

Query: 510  NTK-----WAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISG 564
             ++     W     +     TK  + A +  T+ + + R+L+   ++ F +  +   +  
Sbjct: 241  ISRDPAKTWYQNAWI----STKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVM 296

Query: 565  LANGIDYDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQ 624
             +   D D+                    G   + V V L  S++P SL + + I  +  
Sbjct: 297  ASQKFDVDR--------------------GVAIYAVCVAL--SMIPSSLVVVLTITMSVG 334

Query: 625  AAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVS 684
            AA +    ++   KLD           + LG +  I SDKTGTLTQ  M  K+  +    
Sbjct: 335  AAVMASRNVIIR-KLDS---------LEALGAVNDICSDKTGTLTQGKMIAKQIWVP--K 382

Query: 685  YGRAYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFIS 744
            +G                 ++  G  E     K     IN + NLS      P E +   
Sbjct: 383  FGT----------------LQVVGSNEPLNPEKGD---INFIPNLS------PYEYSHNE 417

Query: 745  KE---IVQDFKGR------NGDIQKKCCEHFM--LALALCHSVLTEPSPTNPNKLEMKAQ 793
             E   I+Q+FK +       G+ Q +  + ++   +LA   SV T+P        E KA 
Sbjct: 418  TEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETK-----EWKAH 472

Query: 794  S-PDEAAL--VTTARDLGFCFMGKTKTGM-----VVEIQGIQKEFEILNI-------LEF 838
              P E A+    T  DL    +   +  M     +  +   +K+    N          F
Sbjct: 473  GDPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPF 532

Query: 839  NSARKRMSCIIKIPGATPNDEPRALLICKGA-DSVI------YSRLSTKAGENDETLLEK 891
            +S  KRMS + +       D     +  KGA +SV+      Y R    A    +  ++ 
Sbjct: 533  DSTIKRMSSVYE-----SRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDT 587

Query: 892  TALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIERDL 951
               +++  ++EGLR L  A +    S+  E              + +++    D  E  L
Sbjct: 588  IKENIDSMSSEGLRVLAFANKSYPKSDVNE-------------EKLQKILKERDYAETGL 634

Query: 952  ILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDM 1006
              LG   I D  ++    ++    +AGI + +LTGD   TA  I     +L  ++
Sbjct: 635  TFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNL 689

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 109/270 (40%), Gaps = 38/270 (14%)

Query: 822  EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVI--YSRLST 879
            E+  I+   + +  L FNS RK M+  I  P      + +  +  KGA   I  YS    
Sbjct: 461  EMPDIRNTVQKVQELPFNSKRKLMATKILNPV-----DNKCTVYVKGAFERILEYSTSYL 515

Query: 880  KA-GENDETLLEKTALHLEQ----YATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLT 934
            K+ G+  E L E     + +     A+EGLR    A+  L+ S                 
Sbjct: 516  KSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTP-------------- 561

Query: 935  NREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAIN 994
                    +++ + +DL   G   + D  +  V  +I  L + G+ + ++TGD   TA+N
Sbjct: 562  --------LTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVN 613

Query: 995  IGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAK 1054
            I     +   D +L V+  +G+ + E  +D    V   ++ + R       + +     +
Sbjct: 614  IAKQIGIPVIDPKLSVL--SGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKR 671

Query: 1055 GDHSFPKGDFAVVIDGDALKIALTGDDMKR 1084
            GD     GD   V D  ALK++  G  M R
Sbjct: 672  GDVVAMTGDG--VNDAPALKLSDIGVSMGR 699

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 652 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGID 703
           + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEADDLMLTACLAASRKKKGLD 401

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 73/174 (41%), Gaps = 40/174 (22%)

Query: 833 LNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGE--------- 883
           +N + FNS RK M+        T +   + ++  KGA   I  +     G          
Sbjct: 460 INEIPFNSKRKFMAV------KTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKP 513

Query: 884 NDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEY-TEWNARYDIAAASLTNREEQLEI 942
           ND+ ++   A+ L   A+EGLRTL  A+ E++ +    E+N             E+ +E 
Sbjct: 514 NDKAIINDAAVAL---ASEGLRTLAFAELEVSATHGDKEFN-------------EDMVE- 556

Query: 943 VSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIG 996
                   L   G  A+ D  +  V  +I  L +  + + ++TGD   TA++I 
Sbjct: 557 -------GLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIA 603

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 652 DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKR 699
           + LG +  I SDKTGTLT N M   K    G    +    AL+ +++R
Sbjct: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKER 402

>Kwal_47.17522
          Length = 899

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 652 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSYGR-AYTEALAGLRKRQGID 703
           + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPDDLMLTACLAASRKKKGLD 401

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 652 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSYGR-AYTEALAGLRKRQGID 703
           + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLTACLAASRKKKGLD 401

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 1097 LCCRVSPAQKAAVVKLVK------NTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQ 1150
            +   V P +KAA VK ++      N    +   +GDG ND   + +ADVGI +A   G +
Sbjct: 972  VIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGINDAPALAAADVGIALA--SGSE 1029

Query: 1151 AVMCS 1155
              M S
Sbjct: 1030 LAMTS 1034

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 2/73 (2%)

Query: 1101 VSPAQKAAVVKLVKNT--LDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYA 1158
            V P  KA  ++ ++ T    V    +GDG ND   I +ADVGI +A       + C    
Sbjct: 1065 VLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISLASGSDLAMISCDFVL 1124

Query: 1159 IGQFRYLTRLLLV 1171
            + +   LT ++++
Sbjct: 1125 LSKKNPLTGIVVL 1137

>YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protein
           with similarity to transcription factors, contains a
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1857 bp, 618 aa]
          Length = 618

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 45/100 (45%), Gaps = 11/100 (11%)

Query: 635 YNAKLDYPCTPKSWNISD-DLGQIEYIFSDKTGTLTQNVMEF--KKCTINGVSYGRAYTE 691
           +NAKL+  C   S + +D +    ++I   K   L +   +    KC I   +Y  AYT+
Sbjct: 333 HNAKLESECDSSSHSDADLEKHDTDFISPSKFRELVKTPQDLYDNKCLIKPHNYKLAYTK 392

Query: 692 ALAGLRKR--------QGIDVEAEGRREKEEIAKDRDVMI 723
            L  LRK+        +   V+ E   +K  +  D +V+I
Sbjct: 393 LLTTLRKKFLEGAEIDKSASVKDEHSTQKHNLRYDLEVII 432

>AFR269W [3461] [Homologous to ScYGL241W (KAP114) - SH]
            complement(916449..919505) [3057 bp, 1018 aa]
          Length = 1018

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 941  EIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCN 1000
            E + D++ RDL+LLG    E  L +G  E +  +AE+ I + +      E  +N    C 
Sbjct: 292  EALLDAVLRDLVLLGAY-YEQHLAEGDEELLKAVAESAIHMVIFLSSVHECKLNTERMCM 350

Query: 1001 LLNN 1004
            LL +
Sbjct: 351  LLGS 354

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 55/124 (44%), Gaps = 17/124 (13%)

Query: 883  ENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEI 942
            E+D  +++K   +++  + EGLR L  A + +   E           A SL    E+L  
Sbjct: 583  EDDLEIIQK---NVDTLSNEGLRVLAFATKTIPAEE-----------AESLG---ERLTK 625

Query: 943  VSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLL 1002
              D +E DLI  G   I D  +     ++     AGI + +LTGD   TA  I     +L
Sbjct: 626  DRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGIL 685

Query: 1003 NNDM 1006
             +++
Sbjct: 686  PHNL 689

>Kwal_14.1498
          Length = 939

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 67/167 (40%), Gaps = 33/167 (19%)

Query: 836 LEFNSARKRMSCIIKIPGATPNDEPRALLICKGA------DSVIYSRLSTKAGENDETLL 889
           + FNS RK M+  +K          + ++  KGA       S  +     K  + D  L 
Sbjct: 465 ISFNSKRKFMAVKVK------EANGKFVVHVKGAYEKILEKSTHFINAENKVVKLDSNLR 518

Query: 890 EKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIER 949
           +      +  A++GLRTL  AQ EL+       N++               ++  D I  
Sbjct: 519 QAITDSADALASDGLRTLAFAQLELS-----NGNSK---------------KLTEDDIN- 557

Query: 950 DLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIG 996
            L   G   + D  +  V  ++  L+E  + + ++TGD   TA++I 
Sbjct: 558 GLTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSIA 604

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
            cerevisiae YDR270w CCC2 probable copper-transporting
            ATPase, start by similarity
          Length = 975

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 86/231 (37%), Gaps = 35/231 (15%)

Query: 990  ETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNS-LISKYLREKFGLSGSEM 1048
            E  I  G SCN+ + +   +   T G   L   E   ++ +S L   Y+     L G   
Sbjct: 687  EVLIGKGISCNITDKNTSKIHTITIGNKKLFPDESLSDIASSTLTESYVSIDGSLVGKFE 746

Query: 1049 ELDNAKGDHSFPK------GDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVS 1102
              D  K D  F        G    ++ GDA + AL    + ++  +   +  +     V+
Sbjct: 747  ISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSAL---KVAQQLGISANDVFS----EVT 799

Query: 1103 PAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAG------EEGRQAVMCSD 1156
            P QK  +V  ++N        +GDG ND   +  AD+GI I+       E     ++ SD
Sbjct: 800  PEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSGTDIAIEAADIVILDSD 859

Query: 1157 YAIGQFRYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNF 1207
                  + L   L            ++  + FY+     L  FW   YN F
Sbjct: 860  NKNNSLKGLVYAL------------DIARKTFYR---VKLNFFWAVCYNTF 895

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 59/124 (47%), Gaps = 15/124 (12%)

Query: 884  NDETLLEK-TALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEI 942
            N+E L+ K  + ++    T  + T+ +  ++L   E     +  DIA+++LT  E  + I
Sbjct: 685  NEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDE-----SLSDIASSTLT--ESYVSI 737

Query: 943  VSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLL 1002
                   D  L+G   I DR+++     +  L   GIK  ++TGD  ++A+ +     + 
Sbjct: 738  -------DGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGIS 790

Query: 1003 NNDM 1006
             ND+
Sbjct: 791  ANDV 794

>KLLA0F17523g join(complement(1609428..1609446), similar to
           sp|P34160 Saccharomyces cerevisiae YMR125w GCR3 large
           subunit of the nuclear cap-binding protein complex CBC
           singleton, hypothetical start
          Length = 857

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 11/64 (17%)

Query: 699 RQGIDVEAEG--RREKEEIAKDRDV---------MINDLRNLSNNTQFFPDEITFISKEI 747
           ++G D E E   R  +   AK + +         M+ D+R +  + + FP++I F+S+ I
Sbjct: 3   KRGFDYEEESGYREARPHFAKRQRLPPVVMLCKDMMPDIRTMGESAKAFPEDIKFLSEAI 62

Query: 748 VQDF 751
           V +F
Sbjct: 63  VHEF 66

>KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042
            Saccharomyces cerevisiae YBL084c CDC27 subunit of
            anaphase-promoting complex (cyclosome), start by
            similarity
          Length = 710

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query: 1481 PRGFEMSGRTPDIPQTQWESPEREEQNLLNS------PQANVGLG 1519
            P    M  R+ + PQT +++P R  QNL NS        +NVG+ 
Sbjct: 259  PPNCSMDSRSRNKPQTPFKAPSRNRQNLSNSQTTSLLSASNVGVS 303

>Kwal_26.7931
          Length = 595

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 924 ARYDIAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIAL-LAEAGIKLW 982
           AR DIA   L        ++ +  E+DL  L GT + D +   VP+  +  +A   IKLW
Sbjct: 158 ARLDIAQVPLNLSLSDKNLLRNLDEKDLRALNGTRVTDEILQLVPKPTSFKIALRAIKLW 217

Query: 983 V 983
            
Sbjct: 218 A 218

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 50,950,676
Number of extensions: 2288860
Number of successful extensions: 6464
Number of sequences better than 10.0: 85
Number of HSP's gapped: 6389
Number of HSP's successfully gapped: 158
Length of query: 1552
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1437
Effective length of database: 12,615,039
Effective search space: 18127811043
Effective search space used: 18127811043
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)