Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L11792g57956528950.0
YER165W (PAB1)57757423980.0
Scas_576.757556522920.0
Sklu_1838.358958222600.0
Kwal_56.2348658757922250.0
AGR122C58557220220.0
KLLA0C17600g59259219330.0
YFR023W (PES4)6113883444e-34
Sklu_1706.16722963455e-34
AEL016C6782953207e-31
Scas_607.106052963091e-29
Kwal_0.3705602932877e-27
KLLA0A08338g7662082721e-24
YHR015W (MIP6)6593362682e-24
CAGL0I08943g6024282621e-23
Scas_697.106104182477e-22
AGR390C3783202091e-17
Scas_671.44431672111e-17
KLLA0E08745g4752142075e-17
CAGL0H10604g4161892031e-16
Kwal_56.247098282472061e-16
ADR307W5663222005e-16
KLLA0C11495g4451731985e-16
YNL016W (PUB1)4531661976e-16
Kwal_27.114474391751961e-15
CAGL0E03245g4251891932e-15
AFR107W3962041913e-15
Kwal_55.201545223521915e-15
ADL160W5261351906e-15
Scas_621.104151781842e-14
Scas_645.147172211863e-14
AEL217W8342161836e-14
Scas_637.23773081734e-13
YCL011C (GBP2)4271981745e-13
Sklu_1879.44211731735e-13
YGR159C (NSR1)4141821718e-13
CAGL0M03795g5132361702e-12
Sklu_2307.26971921702e-12
Scas_558.14352411673e-12
CAGL0B04807g4191961656e-12
KLLA0C12925g5701351657e-12
AGL250W7291971651e-11
KLLA0A05346g8743161641e-11
AAL018W3371921592e-11
Scas_635.75811761622e-11
Kwal_55.219605971351622e-11
YGR250C7812221613e-11
CAGL0E01947g4521741593e-11
CAGL0H02123g5553331593e-11
CAGL0B04169g8611721595e-11
ADR035C8384101586e-11
KLLA0D11792g6852021561e-10
KLLA0C14388g2031901471e-10
CAGL0J11154g3802191531e-10
Sklu_2442.114642011542e-10
Sklu_2085.22091191472e-10
YOL123W (HRP1)5341381542e-10
Kwal_23.39858762001542e-10
Scas_665.42191771472e-10
YNL004W (HRB1)4293121504e-10
ABL059W2041651436e-10
CAGL0F08217g6784221497e-10
Kwal_27.118326861951498e-10
YPR112C (MRD1)8871741499e-10
YHR086W (NAM8)5234071471e-09
YOR319W (HSH49)2131801401e-09
Scas_157.12321711392e-09
YPL043W (NOP4)6852051443e-09
Sklu_905.15152221433e-09
KLLA0F14861g5891731408e-09
KLLA0D14949g8782081419e-09
CAGL0L12672g6822051381e-08
Scas_598.15161381372e-08
Kwal_27.123372091261312e-08
AAR151W4812681344e-08
CAGL0L03806g2551041305e-08
KLLA0F18216g7083191336e-08
Kwal_0.2502161181278e-08
Scas_705.22869971311e-07
KLLA0D05016g2621341252e-07
CAGL0I09900g2111881223e-07
Kwal_14.1851535771264e-07
ADR183C320851235e-07
YMR268C (PRP24)4443001246e-07
ABL134C3751391237e-07
Sklu_1715.13961571211e-06
Sklu_1790.3473841221e-06
KLLA0C08019g301961191e-06
Scas_88.1256641182e-06
CAGL0K06655g802771212e-06
YNL175C (NOP13)4031601202e-06
Kwal_55.209721351101122e-06
Sklu_2257.4188741142e-06
CAGL0H03861g4432261192e-06
YBR212W (NGR1)672771202e-06
CAGL0D05236g4431111174e-06
YIR005W (IST3)148751104e-06
Scas_376.14041591166e-06
Scas_316.14831581158e-06
Kwal_33.144633931531148e-06
KLLA0C05522g5401011141e-05
YOL041C (NOP12)459681131e-05
KLLA0F07799g524841122e-05
CAGL0D06182g280911102e-05
Sklu_2353.5252611092e-05
YGL044C (RNA15)296791084e-05
CAGL0J01914g169831044e-05
Kwal_26.7179456771094e-05
AFL050W218821055e-05
Sklu_2182.33711781075e-05
Scas_701.3321741067e-05
KLLA0D08206g3911581068e-05
YIL061C (SNP1)300991059e-05
CAGL0F01023g396661069e-05
CAGL0H04763g383751051e-04
YNL110C (NOP15)2201241012e-04
Sklu_2375.5207831002e-04
Kwal_23.5864278921012e-04
ADL063W320611012e-04
Scas_621.163141191012e-04
Scas_643.16448581023e-04
ACR274W426501023e-04
Sklu_2213.4257741003e-04
CAGL0C01529g23686993e-04
KLLA0B10472g198100983e-04
AFR649W310761003e-04
Kwal_47.18572363801013e-04
YIR001C (SGN1)25077994e-04
Scas_720.224583984e-04
Kwal_27.1109620179974e-04
Kwal_26.752226274985e-04
Scas_709.2*17163965e-04
KLLA0F09383g25864985e-04
CAGL0M12573g29974995e-04
AGR010C26664985e-04
YPL178W (CBC2)20875966e-04
KLLA0B00979g342170986e-04
Scas_717.4137984988e-04
KLLA0E11011g432210970.001
Sklu_2060.3110103900.001
KLLA0E19118g652195970.001
Kwal_55.2090314794910.001
ADR017W17399920.002
YDR432W (NPL3)41475950.002
Scas_530.4684333940.002
Scas_565.832273930.003
CAGL0J02200g144104880.004
AFL224W20673870.008
Scas_570.1411379830.009
Scas_241.118678860.009
Sklu_1984.328486870.013
Kwal_33.1349633072870.013
YFR032C289140870.014
KLLA0D13772g34568870.015
KLLA0D13420g166107830.020
Kwal_26.845821972840.023
Scas_714.5923360840.028
KLLA0F23650g31272840.037
YBL051C (PIN4)66838840.039
Kwal_27.10364443195840.040
KLLA0B11594g11484770.053
KLLA0B14432g17381800.054
Kwal_55.2041428492810.062
KLLA0E01936g484117820.065
KLLA0E00484g242212800.081
YDR429C (TIF35)27460800.097
AER349C21865790.11
Kwal_55.2071859487800.13
Kwal_30.1289028061780.15
Sklu_2407.322172770.16
Sklu_2249.430978780.17
Scas_666.1122472750.31
CAGL0A04213g63938770.32
ADR001C32466760.33
Sklu_2221.828158740.49
Scas_611.5*787151750.51
KLLA0D16049g42570750.53
ADL064W64688750.54
YER068W (MOT2)587132750.56
Sklu_2434.1473647740.67
CAGL0H03267g77575730.85
ADR189W26959720.89
AAR022W11480681.0
YML072C154526731.1
Sklu_2412.499650721.3
CAGL0H04675g27480701.6
Scas_589.453091711.7
CAGL0H02211g381259701.7
Kwal_26.682473947701.9
YNL286W (CUS2)28590673.8
CAGL0C03355g30973674.2
Sklu_2353.461696674.4
CAGL0J03102g62095666.6
Kwal_23.651631480657.1
ABR121C31473647.9
Scas_598.679051658.2
Sklu_2391.176169659.2
Scas_674.25*883129659.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L11792g
         (570 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L11792g 1259275..1261014 highly similar to sp|P04147 Saccha...  1119   0.0  
YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding prot...   928   0.0  
Scas_576.7                                                            887   0.0  
Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement        875   0.0  
Kwal_56.23486                                                         861   0.0  
AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH] (978634..98...   783   0.0  
KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces...   749   0.0  
YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA po...   137   4e-34
Sklu_1706.1 YFR023W, Contig c1706 1364-3382                           137   5e-34
AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W (...   127   7e-31
Scas_607.10                                                           123   1e-29
Kwal_0.370                                                            115   7e-27
KLLA0A08338g 736461..738761 weakly similar to sp|P39684 Saccharo...   109   1e-24
YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similar...   107   2e-24
CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces c...   105   1e-23
Scas_697.10                                                           100   7e-22
AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH] (1446842..1...    85   1e-17
Scas_671.4                                                             86   1e-17
KLLA0E08745g 782800..784227 some similarities with sp|P32588 Sac...    84   5e-17
CAGL0H10604g complement(1033488..1034738) similar to sp|P32588 S...    83   1e-16
Kwal_56.24709                                                          84   1e-16
ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH] complement(...    82   5e-16
KLLA0C11495g complement(990832..992169) some similarities with s...    81   5e-16
YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylate...    80   6e-16
Kwal_27.11447                                                          80   1e-15
CAGL0E03245g complement(299236..300513) similar to sp|P27476 Sac...    79   2e-15
AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH] complement(...    78   3e-15
Kwal_55.20154                                                          78   5e-15
ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH] complement(...    78   6e-15
Scas_621.10                                                            75   2e-14
Scas_645.14                                                            76   3e-14
AEL217W [2289] [Homologous to ScYGR250C - SH] complement(225217....    75   6e-14
Scas_637.2                                                             71   4e-13
YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein inv...    72   5e-13
Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement         71   5e-13
YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar ...    70   8e-13
CAGL0M03795g complement(428607..430148) highly similar to sp|Q99...    70   2e-12
Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement         70   2e-12
Scas_558.1                                                             69   3e-12
CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces c...    68   6e-12
KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383 S...    68   7e-12
AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH] complement(...    68   1e-11
KLLA0A05346g 485886..488510 some similarities with sp|P53316 Sac...    68   1e-11
AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C (G...    66   2e-11
Scas_635.7                                                             67   2e-11
Kwal_55.21960                                                          67   2e-11
YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein...    67   3e-11
CAGL0E01947g 193225..194583 some similarities with sp|Q99383 Sac...    66   3e-11
CAGL0H02123g complement(188454..190121) similar to sp|Q00539 Sac...    66   3e-11
CAGL0B04169g complement(404713..407298) highly similar to tr|Q06...    66   5e-11
ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH] (768392..77...    65   6e-11
KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces...    65   1e-10
KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181 S...    61   1e-10
CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces...    64   1e-10
Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement      64   2e-10
Sklu_2085.2 YOR319W, Contig c2085 3158-3787                            61   2e-10
YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylate...    64   2e-10
Kwal_23.3985                                                           64   2e-10
Scas_665.4                                                             61   2e-10
YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with simila...    62   4e-10
ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH] complement(...    60   6e-10
CAGL0F08217g complement(814508..816544) similar to sp|P53316 Sac...    62   7e-10
Kwal_27.11832                                                          62   8e-10
YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein w...    62   9e-10
YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated ...    61   1e-09
YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein a...    59   1e-09
Scas_157.1                                                             58   2e-09
YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein r...    60   3e-09
Sklu_905.1 YMR268C, Contig c905 196-1743                               60   3e-09
KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539 S...    59   8e-09
KLLA0D14949g complement(1259860..1262496) similar to sgd|S000631...    59   9e-09
CAGL0L12672g complement(1359637..1361685) similar to sp|P37838 S...    58   1e-08
Scas_598.1                                                             57   2e-08
Kwal_27.12337                                                          55   2e-08
AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH] complement(6...    56   4e-08
CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces c...    55   5e-08
KLLA0F18216g 1677731..1679857 some similarities with sp|P38741 S...    56   6e-08
Kwal_0.250                                                             54   8e-08
Scas_705.22                                                            55   1e-07
KLLA0D05016g complement(431592..432380) similar to sp|P25555 Sac...    53   2e-07
CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces c...    52   3e-07
Kwal_14.1851                                                           53   4e-07
ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH] (1024792..1...    52   5e-07
YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA...    52   6e-07
ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH] (140625..14...    52   7e-07
Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement          51   1e-06
Sklu_1790.3 YOL041C, Contig c1790 1701-3122                            52   1e-06
KLLA0C08019g complement(704199..705104) some similarities with s...    50   1e-06
Scas_88.1                                                              50   2e-06
CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces c...    51   2e-06
YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleola...    51   2e-06
Kwal_55.20972                                                          48   2e-06
Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement         49   2e-06
CAGL0H03861g complement(361189..362520) similar to sp|P38922 Sac...    50   2e-06
YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible R...    51   2e-06
CAGL0D05236g 499006..500337 weakly similar to sp|P43607 Saccharo...    50   4e-06
YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in ...    47   4e-06
Scas_376.1                                                             49   6e-06
Scas_316.1                                                             49   8e-06
Kwal_33.14463                                                          49   8e-06
KLLA0C05522g 494240..495862 some similarities with sp|P32831 Sac...    49   1e-05
YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein ...    48   1e-05
KLLA0F07799g complement(734889..736463) similar to sp|Q08208 Sac...    48   2e-05
CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces c...    47   2e-05
Sklu_2353.5 YIL061C, Contig c2353 10817-11575                          47   2e-05
YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component...    46   4e-05
CAGL0J01914g complement(189309..189818) similar to sp|P40565 Sac...    45   4e-05
Kwal_26.7179                                                           47   4e-05
AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH] complement(...    45   5e-05
Sklu_2182.3 YDR432W, Contig c2182 3920-5035                            46   5e-05
Scas_701.3                                                             45   7e-05
KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces c...    45   8e-05
YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1 snRNA-a...    45   9e-05
CAGL0F01023g complement(108155..109345) similar to tr|Q08208 Sac...    45   9e-05
CAGL0H04763g 454589..455740 highly similar to sp|Q01560 Saccharo...    45   1e-04
YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein ...    44   2e-04
Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement       43   2e-04
Kwal_23.5864                                                           44   2e-04
ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH] complement(...    44   2e-04
Scas_621.16                                                            44   2e-04
Scas_643.16                                                            44   3e-04
ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH] complement...    44   3e-04
Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement         43   3e-04
CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces c...    43   3e-04
KLLA0B10472g complement(914512..915108) similar to sgd|S0006099 ...    42   3e-04
AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073...    43   3e-04
Kwal_47.18572                                                          44   3e-04
YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein wi...    43   4e-04
Scas_720.2                                                             42   4e-04
Kwal_27.11096                                                          42   4e-04
Kwal_26.7522                                                           42   5e-04
Scas_709.2*                                                            42   5e-04
KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces c...    42   5e-04
CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces...    43   5e-04
AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH] (736609..7...    42   5e-04
YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of nu...    42   6e-04
KLLA0B00979g 77439..78467 some similarities with sp|Q01560 Sacch...    42   6e-04
Scas_717.41                                                            42   8e-04
KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces c...    42   0.001
Sklu_2060.3 YIR009W, Contig c2060 4599-4931                            39   0.001
KLLA0E19118g 1694566..1696524 some similarities with sp|Q08925 S...    42   0.001
Kwal_55.20903                                                          40   0.001
ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH] complement(...    40   0.002
YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved i...    41   0.002
Scas_530.4                                                             41   0.002
Scas_565.8                                                             40   0.003
CAGL0J02200g complement(215042..215476) similar to sp|P40561 Sac...    39   0.004
AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH] complement...    38   0.008
Scas_570.14                                                            37   0.009
Scas_241.1                                                             38   0.009
Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement         38   0.013
Kwal_33.13496                                                          38   0.013
YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein...    38   0.014
KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4 A...    38   0.015
KLLA0D13420g complement(1157491..1157991) some similarities with...    37   0.020
Kwal_26.8458                                                           37   0.023
Scas_714.59                                                            37   0.028
KLLA0F23650g 2210563..2211501 some similarities with sp|P53927 S...    37   0.037
YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein wit...    37   0.039
Kwal_27.10364                                                          37   0.040
KLLA0B11594g complement(1018044..1018388) some similarities with...    34   0.053
KLLA0B14432g 1267356..1267877 weakly similar to sp|P36036 Saccha...    35   0.054
Kwal_55.20414                                                          36   0.062
KLLA0E01936g 183638..185092 similar to sp|Q08287 Saccharomyces c...    36   0.065
KLLA0E00484g complement(45755..46483) similar to sp|P10080 Sacch...    35   0.081
YDR429C (TIF35) [1252] chr4 complement(1324465..1325289) Transla...    35   0.097
AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,...    35   0.11 
Kwal_55.20718                                                          35   0.13 
Kwal_30.12890                                                          35   0.15 
Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement         34   0.16 
Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement         35   0.17 
Scas_666.11                                                            33   0.31 
CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces c...    34   0.32 
ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH] (708437..70...    34   0.33 
Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement       33   0.49 
Scas_611.5*                                                            33   0.51 
KLLA0D16049g complement(1352380..1353657) some similarities with...    33   0.53 
ADL064W [1677] [Homologous to ScYER068W (MOT2) - SH] complement(...    33   0.54 
YER068W (MOT2) [1499] chr5 (293048..294811) Zinc finger transcri...    33   0.56 
Sklu_2434.14 YOR361C, Contig c2434 32150-34360                         33   0.67 
CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces c...    33   0.85 
ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH] complement...    32   0.89 
AAR022W [208] [Homologous to ScYIR009W (MSL1) - SH] complement(3...    31   1.0  
YML072C (TCB3) [3897] chr13 complement(124730..129367) Protein c...    33   1.1  
Sklu_2412.4 YMR124W, Contig c2412 7729-10719                           32   1.3  
CAGL0H04675g complement(447256..448080) highly similar to sp|Q04...    32   1.6  
Scas_589.4                                                             32   1.7  
CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces c...    32   1.7  
Kwal_26.6824                                                           32   1.9  
YNL286W (CUS2) [4325] chr14 (95221..96078) Suppressor of U2 snRN...    30   3.8  
CAGL0C03355g 337923..338852 similar to sp|P53743 Saccharomyces c...    30   4.2  
Sklu_2353.4 YER068W, Contig c2353 8340-10190                           30   4.4  
CAGL0J03102g 294126..295988 similar to sp|P34909 Saccharomyces c...    30   6.6  
Kwal_23.6516                                                           30   7.1  
ABR121C [713] [Homologous to ScYNR054C - SH] (616903..617847) [9...    29   7.9  
Scas_598.6                                                             30   8.2  
Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement          30   9.2  
Scas_674.25*                                                           30   9.6  

>CAGL0L11792g 1259275..1261014 highly similar to sp|P04147
           Saccharomyces cerevisiae YER165w PAB1 mRNA
           polyadenylate-binding protein, start by similarity
          Length = 579

 Score = 1119 bits (2895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/565 (95%), Positives = 542/565 (95%)

Query: 1   MADITEKTAEQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGA 60
           MADITEKTAEQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGA
Sbjct: 1   MADITEKTAEQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGA 60

Query: 61  VSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKK 120
           VSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKK
Sbjct: 61  VSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKK 120

Query: 121 GAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXX 180
           GAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHF          
Sbjct: 121 GAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESASEAI 180

Query: 181 XXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFG 240
             LNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFG
Sbjct: 181 DALNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFG 240

Query: 241 KTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQE 300
           KTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQE
Sbjct: 241 KTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQE 300

Query: 301 LKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKG 360
           LKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKG
Sbjct: 301 LKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKG 360

Query: 361 FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRFQQXX 420
           FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRFQQ  
Sbjct: 361 FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRFQQAS 420

Query: 421 XXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQMANMGAMPKNGMPPHQFRNGPVY 480
                    GMPGQFMPPMFYGVMPPRGVPFNGPNPQMANMGAMPKNGMPPHQFRNGPVY
Sbjct: 421 AAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQMANMGAMPKNGMPPHQFRNGPVY 480

Query: 481 GVPPQGGFARNGPAANQFYQQKQRQALGEELYKRIFSRTNDEEAAGKITGMILDLPPQEV 540
           GVPPQGGFARNGPAANQFYQQKQRQALGEELYKRIFSRTNDEEAAGKITGMILDLPPQEV
Sbjct: 481 GVPPQGGFARNGPAANQFYQQKQRQALGEELYKRIFSRTNDEEAAGKITGMILDLPPQEV 540

Query: 541 VPLLENDELFEQHFKEASAAYESFK 565
           VPLLENDELFEQHFKEASAAYESFK
Sbjct: 541 VPLLENDELFEQHFKEASAAYESFK 565

>YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding protein
           of cytoplasm and nucleus, part of the 3'-end
           RNA-processing complex (cleavage factor I), involved in
           translation termination with Sup35p, has 4 RNA
           recognition (RRM) domains [1734 bp, 577 aa]
          Length = 577

 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/574 (78%), Positives = 501/574 (87%), Gaps = 6/574 (1%)

Query: 1   MADITEKTAEQLENLSLQD--KQEGTNEENQS-ETVSASLYVGDLDPSVSEAHLYDIFSP 57
           MADIT+KTAEQLENL++QD  KQ  T  E+QS E  SASLYVGDL+PSVSEAHLYDIFSP
Sbjct: 1   MADITDKTAEQLENLNIQDDQKQAATGSESQSVENSSASLYVGDLEPSVSEAHLYDIFSP 60

Query: 58  IGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSL 117
           IG+VSSIRVCRDAITKTSLGYAYVNFNDH+A + AIE+LN+TPIKG+LCRIMWSQRDPSL
Sbjct: 61  IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL 120

Query: 118 RKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXX 177
           RKKG+GNIFIKNLHPDIDNKALYDTFSVFG+ILSSK+ATDE GKSKGFG+VHF       
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 178 XXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVA 237
                LNGMLLNGQEIYV PHLS+KER+S+ EE KA++TN+Y+KNIN+ETTD++F+EL A
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240

Query: 238 KFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYER 297
           KFG   S  LE+  +G+ KGFGFVN+  HEDAVK VE LN++E  G+ LYV RAQKK ER
Sbjct: 241 KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNER 300

Query: 298 QQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGK 357
              LKKQYEA R+EKMAKYQG+NLF+KNLDDS+DD+KLEEEFAPYGTITSAKVM TENGK
Sbjct: 301 MHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK 360

Query: 358 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRFQ 417
           SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR+Q
Sbjct: 361 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQ 420

Query: 418 QXXXXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQMAN-MGAMPKNGMPPHQFRN 476
           Q           GMPGQFMPPMFYGVMPPRGVPFNGPNPQ  N MG MPKNGMPP QFRN
Sbjct: 421 Q-ATAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMNPMGGMPKNGMPP-QFRN 478

Query: 477 GPVYGVPPQGGFARNGPAANQFYQQKQRQALGEELYKRIFSRTNDEEAAGKITGMILDLP 536
           GPVYGVPPQGGF RN    NQFYQQKQRQALGE+LYK++ ++T++EEAAGKITGMILDLP
Sbjct: 479 GPVYGVPPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGMILDLP 538

Query: 537 PQEVVPLLENDELFEQHFKEASAAYESFKQEQQQ 570
           PQEV PLLE+DELFEQH+KEASAAYESFK+EQ+Q
Sbjct: 539 PQEVFPLLESDELFEQHYKEASAAYESFKKEQEQ 572

>Scas_576.7
          Length = 575

 Score =  887 bits (2292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/565 (76%), Positives = 483/565 (85%), Gaps = 9/565 (1%)

Query: 1   MADITEKTAEQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGA 60
           M+DITEKT EQLENL + + ++  +    +ET  ASLYVG+LDP+VSEA LYDIFSPIG+
Sbjct: 1   MSDITEKTVEQLENLKISESEDQPSTTTSTETSPASLYVGELDPTVSEALLYDIFSPIGS 60

Query: 61  VSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKK 120
           VSSIRVCRDA+TKTSLGYAYVNFNDH+A K AIE+LN+TPIKG+LCRIMWSQRDP+LRKK
Sbjct: 61  VSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALRKK 120

Query: 121 GAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXX 180
           G+GNIFIKNLHPDIDNKAL++TFSVFGNILSSK+ATDETGKSKGFG+VHF          
Sbjct: 121 GSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAI 180

Query: 181 XXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFG 240
             LNGMLLNGQEIYV PHL++KER+S+ EE KA+FTNVY+KNIN ETTD+EF EL AK+G
Sbjct: 181 DALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYG 240

Query: 241 KTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQE 300
              S  LE+T +G+ KGFGFV+F  HEDA K VEELN TEFK Q L+V+RAQKKYER QE
Sbjct: 241 NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQE 300

Query: 301 LKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKG 360
           LKKQYEA+R+EKMAKYQG+NLF+KNLDDSIDD+KL+EEFAPYGTITS +VM T+NGKSKG
Sbjct: 301 LKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKG 360

Query: 361 FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRFQQXX 420
           FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR QMR+QQ  
Sbjct: 361 FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQMRYQQ-A 419

Query: 421 XXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQMANMGAMPKNGMPPHQFRNGPVY 480
                    G+PGQFMPPMFYGVMPPRGVPFNGPNPQ         NG+PP QFRNGP Y
Sbjct: 420 TAAAAAAAAGIPGQFMPPMFYGVMPPRGVPFNGPNPQQM-------NGVPPQQFRNGPGY 472

Query: 481 GVPPQGGFARNGPAANQFYQQKQRQALGEELYKRIFSRTNDEEAAGKITGMILDLPPQEV 540
           G+PPQGGF RNG   NQFYQ+ QRQALGEELYK++ ++  DEEAAGKITGMILDLPPQEV
Sbjct: 473 GMPPQGGFPRNG-VPNQFYQKNQRQALGEELYKKVSAKNADEEAAGKITGMILDLPPQEV 531

Query: 541 VPLLENDELFEQHFKEASAAYESFK 565
           V LLENDELFEQHFKEASAAYESFK
Sbjct: 532 VSLLENDELFEQHFKEASAAYESFK 556

>Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement
          Length = 589

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/582 (73%), Positives = 486/582 (83%), Gaps = 16/582 (2%)

Query: 1   MADITEKTAEQLENLSLQDKQEGTNEENQSE-----TVSASLYVGDLDPSVSEAHLYDIF 55
           M+D+T+KTAEQLE L + D Q+      +SE     T SASLYVG+LDP+V+EA LYD+F
Sbjct: 1   MSDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF 60

Query: 56  SPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDP 115
           SPIG+VSSIRVCRDAITKTSLGYAYVNF+DHDA +TAI+KLN+T IKG+ CRIMWSQRDP
Sbjct: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120

Query: 116 SLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXX 175
           SLRKKG+GNIFIKNLHP IDNKAL+DTFSVFGNILS K+ATDE G SKGFG+VHF     
Sbjct: 121 SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYS 180

Query: 176 XXXXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEEL 235
                  +NGMLLNGQE+YV PH+SKK+R+SK EE K+NFTN+Y+KNI+ ETT +EFE L
Sbjct: 181 AKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240

Query: 236 VAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKY 295
             +FGK  S VLER  EG+ +GFGF+NF +HE A K V+ELN+T+FK Q LYV RAQKKY
Sbjct: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300

Query: 296 ERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTEN 355
           ER QEL+KQYE +R+EK+AKYQG+NLF+KNLDDSIDD+KL +EFAP+G ITSAKVM  + 
Sbjct: 301 ERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA 360

Query: 356 GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 415
           G SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR
Sbjct: 361 GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 420

Query: 416 FQQXXXXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNP-QMANMGAMPKNG-MPPHQ 473
           +QQ           GMPGQFMPPMFYGVMPPRGVPFNGPNP QMA MG MPKNG +PP Q
Sbjct: 421 YQQ-VTAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQ 479

Query: 474 FR--NGPVYGVP----PQGGFARNGPAANQFYQQKQRQALGEELYKRIFSRTNDEEAAGK 527
           F   NGP+YGVP    PQGGF RNG   NQFY QKQRQALGE+LYK++ ++T DEEAAGK
Sbjct: 480 FGRPNGPMYGVPPQGAPQGGFPRNG--GNQFYHQKQRQALGEQLYKKVSAKTQDEEAAGK 537

Query: 528 ITGMILDLPPQEVVPLLENDELFEQHFKEASAAYESFKQEQQ 569
           ITGMILDLPPQEVVPLLEND+LFEQHFKEA AAYESFK++Q+
Sbjct: 538 ITGMILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFKKDQE 579

>Kwal_56.23486
          Length = 587

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/579 (72%), Positives = 483/579 (83%), Gaps = 16/579 (2%)

Query: 1   MADITEKTAEQLENLSLQDKQ-----EGTNEENQSETVSASLYVGDLDPSVSEAHLYDIF 55
           M+D+T+KTAEQLE L +QD+Q        +E  + E  SASLYVG+LDPSV+EA LYD+F
Sbjct: 1   MSDVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLF 60

Query: 56  SPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDP 115
           SPIG+VSSIRVCRDAITKTSLGYAYVNF+DH+A  TAIEKLN+TPIKG+ CRIMWSQRDP
Sbjct: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP 120

Query: 116 SLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXX 175
           SLRKKG+GN+FIKNLHP IDNKAL+DTFSVFGNILS K+ATDETGKS+ FG+VHF     
Sbjct: 121 SLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEA 180

Query: 176 XXXXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEEL 235
                  +NGMLLNG E+YV PH+SKK+R+SK +E+K+NFTNVY+KNI+ ET   EFE+L
Sbjct: 181 AKEAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKL 240

Query: 236 VAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKY 295
            +++G   S VLE   EG+ +GFGFVNF +H  A K VEELN+T+F GQ LYV RAQKKY
Sbjct: 241 FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300

Query: 296 ERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTEN 355
           ER QELKKQYE++RMEK+AKYQG+NLF+KNLDDSIDD+KL+EEFAP+GTITS KVM  + 
Sbjct: 301 ERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA 360

Query: 356 GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 415
           G SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRRSQLAQQIQARNQMR
Sbjct: 361 GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMR 420

Query: 416 FQQXXXXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNP-QMANMGAMPKNGMPPHQF 474
           +QQ           GMPGQFM PMFYGVMPPRGVPFNGPNP QMA M  MPKNG+PP QF
Sbjct: 421 YQQ--ATAAAAAAAGMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNGVPPQQF 478

Query: 475 R--NGPVYGVP---PQGGFARNGPAANQFYQQKQRQALGEELYKRIFSRTNDEEAAGKIT 529
              NGP+YGVP   PQG F RNG   NQF+ QKQRQALGE+LYKR+ ++T DEEAAGKIT
Sbjct: 479 GRPNGPMYGVPPQGPQGAFPRNG---NQFFHQKQRQALGEQLYKRVSAKTQDEEAAGKIT 535

Query: 530 GMILDLPPQEVVPLLENDELFEQHFKEASAAYESFKQEQ 568
           GMILDLPPQEVVPLLENDELF+QHFKEA AAY+SFK++Q
Sbjct: 536 GMILDLPPQEVVPLLENDELFDQHFKEAFAAYDSFKKDQ 574

>AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH]
           (978634..980391) [1758 bp, 585 aa]
          Length = 585

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/572 (70%), Positives = 468/572 (81%), Gaps = 13/572 (2%)

Query: 1   MADITEKTAEQLENLSLQDKQEGTNEENQS---ETVSASLYVGDLDPSVSEAHLYDIFSP 57
           M+DIT+KTAEQLE L ++++   T  E+++   ET  ASLYVG+L+P+VSEA LYDIFSP
Sbjct: 1   MSDITDKTAEQLEQLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSP 60

Query: 58  IGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSL 117
           IG+VSSIRVCRDAIT TSLGYAYVNF+DH+A   AIE+LN+T IKGK CRIMWSQRDPSL
Sbjct: 61  IGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSL 120

Query: 118 RKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXX 177
           RKKG+GNI+IKNLHP IDNK+L++TFS FGNILS KVATDE G S+GFG+VHF       
Sbjct: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDAR 180

Query: 178 XXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVA 237
                ++GML+N QE+YV  H+SKK+R+SK EE+KA FTNVY+KNI+ ET+ +EFEEL  
Sbjct: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240

Query: 238 KFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYER 297
           K+GK  S VLE+  EG+ +GFGFVNF +H  A K V+ELN  EFKGQ LYV RAQKKYER
Sbjct: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYER 300

Query: 298 QQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGK 357
            QELKKQYEA R+EK+AKYQG+NLF+KNLDDSIDD+KL+EEFAP+GTITSAKVM  E G 
Sbjct: 301 LQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN 360

Query: 358 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRFQ 417
           S+GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRR+QLAQQIQARNQMRFQ
Sbjct: 361 SRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQMRFQ 420

Query: 418 QXXXXXXXXXXXGMPGQFM-PPMFYGVMPPRGVPFNGPNPQMANMGAMPKNG-MPPHQF- 474
                       G+PGQFM PPM+YG +PPR VPF GPNPQMA    MPKNG MPP QF 
Sbjct: 421 H-ANAAAAAAVAGLPGQFMPPPMYYGGIPPR-VPFQGPNPQMA---GMPKNGAMPPQQFG 475

Query: 475 RNGPVY-GVPPQGGFARNGPAANQFYQQKQRQALGEELYKRIFSRTNDEEAAGKITGMIL 533
           R GP+Y G  PQG F RNG    QFYQQKQRQALGE+LY+++F++T D+EAAGKITGMIL
Sbjct: 476 RPGPMYGGFAPQGQFPRNG-QQQQFYQQKQRQALGEQLYQKVFAKTQDDEAAGKITGMIL 534

Query: 534 DLPPQEVVPLLENDELFEQHFKEASAAYESFK 565
           DLPPQ+V+ LLENDEL EQHF+EA AAY+ FK
Sbjct: 535 DLPPQQVIQLLENDELLEQHFQEAHAAYQKFK 566

>KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces
           cerevisiae YER165w PAB1 mRNA polyadenylate-binding
           protein, start by similarity
          Length = 592

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/592 (64%), Positives = 460/592 (77%), Gaps = 26/592 (4%)

Query: 1   MADITEKTAEQLENLSLQDKQE---------------GTNEENQSETVSASLYVGDLDPS 45
           M+DITEKTAEQLENL + D Q+                 +  ++ E  +ASLYVG+LDP+
Sbjct: 1   MSDITEKTAEQLENLQINDDQQPAQSASAPSTSASESEASSVSKVENNNASLYVGELDPN 60

Query: 46  VSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKL 105
           ++EA LYD+FSP+G +SSIRVCRDA+TK SLGYAYVN+ D++A K AI++LN+  I G+ 
Sbjct: 61  ITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQELNYAEINGRP 120

Query: 106 CRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGF 165
           CRIMWS+RDP++RKKG+GNIFIKNLHP IDNKAL++TFS FG +LS KVA DE G S+GF
Sbjct: 121 CRIMWSERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGF 180

Query: 166 GYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINT 225
           G+VHF            +NGML+NG E+YV  H+ KK+R SK EE KANFTN+Y+KNI+ 
Sbjct: 181 GFVHFKEESDAKDAIEAVNGMLMNGLEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDV 240

Query: 226 ETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQP 285
           ETTD+EFE+L +++G+  S  LE+  EG+ KGFGFVNFV+H  A K VEELN  EFK Q 
Sbjct: 241 ETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQA 300

Query: 286 LYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTI 345
           LYV RAQKKYER +ELKKQYE  R+EK+AK+QG+NLFIKNLDDSIDD+KL+EEFAPYGTI
Sbjct: 301 LYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKEEFAPYGTI 360

Query: 346 TSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLA 405
           TSA+VM  + G SKGFGFVCFS+PEEATKA+TEKNQQIVAGKPLYVAIAQRKDVRRSQLA
Sbjct: 361 TSARVMRDQEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQRKDVRRSQLA 420

Query: 406 QQIQARNQMRFQQXXXXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQM-ANMGA- 463
           QQIQARNQ+RFQQ           GMPGQ+MP MFYGVM PRG P  GPNP M   MGA 
Sbjct: 421 QQIQARNQIRFQQQQQQQAAAAAAGMPGQYMPQMFYGVMAPRGFP--GPNPGMNGPMGAG 478

Query: 464 MPKNGM--PPHQFR---NGPVY-GVPPQGGFARNGPAANQFYQQKQRQALGEELYKRIFS 517
           +PKNGM  PP QF    NGP+Y G+PPQ  F R+    +   QQKQRQALGE+LYK++ +
Sbjct: 479 IPKNGMVPPPQQFAGRPNGPMYQGMPPQNQFPRHQ-QQHYIQQQKQRQALGEQLYKKVSA 537

Query: 518 RTNDEEAAGKITGMILDLPPQEVVPLLENDELFEQHFKEASAAYESFKQEQQ 569
           + +DE AAGKITGMILDLPPQ+V+ LL+NDE FEQ F+EA AAYE+FK+EQ+
Sbjct: 538 KIDDENAAGKITGMILDLPPQQVIQLLDNDEQFEQQFQEALAAYENFKKEQE 589

>YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA
           polymerase epsilon mutation, contains four RNA
           recognition motif (RRM) domains [1836 bp, 611 aa]
          Length = 611

 Score =  137 bits (344), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 111/388 (28%), Positives = 177/388 (45%), Gaps = 57/388 (14%)

Query: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           L++GDL  +V+E  L  IF    +  S +VC D++TK SLG+ Y+NF D + A+ A+E+L
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 97  NFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNL---HPDIDNKALYDTFSVFGNILSSK 153
           N+T + GK  RIM S R+ + RK    N+F  NL   +P +  +  YDTFS +G ILS K
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRYGKILSCK 212

Query: 154 VATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERES-KFEEMK 212
           + +      K  G+V+F             N     G++I  G H  K+ R    FE  K
Sbjct: 213 LDS-----RKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGIHFDKEVRSVPNFETQK 267

Query: 213 ANF--------------------------------TNVYIKNINTETTDKEFEELVAKFG 240
           +                                   +++IKN+ T TT  +     ++ G
Sbjct: 268 SRLDAETIIEKEQSLNEKHSKGNDKESKNIYSSSQNSIFIKNLPTITTRDDILNFFSEVG 327

Query: 241 KTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQE 300
              S+ L    + +   + FV + N  D+ K ++  NN  F+G+ L V RAQ K ER + 
Sbjct: 328 PIKSIYLSNATKVK-YLWAFVTYKNSSDSEKAIKRYNNFYFRGKKLLVTRAQDKEERAKF 386

Query: 301 LKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTT--ENGKS 358
           ++ Q  +T            LF++NL  ++ +K+  +       I   K+     +   S
Sbjct: 387 IESQKIST------------LFLENL-SAVCNKEFLKYLCHQENIRPFKIQIDGYDENSS 433

Query: 359 KGFGFVCFSTPEEATKAITEKNQQIVAG 386
              GF+ F   E+AT+     N ++V G
Sbjct: 434 TYSGFIKFRNFEDATRIFNFLNNRLVGG 461

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 85/311 (27%), Positives = 131/311 (42%), Gaps = 41/311 (13%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXL 183
           +FI +LH  +  + L   F  + + +S+KV  D  T KS G GY++F            L
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 184 NGMLLNGQEIYVGPHLSKKERESKFEEMKANF-TNVYIKNI---NTETTDKEFEELVAKF 239
           N   +NG+EI + P L    R + F   + NF TNV+  N+   N   T + F +  +++
Sbjct: 153 NYTKVNGKEIRIMPSL----RNTTF---RKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRY 205

Query: 240 GKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVN-------RAQ 292
           GK  S  L+       K  GFV F + + A   ++  NNT F G+ +          R+ 
Sbjct: 206 GKILSCKLD-----SRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGIHFDKEVRSV 260

Query: 293 KKYERQQ-----ELKKQYEATRMEKMAK---------YQGI--NLFIKNLDDSIDDKKLE 336
             +E Q+     E   + E +  EK +K         Y     ++FIKNL        + 
Sbjct: 261 PNFETQKSRLDAETIIEKEQSLNEKHSKGNDKESKNIYSSSQNSIFIKNLPTITTRDDIL 320

Query: 337 EEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
             F+  G I S  +      K   + FV +    ++ KAI   N     GK L V  AQ 
Sbjct: 321 NFFSEVGPIKSIYLSNATKVKYL-WAFVTYKNSSDSEKAIKRYNNFYFRGKKLLVTRAQD 379

Query: 397 KDVRRSQLAQQ 407
           K+ R   +  Q
Sbjct: 380 KEERAKFIESQ 390

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKV-MTTENGKSKGFGFVCFSTPEEATKAITEK 379
           LFI +L +++ ++ L+  F  Y +  SAKV + +   KS G G++ F   EEA KA+ E 
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 380 NQQIVAGKPLYVAIAQRKDVRRSQLAQQI 408
           N   V GK + +  + R    R      +
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGTNV 181

>Sklu_1706.1 YFR023W, Contig c1706 1364-3382
          Length = 672

 Score =  137 bits (345), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 85/296 (28%), Positives = 141/296 (47%), Gaps = 40/296 (13%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
            +L++GDLD  V+E  L D F+   ++ S+++C DAI+K SLGY Y+NF++ + A+ A E
Sbjct: 102 VALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATE 161

Query: 95  KLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNL---HPDIDNKALYDTFSVFGNILS 151
           + N+ P+ GK  RIM S R+   RK    N+F  NL   +  +  +A YDTF  +G ILS
Sbjct: 162 EFNYVPLFGKEVRIMPSLRNSFYRKNIGTNVFFSNLPLENLSLTTRAFYDTFKKYGKILS 221

Query: 152 SKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERES-KFEE 210
            K+      + K  G+++F             NG    G  I  G H  ++ R+S +FE+
Sbjct: 222 CKL-----DRRKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDREVRKSPEFEK 276

Query: 211 MKANF------------------------------TNVYIKNINTETTDKEFEELVAKFG 240
            K+                                  +++KN+     + +  +  ++ G
Sbjct: 277 RKSKLDGMTIIKEKLMTDDEQELQEVAPGTKAPHPNAIFVKNLPVNANEDDILDFFSRIG 336

Query: 241 KTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYE 296
              SV   + P+  N  + FV +    D  + +E+LN   FK + + V RAQK ++
Sbjct: 337 PVKSVFTSKVPK-YNSSWAFVTYKKGSDTSEAIEKLNGEIFKHRKIEVARAQKNFQ 391

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 77/189 (40%), Gaps = 25/189 (13%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSV-VLERTPEGENKGFGFVNFVNHEDAVKCVEEL 276
           ++I +++   T+K   +   K+    SV +        + G+G++NF N EDA K  EE 
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 277 NNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNL---DDSIDDK 333
           N     G+ + +                  + R     K  G N+F  NL   + S+  +
Sbjct: 164 NYVPLFGKEVRI----------------MPSLRNSFYRKNIGTNVFFSNLPLENLSLTTR 207

Query: 334 KLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 393
              + F  YG I S K+      + K  GF+ F     A  AI + N +   G  +   I
Sbjct: 208 AFYDTFKKYGKILSCKL-----DRRKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGI 262

Query: 394 AQRKDVRRS 402
              ++VR+S
Sbjct: 263 HFDREVRKS 271

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 319 INLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGK-SKGFGFVCFSTPEEATKAIT 377
           + LFI +LD+ + +K L + F  Y ++ S K+      K S G+G++ FS  E+A KA  
Sbjct: 102 VALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATE 161

Query: 378 EKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 408
           E N   + GK + +  + R    R  +   +
Sbjct: 162 EFNYVPLFGKEVRIMPSLRNSFYRKNIGTNV 192

>AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W
           (MIP6) - SH] (605004..607040) [2037 bp, 678 aa]
          Length = 678

 Score =  127 bits (320), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 83/295 (28%), Positives = 136/295 (46%), Gaps = 39/295 (13%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
            +L++GDLD  V+E +L D F+   +  S ++C D+ TK SLGY Y+NF++ + A+  IE
Sbjct: 116 VALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIE 175

Query: 95  KLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNL---HPDIDNKALYDTFSVFGNILS 151
           + N+ PI G+  RIM S R+   RK    N+F  NL   +  +  +  YD F  FG ILS
Sbjct: 176 EFNYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLENLALTTRVFYDAFKKFGKILS 235

Query: 152 SKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERES-KFEE 210
            K+      + K  G+V+F             NG    G  I  G H  +  R+S +FE+
Sbjct: 236 CKL-----DRRKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNILCGIHFDRNVRKSPEFEK 290

Query: 211 MKANFTN-----------------------------VYIKNINTETTDKEFEELVAKFGK 241
            KA   +                             V+IKN+          +  ++ G 
Sbjct: 291 RKARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNAVFIKNLPLNPDSDLLLDYFSQIGP 350

Query: 242 TDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYE 296
             S+      +  +  + F+ F    DA   ++ LN+++  G+P+ ++RAQK ++
Sbjct: 351 VKSIFTSNVSKLSS-AWAFITFQKGSDAQDAIDNLNHSQLLGRPIELSRAQKNFQ 404

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 138/317 (43%), Gaps = 38/317 (11%)

Query: 105 LCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSK 163
           + ++  S+  P+L  K    +FI +L   +  K L DTF+ F + +S+K+  D  T KS 
Sbjct: 98  IVKLGRSKDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSL 157

Query: 164 GFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNI 223
           G+GY++F             N + + G+E+ + P L    R S + +     TNV+  N+
Sbjct: 158 GYGYLNFSNEEDAERVIEEFNYIPIFGREVRIMPSL----RNSFYRKNIG--TNVFFSNL 211

Query: 224 ---NTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTE 280
              N   T + F +   KFGK  S  L+R      K  GFV F     A + + E N  E
Sbjct: 212 PLENLALTTRVFYDAFKKFGKILSCKLDR-----RKNIGFVYFEKDSAAKQAIAEYNGKE 266

Query: 281 FKGQPLYVN-----------RAQKKYERQQELKKQYEATRME---------KMAKYQGIN 320
           F G  +                +K+  R +++    E+  M+         KM       
Sbjct: 267 FFGNNILCGIHFDRNVRKSPEFEKRKARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNA 326

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGK-SKGFGFVCFSTPEEATKAITEK 379
           +FIKNL  + D   L + F+  G + S  + T+   K S  + F+ F    +A  AI   
Sbjct: 327 VFIKNLPLNPDSDLLLDYFSQIGPVKS--IFTSNVSKLSSAWAFITFQKGSDAQDAIDNL 384

Query: 380 NQQIVAGKPLYVAIAQR 396
           N   + G+P+ ++ AQ+
Sbjct: 385 NHSQLLGRPIELSRAQK 401

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 86/201 (42%), Gaps = 31/201 (15%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENK----GFGFVNFVNHEDAVKCV 273
           ++I +++ + T+K   +    F K DS V  +     N     G+G++NF N EDA + +
Sbjct: 118 LFIGDLDEKVTEKNLRD---TFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVI 174

Query: 274 EELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNL---DDSI 330
           EE N     G+ + +                  + R     K  G N+F  NL   + ++
Sbjct: 175 EEFNYIPIFGREVRI----------------MPSLRNSFYRKNIGTNVFFSNLPLENLAL 218

Query: 331 DDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 390
             +   + F  +G I S K+      + K  GFV F     A +AI E N +   G  + 
Sbjct: 219 TTRVFYDAFKKFGKILSCKL-----DRRKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNIL 273

Query: 391 VAIAQRKDVRRSQLAQQIQAR 411
             I   ++VR+S   ++ +AR
Sbjct: 274 CGIHFDRNVRKSPEFEKRKAR 294

>Scas_607.10
          Length = 605

 Score =  123 bits (309), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/296 (27%), Positives = 138/296 (46%), Gaps = 40/296 (13%)

Query: 33  VSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTA 92
           +  SL++  L   V+E  LYD+FS   ++ S+++C D+ +K SL Y Y+NF+D   AK A
Sbjct: 90  IVTSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFSDELEAKKA 149

Query: 93  IEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNL---HPDIDNKALYDTFSVFGNI 149
           ++  N+T + G   ++M S R+   RK    N+F  NL   +  +  +A YDTF  +G I
Sbjct: 150 VDDFNYTILFGNEIKMMPSLRNTIYRKNIGTNVFFANLPLENKHLTTRAFYDTFKGYGEI 209

Query: 150 LSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERE-SKF 208
           LS K+      K K  G+V+F             N  +  G +I  G H  K+ R    F
Sbjct: 210 LSCKL-----DKRKNIGFVYFDNDKPAQMVINDFNNKIYFGNKIICGLHFDKEIRNFPNF 264

Query: 209 EEMKANFTN------------------------------VYIKNINTETTDKEFEELVAK 238
           ++ KAN  N                              +++KN+  +  D+E  +  +K
Sbjct: 265 DKRKANIDNKIIIDDELEAANIGVQFKKNSELILPHPNAIFVKNLPFDVPDEEILDHFSK 324

Query: 239 FGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK 294
            G   SV      + ++  + F+ +    D ++     NNT+F+G+ + V+RA+ K
Sbjct: 325 LGPVKSVFSSNVTKYKS-SWAFITYKKQTDTIRATNHFNNTKFQGKTITVSRAKLK 379

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 128/311 (41%), Gaps = 37/311 (11%)

Query: 113 RDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFX 171
           R+   RK+   ++FI  L  D+    LYD FS + +++S K+  D ++ KS  +GY++F 
Sbjct: 82  RNYRSRKRIVTSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFS 141

Query: 172 XXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNI---NTETT 228
                       N  +L G EI + P L    R + + +     TNV+  N+   N   T
Sbjct: 142 DELEAKKAVDDFNYTILFGNEIKMMPSL----RNTIYRKNIG--TNVFFANLPLENKHLT 195

Query: 229 DKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYV 288
            + F +    +G+  S  L++      K  GFV F N + A   + + NN  + G  +  
Sbjct: 196 TRAFYDTFKGYGEILSCKLDKR-----KNIGFVYFDNDKPAQMVINDFNNKIYFGNKIIC 250

Query: 289 --------------NRAQKKYERQQELKKQYEATRMEKMAKYQG-------INLFIKNLD 327
                         ++ +   + +  +  + EA  +    K            +F+KNL 
Sbjct: 251 GLHFDKEIRNFPNFDKRKANIDNKIIIDDELEAANIGVQFKKNSELILPHPNAIFVKNLP 310

Query: 328 DSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK 387
             + D+++ + F+  G + S         KS  + F+ +    +  +A    N     GK
Sbjct: 311 FDVPDEEILDHFSKLGPVKSVFSSNVTKYKS-SWAFITYKKQTDTIRATNHFNNTKFQGK 369

Query: 388 PLYVAIAQRKD 398
            + V+ A+ K+
Sbjct: 370 TITVSRAKLKN 380

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 46/89 (51%), Gaps = 1/89 (1%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEK 379
           LFI  L D + +  L + F+ Y ++ S K+   +++ KS  +G++ FS   EA KA+ + 
Sbjct: 94  LFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFSDELEAKKAVDDF 153

Query: 380 NQQIVAGKPLYVAIAQRKDVRRSQLAQQI 408
           N  I+ G  + +  + R  + R  +   +
Sbjct: 154 NYTILFGNEIKMMPSLRNTIYRKNIGTNV 182

>Kwal_0.370
          Length = 560

 Score =  115 bits (287), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 130/293 (44%), Gaps = 40/293 (13%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
           +SL++GDLDP+V+E  L D F    ++ S+++C D+ T  SLGY Y+NF     A+TAIE
Sbjct: 15  SSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIE 74

Query: 95  KLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNL---HPDIDNKALYDTFSVFGNILS 151
             ++  + G+  RIM S R+   RK    N+F  NL    P +  +  Y+TF  +G +LS
Sbjct: 75  TFSYVNLFGREVRIMPSMRNSYFRKNIGTNVFFSNLPLEQPALTTRVFYETFREYGKVLS 134

Query: 152 SKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERES-KFEE 210
            K+      + K  G+V+F             N     G  +  G H  K  R S +FE+
Sbjct: 135 CKL-----DRRKNIGFVYFESDAAARKAIASYNNKEYYGNIVTCGLHFDKDIRRSPEFEK 189

Query: 211 MKANF------------------------------TNVYIKNINTETTDKEFEELVAKFG 240
            ++                                 ++++KN+     +++     ++ G
Sbjct: 190 RRSRLGSLTVAKENLLSENNVELENHDQNSKDPHPNSIHVKNLPFNICNEDLLNYFSRIG 249

Query: 241 KTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQK 293
              SV   +  E     +GFV +    D  K ++ LN   F  + L VN+A K
Sbjct: 250 PVKSVFTSKL-EAYRSSWGFVTYKKGCDTRKALDSLNGAIFMDRRLEVNKALK 301

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 86/337 (25%), Positives = 143/337 (42%), Gaps = 39/337 (11%)

Query: 109 MWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGY 167
           M +  +P +  +   ++FI +L P++  K L DTF VF +++S K+  D ETG S G+GY
Sbjct: 1   MNNSYNPCVTSQKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGY 60

Query: 168 VHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTE- 226
           ++F             + + L G+E+ + P +    R S F +     TNV+  N+  E 
Sbjct: 61  LNFYSSKDAETAIETFSYVNLFGREVRIMPSM----RNSYFRKNIG--TNVFFSNLPLEQ 114

Query: 227 --TTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQ 284
              T + F E   ++GK  S  L+R      K  GFV F +   A K +   NN E+ G 
Sbjct: 115 PALTTRVFYETFREYGKVLSCKLDR-----RKNIGFVYFESDAAARKAIASYNNKEYYGN 169

Query: 285 PLYVN-RAQKKYERQQELKKQYEATRMEKMAKYQGI--------------------NLFI 323
            +       K   R  E +K+        +AK   +                    ++ +
Sbjct: 170 IVTCGLHFDKDIRRSPEFEKRRSRLGSLTVAKENLLSENNVELENHDQNSKDPHPNSIHV 229

Query: 324 KNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQI 383
           KNL  +I ++ L   F+  G + S      E  +S  +GFV +    +  KA+   N  I
Sbjct: 230 KNLPFNICNEDLLNYFSRIGPVKSVFTSKLEAYRS-SWGFVTYKKGCDTRKALDSLNGAI 288

Query: 384 VAGKPLYV--AIAQRKDVRRSQLAQQIQARNQMRFQQ 418
              + L V  A+    D R   +++  +A N   F+ 
Sbjct: 289 FMDRRLEVNKALKNNGDRRDGTVSKNRRAYNDQNFRS 325

>KLLA0A08338g 736461..738761 weakly similar to sp|P39684
           Saccharomyces cerevisiae YFR023w PES4 DNA-directed DNA
           polymerase epsilon suppressor, start by similarity
          Length = 766

 Score =  109 bits (272), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 107/208 (51%), Gaps = 11/208 (5%)

Query: 15  LSLQDKQEGTNEEN--QSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAIT 72
           ++L + +  T + N  +SE  +A L++GDL  +V+E  L++IF+   + +S+++C D+ T
Sbjct: 117 VNLSNSKHSTQQTNTMKSEKQTA-LFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNT 175

Query: 73  KTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHP 132
           K SLGY Y+NF D   A+ A+++ N+ PI G+  R+M S R+   RK    N+F  NL  
Sbjct: 176 KKSLGYGYLNFGDPKDAENAVDEYNYMPIFGREIRMMPSLRNTYFRKNIGTNVFFSNLPL 235

Query: 133 D---IDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLN 189
           D   +  +  YD F  FG ILS K+      + K  G+++F             NG    
Sbjct: 236 DNTKLTTRVFYDEFKKFGKILSCKL-----DRRKNIGFIYFENDAAAKEAIKQYNGKEFF 290

Query: 190 GQEIYVGPHLSKKERESKFEEMKANFTN 217
              I  G H  +  R+S   E K N  N
Sbjct: 291 DSTIMCGVHFDRNVRKSPEFEQKINRIN 318

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 87/206 (42%), Gaps = 30/206 (14%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSV-VLERTPEGENKGFGFVNFVNHEDAVKCVE 274
           T ++I ++    T+     +  KF   +SV +   +   ++ G+G++NF + +DA   V+
Sbjct: 138 TALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVD 197

Query: 275 ELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKK 334
           E N     G+ +                +   + R     K  G N+F  NL   +D+ K
Sbjct: 198 EYNYMPIFGREI----------------RMMPSLRNTYFRKNIGTNVFFSNL--PLDNTK 239

Query: 335 LE-----EEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
           L      +EF  +G I S K+      + K  GF+ F     A +AI + N +      +
Sbjct: 240 LTTRVFYDEFKKFGKILSCKL-----DRRKNIGFIYFENDAAAKEAIKQYNGKEFFDSTI 294

Query: 390 YVAIAQRKDVRRS-QLAQQIQARNQM 414
              +   ++VR+S +  Q+I   N +
Sbjct: 295 MCGVHFDRNVRKSPEFEQKINRINNL 320

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 4/78 (5%)

Query: 22  EGTNEENQSETVSA--SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYA 79
           E TN+E+++  +    +++V +L  + S  +L + FS IG V S+      ++K    +A
Sbjct: 371 EETNKESKNTKLPHPNAIFVKNLPINPSHDNLLNFFSKIGPVKSVYT--SDVSKFDSSWA 428

Query: 80  YVNFNDHDAAKTAIEKLN 97
           ++ +      KTAIEKLN
Sbjct: 429 FITYKRIQDTKTAIEKLN 446

>YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similarity
           to Pes4p and Pab1p in the N-terminal region, contains
           four RNA recognition (RRM) domains [1980 bp, 659 aa]
          Length = 659

 Score =  107 bits (268), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 91/336 (27%), Positives = 150/336 (44%), Gaps = 55/336 (16%)

Query: 1   MADITEKTAEQLENLSLQ--DKQEGTNEENQSETV-------------------SASLYV 39
           + D+  K AE  E  SL+  D +  T E+ + E V                   + SL++
Sbjct: 56  LGDVKLKDAEVKEKNSLKKYDCKNATQEKKEQEQVFEKTVAKGSVQKYITKTSKTNSLFI 115

Query: 40  GDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFT 99
           G+L  +V+E  L  IF    +  S +VCRD +TK SLGY Y+NF D + A++A ++ N+T
Sbjct: 116 GNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYT 175

Query: 100 PIKGKLCRIMWSQRDPSLRKKGAGNIFIKNL---HPDIDNKALYDTFSVFGNILSSKVAT 156
              G+  +IM S ++   RK    N+F  NL   +P +  ++ Y     +GN+LS  +  
Sbjct: 176 VFFGQEVKIMPSMKNTLFRKNIGTNVFFSNLPLENPQLTTRSFYLIMIEYGNVLSCLLE- 234

Query: 157 DETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERE----SKFEEM- 211
               + K  G+V+F             N     G +I  G H  K+ R     +K ++M 
Sbjct: 235 ----RRKNIGFVYFDNDISARNVIKKYNNQEFFGNKIICGLHFDKEVRTRPEFTKRKKMI 290

Query: 212 ------------------KANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVL-ERTPE 252
                              A    + +KN+ ++TT +E  +  +  G   SV + E+   
Sbjct: 291 GSDIVIEDELLASNNLSDNARSKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQAN 350

Query: 253 GENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYV 288
             +K   FV + N E++ K  + LN T FK   ++V
Sbjct: 351 TPHK--AFVTYKNEEESKKAQKCLNKTIFKNHTIWV 384

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 3/123 (2%)

Query: 289 NRAQKKYERQQELKKQYEATRMEK-MAKYQGIN-LFIKNLDDSIDDKKLEEEFAPYGTIT 346
           N  Q+K E++Q  +K      ++K + K    N LFI NL  ++ ++ L + F  Y +  
Sbjct: 79  NATQEKKEQEQVFEKTVAKGSVQKYITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFE 138

Query: 347 SAKVMTT-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLA 405
           SAKV       KS G+G++ F    +A  A  E N  +  G+ + +  + +  + R  + 
Sbjct: 139 SAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIMPSMKNTLFRKNIG 198

Query: 406 QQI 408
             +
Sbjct: 199 TNV 201

 Score = 35.8 bits (81), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 88/213 (41%), Gaps = 31/213 (14%)

Query: 201 KKERESKFEEM-----------KANFTN-VYIKNINTETTDKEFEELVAKFGKTDSVVLE 248
           KKE+E  FE+            K + TN ++I N+ +  T++   ++  ++   +S  + 
Sbjct: 84  KKEQEQVFEKTVAKGSVQKYITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVC 143

Query: 249 RT-PEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEA 307
           R     ++ G+G++NF +  DA    +E N T F GQ + +  + K    ++ +      
Sbjct: 144 RDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIMPSMKNTLFRKNI------ 197

Query: 308 TRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFS 367
                     G N+F  NL   +++ +L         I    V++    + K  GFV F 
Sbjct: 198 ----------GTNVFFSNL--PLENPQLTTRSFYLIMIEYGNVLSCLLERRKNIGFVYFD 245

Query: 368 TPEEATKAITEKNQQIVAGKPLYVAIAQRKDVR 400
               A   I + N Q   G  +   +   K+VR
Sbjct: 246 NDISARNVIKKYNNQEFFGNKIICGLHFDKEVR 278

>CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces
           cerevisiae YFR023w PES4 DNA-directed DNA polymerase
           epsilon suppressor, hypothetical start
          Length = 602

 Score =  105 bits (262), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 106/428 (24%), Positives = 174/428 (40%), Gaps = 67/428 (15%)

Query: 9   AEQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCR 68
           +E LE + ++ +  GTN +N     + +L+VG+L   ++   L ++F    +  S +VC 
Sbjct: 43  SETLEIVDIRTENLGTNVQN-----NIALFVGNLAEEITSERLTEMFKVYKSFISAKVCT 97

Query: 69  DAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIK 128
           +A    SLG+ Y+NF + + A+ A E  N+  I GK  RIM S RD   RK    NIF  
Sbjct: 98  NADDNRSLGHGYINFGNKEDAERATEDFNYNKIMGKEIRIMPSIRDSVYRKNFGTNIFFS 157

Query: 129 NL---HPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNG 185
           NL      + ++  YD F  +GN+LS K+ +     SK  G+V+F             N 
Sbjct: 158 NLPLQKEKLTHRMFYDIFRKYGNVLSVKLDS-----SKNIGFVYFEDDTIARDVIKEFNN 212

Query: 186 MLLNGQEIYVGPHLSKKER------------------------------ESKFEEMKANF 215
               G  I  G H  K+ R                              E K ++ K   
Sbjct: 213 KEFLGNIISCGLHFDKELRKKPNFDKQISKLDDDIIIEKEKEIFDSNKVEIKIDKDKVAI 272

Query: 216 TN---VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKC 272
                ++IKN+  +T + E   + ++ G   SV L    E     + FV + +     K 
Sbjct: 273 IQPNGIFIKNLPLDTNNNEILAIFSEVGPIKSVFLSPLNESREYLWAFVTYKDKASVEKA 332

Query: 273 VEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDD 332
           +   N      + ++V  A  KY                 +   + I LF+ NL   I D
Sbjct: 333 ISLFNGKAIGNRNVFVTHAYSKYN----------------IPTPKPI-LFLSNLS-PICD 374

Query: 333 KKLEEEFAPYGTIT--SAKVMTTENGKS-KGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
           +K  ++     ++     KV  +EN +     G + F T ++  KA    N ++V+G  +
Sbjct: 375 RKFLKQIMNQLSVKPEDIKVHQSENPEHVTSTGTIQFKTQDDLDKAKKFLNNKLVSGSII 434

Query: 390 YVAIAQRK 397
           Y    + K
Sbjct: 435 YATTRKSK 442

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 318 GINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAI 376
            I LF+ NL + I  ++L E F  Y +  SAKV T  ++ +S G G++ F   E+A +A 
Sbjct: 63  NIALFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERAT 122

Query: 377 TEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 408
            + N   + GK + +  + R  V R      I
Sbjct: 123 EDFNYNKIMGKEIRIMPSIRDSVYRKNFGTNI 154

>Scas_697.10
          Length = 610

 Score = 99.8 bits (247), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 101/418 (24%), Positives = 176/418 (42%), Gaps = 56/418 (13%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
            +L++GDL+  V++  L  IF    +  S +VC D  T  SLG+ Y+NF D + A+ AI+
Sbjct: 101 TALFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAID 160

Query: 95  KLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKA-----LYDTFSVFGNI 149
             N   +  K+ RIM S R  + +K    N+F  NL PD DN+       ++ F  FG I
Sbjct: 161 DFNCMKLGDKVIRIMPSLRGKNTKKSIGTNVFFTNL-PDEDNRLFHSRKFFEIFRQFGKI 219

Query: 150 LSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVG---------PHLS 200
           LS ++       +K  G++ F             N  +  G  I  G         P + 
Sbjct: 220 LSCRL-----DPNKNIGFISFEHEEVAKTVVKKYNNSMFFGNRITCGILSEDNSKKPIME 274

Query: 201 KKERESK-FEEMKANF-------------TN-------VYIKNINTETTDKEFEELVAKF 239
           +K+ ++K F ++   +             TN       V++ N+ T  T +E      K 
Sbjct: 275 EKQEQAKQFSQLNKKYDLNEKNMPRALLNTNNLFIENTVFVSNLPTSITVEEIRNHFNKI 334

Query: 240 GKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQ 299
           G   ++ +       N  + FV +     A++ ++ELNNT  + + + V++A ++ E Q 
Sbjct: 335 GNIMNLFISDKI-SSNALWAFVKYSTAACAIRAIKELNNTFIRKKQIVVSQAFRRGETQF 393

Query: 300 ELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENG--K 357
            L ++    R+          L++K L   I DK    +F     I   ++  T+    K
Sbjct: 394 HLSRK-PTKRI----------LYLKEL-SRICDKDFVSQFCHQRRIKFDEISLTKVNLEK 441

Query: 358 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 415
           S     +   T E+A K     N +++AG  +  +     ++   +        NQ+R
Sbjct: 442 STHTARIKCRTDEDARKLYNSINNRLIAGSIIKASWENSNEIENVEKDISNNVENQIR 499

>AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH]
           (1446842..1447978) [1137 bp, 378 aa]
          Length = 378

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/320 (22%), Positives = 127/320 (39%), Gaps = 62/320 (19%)

Query: 31  ETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAK 90
           ET    LYVG+LD +++EA L   F   G +++++V  D   + +  YA+V +     A 
Sbjct: 31  ETSDRILYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYRQPRDAN 89

Query: 91  TAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNIL 150
            A + L+   I+  + +I W+ +   +      N+F+ +L+ D+D++ L  TF  F   +
Sbjct: 90  VAFQTLDGKQIENNVIKINWAFQSQQVSSDDTFNLFVGDLNVDVDDETLSSTFKEFPTFI 149

Query: 151 SSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV-------------- 195
            + V  D ++G+S+G+G+V F              G  LNG+ I V              
Sbjct: 150 QAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAKRESQHAARP 209

Query: 196 ---------------------GPHL--------------------SKKERESKFEEMKAN 214
                                GPHL                    + +  E+        
Sbjct: 210 RSNRGGFRGGSGHQPFRGMPQGPHLGGAAPAGPMQLQGPPVPSPVNPQAVEAMIRRAPQR 269

Query: 215 FTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVE 274
            T  YI NI     + +   L+  FG     +++     E KG  F+ +  H+ A  C+ 
Sbjct: 270 VTTAYIGNIPHFAQEPDLIPLLQNFG----FIIDFKHYAE-KGCCFIKYDTHDQAALCIV 324

Query: 275 ELNNTEFKGQPLYVNRAQKK 294
            L N  F+G+ L     ++K
Sbjct: 325 ALANFPFQGRTLRTGWGKEK 344

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 83/186 (44%), Gaps = 17/186 (9%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277
           +Y+ N++    +   ++     G   +V +      E   + FV +    DA    + L+
Sbjct: 37  LYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYRQPRDANVAFQTLD 96

Query: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEE 337
             + +   + +N A   ++ QQ             ++     NLF+ +L+  +DD+ L  
Sbjct: 97  GKQIENNVIKINWA---FQSQQ-------------VSSDDTFNLFVGDLNVDVDDETLSS 140

Query: 338 EFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
            F  + T   A VM   ++G+S+G+GFV F   EEA KA+  K    + G+ + V  A +
Sbjct: 141 TFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAK 200

Query: 397 KDVRRS 402
           ++ + +
Sbjct: 201 RESQHA 206

 Score = 32.3 bits (72), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 20/45 (44%)

Query: 77  GYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKG 121
           G  ++ ++ HD A   I  L   P +G+  R  W +  PS    G
Sbjct: 307 GCCFIKYDTHDQAALCIVALANFPFQGRTLRTGWGKEKPSFVPNG 351

>Scas_671.4
          Length = 443

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 86/167 (51%), Gaps = 3/167 (1%)

Query: 31  ETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAK 90
           ET    LYVG+LD S++E  L   F   G ++ +++  D     ++ YA++ +     A 
Sbjct: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDAN 137

Query: 91  TAIEKLNFTPIKGKLCRIMWS-QRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNI 149
            A++ LN   I+GK  RI W+ Q   +       N+F+ +L+ D+D++ L   F  F + 
Sbjct: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSY 197

Query: 150 LSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
           + + V  D +TG+S+G+G+V F            + GM +NG+ + +
Sbjct: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 83/182 (45%), Gaps = 16/182 (8%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277
           +Y+ N++    +   ++     G+   V +    +  N  + F+ ++   DA   ++ LN
Sbjct: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144

Query: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEE 337
             + +G+ + +N A   ++ QQ                    NLF+ +L+  +DD+ L  
Sbjct: 145 GIQIEGKTVRINWA---FQSQQTTNSD------------DTFNLFVGDLNVDVDDETLSH 189

Query: 338 EFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
            F  + +   A VM   + G+S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249

Query: 397 KD 398
           ++
Sbjct: 250 RE 251

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/171 (18%), Positives = 73/171 (42%), Gaps = 6/171 (3%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +++ NL   I+   L   F V G I   K+  D+   +  + ++ +            LN
Sbjct: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144

Query: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKF-GKTD 243
           G+ + G+ + +      ++  +  +       N+++ ++N +  D+       +F     
Sbjct: 145 GIQIEGKTVRINWAFQSQQTTNSDDTF-----NLFVGDLNVDVDDETLSHAFDQFPSYVQ 199

Query: 244 SVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK 294
           + V+     G ++G+GFV+F + E A + +  +      G+ + +N A K+
Sbjct: 200 AHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 6/100 (6%)

Query: 14  NLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITK 73
           N + Q  Q+ TN ++     + +L+VGDL+  V +  L   F    +     V  D  T 
Sbjct: 156 NWAFQ-SQQTTNSDD-----TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTG 209

Query: 74  TSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQR 113
            S GY +V+F D + A+ A+  +   PI G+  RI W+ +
Sbjct: 210 RSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 5/79 (6%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275
           T  YI NI    T+ +   L+  FG    +     PE   KG  F+ +  HE A  C+  
Sbjct: 325 TTAYIGNIPHFATEADLIPLLQNFGFI--LDFSHYPE---KGCCFIKYDTHEQAAVCIVA 379

Query: 276 LNNTEFKGQPLYVNRAQKK 294
           L N  F+G+ L     +++
Sbjct: 380 LANFPFQGRNLRTGWGKER 398

>KLLA0E08745g 782800..784227 some similarities with sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1 major
           polyadenylated RNA-binding protein of nucleus and
           cytoplasm, hypothetical start
          Length = 475

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 104/214 (48%), Gaps = 14/214 (6%)

Query: 2   ADITEKTAEQLENLSLQDKQEGTNEENQS-----------ETVSASLYVGDLDPSVSEAH 50
           A  +EK A Q  N   + +QE  +EE+ S           E     LYVG+L  S+ +  
Sbjct: 53  APASEKPASQDNNGDGEKQQEEGDEEDDSAAPVLATQGGREKSDKILYVGNLPKSIDDDL 112

Query: 51  LYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMW 110
           L   F   G++SS+++  D  ++    YA+V + +   A  A + LN   ++GK+ +I W
Sbjct: 113 LKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINW 171

Query: 111 SQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVH 169
           + +   +      N+F+ +L+ D+D+  L  TF  F + + + V  D ++G+S+G+G+V 
Sbjct: 172 AFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVS 231

Query: 170 FXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKE 203
           F              G  LNG+ + +    SK+E
Sbjct: 232 FGEQDQAQVAMETKQGFELNGRALRIN-WASKRE 264

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 86/191 (45%), Gaps = 17/191 (8%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277
           +Y+ N+     D   ++     G   SV +      +   + FV +    DA    + LN
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158

Query: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEE 337
             E +G+ L +N A   ++ QQ             +   +  NLF+ +L+  +DD  L  
Sbjct: 159 GKEVEGKVLKINWA---FQSQQ-------------VNSDETFNLFVGDLNVDVDDATLAG 202

Query: 338 EFAPYGTITSAKVM-TTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
            F  + +   A VM   ++G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262

Query: 397 KDVRRSQLAQQ 407
           ++ ++SQ  Q+
Sbjct: 263 REPQQSQQGQR 273

 Score = 36.2 bits (82), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 41/104 (39%), Gaps = 5/104 (4%)

Query: 191 QEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERT 250
           Q   V P +  +  E          T  YI NI     + +   L+  FG    +  +  
Sbjct: 334 QAPLVPPPVDPEAVEDMMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFI--IDFKHY 391

Query: 251 PEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK 294
           PE   KG  F+ +  HE A  C+  L N  F+G+ L     ++K
Sbjct: 392 PE---KGCCFIKYDTHEQAALCIVALTNFPFQGRNLRTGWGKEK 432

>CAGL0H10604g complement(1033488..1034738) similar to sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1, hypothetical
           start
          Length = 416

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 94/189 (49%), Gaps = 9/189 (4%)

Query: 31  ETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAK 90
           ET    LYVG+LD S++E  L   F   G + ++++  D +    + YA+V +     A 
Sbjct: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDAN 112

Query: 91  TAIEKLNFTPIKGKLCRIMWS-QRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNI 149
            A++ LN   ++ K  +I W+ +   +       N+F+ +L+ D+D++ L  TF  F   
Sbjct: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTF 172

Query: 150 LSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERESKF 208
           + + V  D +TG+S+G+G+V F            + G  L+G++I +    +K+ER    
Sbjct: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRIN-WATKRER---- 227

Query: 209 EEMKANFTN 217
             M  NF N
Sbjct: 228 -NMGNNFGN 235

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 86/182 (47%), Gaps = 16/182 (8%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277
           +Y+ N++   T+   ++     G   +V +    + E   + FV ++   DA   ++ LN
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119

Query: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEE 337
             + + + L +N A   +E QQ  +                 NLF+ +L+  +DD+ L  
Sbjct: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164

Query: 338 EFAPYGTITSAKVM-TTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
            F  + T   A VM   + G+S+G+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224

Query: 397 KD 398
           ++
Sbjct: 225 RE 226

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 4/119 (3%)

Query: 11  QLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDA 70
           QLEN +L+       ++      + +L+VGDL+  V +  L   F          V  D 
Sbjct: 122 QLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDM 181

Query: 71  ITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKN 129
            T  S GY +V+F++ + A+ A++ +    + G+  RI W+ +    R++  GN F  N
Sbjct: 182 QTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK----RERNMGNNFGNN 236

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/171 (19%), Positives = 72/171 (42%), Gaps = 6/171 (3%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +++ NL   I    L   F   G I + K+  D   +   + +V +            LN
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119

Query: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGK-TD 243
           G+ L  + + +      ++     +       N+++ ++N +  D+       +F     
Sbjct: 120 GVQLENKTLKINWAFETQQAAENDDTF-----NLFVGDLNVDVDDETLAGTFREFPTFIQ 174

Query: 244 SVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK 294
           + V+     G ++G+GFV+F N E+A K ++ +   +  G+ + +N A K+
Sbjct: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATKR 225

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275
           T  YI NI    T+ +   L+  FG     +L+ T   E KG  F+ +  HE A  C+  
Sbjct: 315 TTAYIGNIPHYATEADLIPLLQNFG----FILDFTHYPE-KGCCFIKYDTHEQAAVCIVA 369

Query: 276 LNNTEFKGQPLYVNRAQKK 294
           L N  F+G+ L     +++
Sbjct: 370 LANFPFQGRNLRTGWGKER 388

>Kwal_56.24709
          Length = 828

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 106/247 (42%), Gaps = 51/247 (20%)

Query: 91  TAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNIL 150
           +A+  L  +PI  K     WS    +      GN++++ +  D+    L   FS FG +L
Sbjct: 214 SAVAALRASPIVSK-----WSVSVNAHALTHPGNLYVRGIPKDLTIDDLVPVFSKFGPVL 268

Query: 151 SSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERES-KF 208
           S K+  D  +G S G+G++ +            LNG L+NG  +++  H+ +KERE   +
Sbjct: 269 SLKIICDSHSGDSLGYGFLSYPLGSQASRCIKELNGNLMNGSALFINYHVERKERERIHW 328

Query: 209 EEMKAN-----FTNVYIKNINTETTDKEF---EELVAKF--------------------- 239
           +  K +     F  V+I N+ T   D      E ++AKF                     
Sbjct: 329 DHFKEDNDDDRFKGVFIGNLPTNHPDGSLVTPEHVIAKFQDQLRSKGEQPVHIVSYYLPK 388

Query: 240 --GKTD-------------SVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQ 284
              ++D                + +  E   KG+GF+ FV+H+ A+  ++  NN E+ G 
Sbjct: 389 RNSESDIEYRDDDDKTDDIETCISKHEESPLKGYGFIKFVSHDQALTAIDLFNNFEWLGN 448

Query: 285 PLYVNRA 291
            L VN+A
Sbjct: 449 KLVVNKA 455

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (51%), Gaps = 22/99 (22%)

Query: 320 NLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTEN-------------------GKSKG 360
           NL++K+L  S  D+   + +  +G I SAK++T                      G SKG
Sbjct: 611 NLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGSSKG 670

Query: 361 FGFVCFSTPEEATKA--ITEKNQQIVAGKPLYVAIAQRK 397
           +GFVCF  P +A++A  IT++  Q+     LYV+ AQ++
Sbjct: 671 YGFVCFKNPLDASRAMMITDR-YQVDENHTLYVSFAQKR 708

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 63/120 (52%), Gaps = 5/120 (4%)

Query: 217 NVYIKNINTETTDKEFEELVAKFGKTDSV-VLERTPEGENKGFGFVNFVNHEDAVKCVEE 275
           N+Y++ I  + T  +   + +KFG   S+ ++  +  G++ G+GF+++     A +C++E
Sbjct: 242 NLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKE 301

Query: 276 LNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKL 335
           LN     G  L++N   ++ ER++     ++    +   +++G+  FI NL  +  D  L
Sbjct: 302 LNGNLMNGSALFINYHVERKERERIHWDHFKEDNDDD--RFKGV--FIGNLPTNHPDGSL 357

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 20/99 (20%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKT------------------DSVVLERTPE-GENK 256
           +N+Y+K++     D++F +    FG+                   D    +  P  G +K
Sbjct: 610 SNLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGSSK 669

Query: 257 GFGFVNFVNHEDAVKCVEELNNTEF-KGQPLYVNRAQKK 294
           G+GFV F N  DA + +   +  +  +   LYV+ AQK+
Sbjct: 670 GYGFVCFKNPLDASRAMMITDRYQVDENHTLYVSFAQKR 708

>ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH]
           complement(1238223..1239923) [1701 bp, 566 aa]
          Length = 566

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 139/322 (43%), Gaps = 65/322 (20%)

Query: 28  NQSETVSASLYVGDLDPSVSEAHLYDIFSPIG-AVSSIRVCRDAITKTSLGYAYVNFNDH 86
           N ++T S  LY+GDLDPS +E  +  I++ +G A   +++ +++    + GY +V F  +
Sbjct: 45  NGADTSSTQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSN 104

Query: 87  DAAKTAIEKLNFTPI---KGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTF 143
            AA  A+ K    PI     +  ++ W+    +   + +  IF+ +L P++    L++ F
Sbjct: 105 LAATNALLKTGL-PIPVDASRTLKLNWASFATTPGSEFS--IFVGDLAPNVTESQLFELF 161

Query: 144 -SVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSK 201
            S + + L++K+  D+ TG SKG+G+V F            + G+ LNG+ I V      
Sbjct: 162 ISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKN 221

Query: 202 KER-----------------------------------ESKF-----------EEMKANF 215
           K R                                   +S+F           +    N 
Sbjct: 222 KSRFQSGNPASAAPASPASTAVNSPGLAQGSNVQTLLQQSQFIYPVQQQPALSQFADPNN 281

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275
           T V+I  +++  T+ E       FG+   +V  + P G  KG GFV +V+   A   + +
Sbjct: 282 TTVFIGGLSSLVTEDELRAYFQPFGQ---IVYVKIPVG--KGCGFVQYVDRSSAENAIAK 336

Query: 276 LNNTEFKGQPLYVNRAQKKYER 297
           +     +G P+  +R +  + R
Sbjct: 337 M-----QGFPIGNSRVRLSWGR 353

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/189 (20%), Positives = 91/189 (48%), Gaps = 20/189 (10%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVV--LERTPEGENKGFGFVNFVNHEDAVKCV 273
           T +Y+ +++   T+ + +++ A  G+ +  V  ++ +  G N G+ FV F ++  A   +
Sbjct: 52  TQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNLAATNAL 111

Query: 274 EELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDK 333
            +       G P+ V+ ++        LK  + +      +++   ++F+ +L  ++ + 
Sbjct: 112 LK------TGLPIPVDASRT-------LKLNWASFATTPGSEF---SIFVGDLAPNVTES 155

Query: 334 KLEEEF-APYGTITSAKVMTTE-NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           +L E F + Y +  +AK++  +  G SKG+GFV F    E  +++ E     + G+ + V
Sbjct: 156 QLFELFISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRV 215

Query: 392 AIAQRKDVR 400
           +   +   R
Sbjct: 216 STTSKNKSR 224

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/294 (18%), Positives = 109/294 (37%), Gaps = 51/294 (17%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFG--NILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXX 182
           +++ +L P      +   ++  G  N+    +     G + G+ +V F            
Sbjct: 54  LYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNLAAT----- 108

Query: 183 LNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKE-FEELVAKFGK 241
            N +L  G  I V    + K   + F     +  ++++ ++    T+ + FE  ++++  
Sbjct: 109 -NALLKTGLPIPVDASRTLKLNWASFATTPGSEFSIFVGDLAPNVTESQLFELFISRYSS 167

Query: 242 T-DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYER--- 297
           T ++ ++     G +KG+GFV F N  +  + + E+      G+ + V+   K   R   
Sbjct: 168 TLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKNKSRFQS 227

Query: 298 --------------------------QQELKKQ----YEATRMEKMAKYQGIN---LFIK 324
                                      Q L +Q    Y   +   ++++   N   +FI 
Sbjct: 228 GNPASAAPASPASTAVNSPGLAQGSNVQTLLQQSQFIYPVQQQPALSQFADPNNTTVFIG 287

Query: 325 NLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITE 378
            L   + + +L   F P+G I   K+        KG GFV +     A  AI +
Sbjct: 288 GLSSLVTEDELRAYFQPFGQIVYVKIPV-----GKGCGFVQYVDRSSAENAIAK 336

>KLLA0C11495g complement(990832..992169) some similarities with
           sp|P27476 Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, hypothetical
           start
          Length = 445

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 85/173 (49%), Gaps = 14/173 (8%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
           A+++VG L  S+ +  L   F PIG V S RV  +  T  S GY YV+F D   A+ AI+
Sbjct: 196 ATIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIK 255

Query: 95  KLNFTPIKGKL--CRIMWSQ-----RDPSLRKKG------AGNIFIKNLHPDIDNKALYD 141
           +++   I G+   C +  S+     RD   +K G      +  +F+ NL  + D   LY+
Sbjct: 256 EMHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYE 315

Query: 142 TFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEI 193
            F  +G I+S ++ T  ET + KGFGYV +            L G  +N + +
Sbjct: 316 IFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRPV 368

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 83/175 (47%), Gaps = 19/175 (10%)

Query: 222 NINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEF 281
           +I+ E    EFE +      +  V+ ER  +  ++G+G+V+F +   A K ++E++  E 
Sbjct: 206 SIDDEWLKTEFEPIGGVI--SARVMYERGTD-RSRGYGYVDFEDKSYAEKAIKEMHGKEI 262

Query: 282 KGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGI------NLFIKNLDDSIDDKKL 335
            G+P+  + +           K   A R ++  K+  +       LF+ NL    D   L
Sbjct: 263 DGRPINCDMS---------TSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNL 313

Query: 336 EEEFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
            E F  YG I S ++ T  E  + KGFG+V + + E+ATKA      + +  +P+
Sbjct: 314 YEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRPV 368

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 3/79 (3%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENG--KSKGFGFVCFSTPEEATKAITE 378
           +F+  L  SIDD+ L+ EF P G + SA+VM  E G  +S+G+G+V F     A KAI E
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVM-YERGTDRSRGYGYVDFEDKSYAEKAIKE 256

Query: 379 KNQQIVAGKPLYVAIAQRK 397
            + + + G+P+   ++  K
Sbjct: 257 MHGKEIDGRPINCDMSTSK 275

>YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylated
           RNA-binding protein of nucleus and cytoplasm, contains
           three RNA recognition (RRM) domains and three
           Gln/Asn-rich regions [1362 bp, 453 aa]
          Length = 453

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 86/166 (51%), Gaps = 2/166 (1%)

Query: 31  ETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAK 90
           ET    LYVG+LD +++E  L   F   G +++I++  D   K ++ YA+V ++    A 
Sbjct: 71  ETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNK-NVNYAFVEYHQSHDAN 129

Query: 91  TAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNIL 150
            A++ LN   I+  + +I W+ +          N+F+ +L+ ++D++ L + F  F + L
Sbjct: 130 IALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYL 189

Query: 151 SSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
           S  V  D +TG S+G+G+V F            + G  LNG+ + +
Sbjct: 190 SGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRI 235

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 84/182 (46%), Gaps = 17/182 (9%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277
           +Y+ N++   T+   ++     G   ++ +      +N  + FV +    DA   ++ LN
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLN 136

Query: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEE 337
             + +   + +N A   ++ QQ              +     NLF+ +L+ ++DD+ L  
Sbjct: 137 GKQIENNIVKINWA---FQSQQS-------------SSDDTFNLFVGDLNVNVDDETLRN 180

Query: 338 EFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
            F  + +  S  VM   + G S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 181 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAK 240

Query: 397 KD 398
           +D
Sbjct: 241 RD 242

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 72/171 (42%), Gaps = 7/171 (4%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +++ NL   I    L   F V G I + K+  D+  K+  + +V +            LN
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLN 136

Query: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDS 244
           G  +    + +      ++  S       +  N+++ ++N    D+        F    S
Sbjct: 137 GKQIENNIVKINWAFQSQQSSSD------DTFNLFVGDLNVNVDDETLRNAFKDFPSYLS 190

Query: 245 -VVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK 294
             V+     G ++G+GFV+F + +DA   ++ +   +  G+PL +N A K+
Sbjct: 191 GHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKR 241

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query: 14  NLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITK 73
           N + Q +Q  +++       + +L+VGDL+ +V +  L + F    +  S  V  D  T 
Sbjct: 148 NWAFQSQQSSSDD-------TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTG 200

Query: 74  TSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQR 113
           +S GY +V+F   D A+ A++ +    + G+  RI W+ +
Sbjct: 201 SSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAK 240

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 42/102 (41%), Gaps = 5/102 (4%)

Query: 193 IYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE 252
           I + P ++ +  +          T  YI NI    T+ +   L   FG    +  +  PE
Sbjct: 318 IGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFI--LDFKHYPE 375

Query: 253 GENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK 294
              KG  F+ +  HE A  C+  L N  F+G+ L     +++
Sbjct: 376 ---KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 414

>Kwal_27.11447
          Length = 439

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 91/175 (52%), Gaps = 3/175 (1%)

Query: 31  ETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAK 90
           ET    LYVG+LD +V+E  L   F   GA++++++  D   K +  YA+V F+    A 
Sbjct: 58  ETSDRILYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEA-NYAFVEFHQPHDAS 116

Query: 91  TAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNIL 150
            A + L+   I+  + +I ++ +   +  +   N+F+ +L+ D+D++ L +TF      +
Sbjct: 117 VAFQTLDGKQIENHVIKINYAFQSQQVSSEDTFNLFVGDLNVDVDDETLANTFKHVPTFI 176

Query: 151 SSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKER 204
            + V  D +TG+S+G+G+V F              G ++NG+ I +    SK+E 
Sbjct: 177 QAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRIN-WASKREH 230

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 81/182 (44%), Gaps = 17/182 (9%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277
           +Y+ N++   T+   ++     G   +V +      +   + FV F    DA    + L+
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEANYAFVEFHQPHDASVAFQTLD 123

Query: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEE 337
             + +   + +N A   ++ QQ             ++     NLF+ +L+  +DD+ L  
Sbjct: 124 GKQIENHVIKINYA---FQSQQ-------------VSSEDTFNLFVGDLNVDVDDETLAN 167

Query: 338 EFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
            F    T   A VM   + G+S+G+GFV F    +A KA+ EK   +V G+ + +  A +
Sbjct: 168 TFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRINWASK 227

Query: 397 KD 398
           ++
Sbjct: 228 RE 229

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 4/89 (4%)

Query: 29  QSETVSA----SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFN 84
           QS+ VS+    +L+VGDL+  V +  L + F  +       V  D  T  S GY +V+F 
Sbjct: 139 QSQQVSSEDTFNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFG 198

Query: 85  DHDAAKTAIEKLNFTPIKGKLCRIMWSQR 113
           +   A+ A+E+   T + G+  RI W+ +
Sbjct: 199 EQVQAQKAMEEKQGTVVNGRAIRINWASK 227

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 5/116 (4%)

Query: 197 PHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENK 256
           P +  +  E+      +  T VYI NI    ++++   L+  FG    V  +  P+   +
Sbjct: 305 PQVPPQAIEAMIRSAPSRVTTVYIGNIPHFASEQDLIPLLQNFGFI--VDFKHYPD---R 359

Query: 257 GFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEK 312
           G  F+ +  HE A  C+  L N  F+G+ L     ++K     + K    A +ME+
Sbjct: 360 GCCFIKYGTHEQAAICILTLGNFPFQGRNLRTGWGKEKPTYVPQPKLDQSALQMEQ 415

>CAGL0E03245g complement(299236..300513) similar to sp|P27476
           Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, start by
           similarity
          Length = 425

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 94/189 (49%), Gaps = 14/189 (7%)

Query: 19  DKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGY 78
           +++E + ++ +++   A+++VG L  S+ +  L   F  IG V + RV  +  T  S GY
Sbjct: 160 EEEESSPKKAKTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGY 219

Query: 79  AYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSL-----RKKGAGNI-------- 125
            YV+F D   A+ A+++++   I G+   +  S   P++     R+K  G+I        
Sbjct: 220 GYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTL 279

Query: 126 FIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           F+ NL  + D   +Y+ F  FG I+S ++ T  ET + KGFGYV +            L 
Sbjct: 280 FLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQ 339

Query: 185 GMLLNGQEI 193
           G  ++ + +
Sbjct: 340 GEYIDNRPV 348

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 90/180 (50%), Gaps = 9/180 (5%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXX 182
            +F+  L   ID++ L   F   G +++++V  +  T +S+G+GYV F            
Sbjct: 177 TVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKE 236

Query: 183 LNGMLLNGQEIYVGPHLSK------KERESKFEEMKANFTN-VYIKNINTETTDKEFEEL 235
           ++G  ++G+ I V    SK      ++R+ +F ++ +  ++ +++ N++         E+
Sbjct: 237 MHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRDNIYEI 296

Query: 236 VAKFGKTDSVVLERTPEGEN-KGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK 294
             KFG+  SV +   PE E  KGFG+V + + +DA K +E L       +P+ ++ +  K
Sbjct: 297 FGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRPVRLDYSTPK 356

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 83/169 (49%), Gaps = 7/169 (4%)

Query: 222 NINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEF 281
           +I+ E   +EFE +         V+ ER  +  ++G+G+V+F +   A K V+E++  E 
Sbjct: 186 SIDDEWLKQEFEHIGGVVAA--RVMYERGTD-RSRGYGYVDFEDKSYAEKAVKEMHGKEI 242

Query: 282 KGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAP 341
            G+P+ V+ +  K        +Q    R   +       LF+ NL  + D   + E F  
Sbjct: 243 DGRPINVDMSTSKPTVNPREDRQ---KRFGDIPSEPSDTLFLGNLSFNADRDNIYEIFGK 299

Query: 342 YGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
           +G I S ++ T  E  + KGFG+V +++ ++A KA+     + +  +P+
Sbjct: 300 FGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRPV 348

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 52/90 (57%), Gaps = 5/90 (5%)

Query: 312 KMAKYQG--INLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENG--KSKGFGFVCFS 367
           K AK  G    +F+  L  SIDD+ L++EF   G + +A+VM  E G  +S+G+G+V F 
Sbjct: 167 KKAKTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMY-ERGTDRSRGYGYVDFE 225

Query: 368 TPEEATKAITEKNQQIVAGKPLYVAIAQRK 397
               A KA+ E + + + G+P+ V ++  K
Sbjct: 226 DKSYAEKAVKEMHGKEIDGRPINVDMSTSK 255

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           S +L++G+L  +    ++Y+IF   G + S+R+     T+   G+ YV +   D AK A+
Sbjct: 276 SDTLFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKAL 335

Query: 94  EKLNFTPIKGKLCRIMWSQRDP 115
           E L    I  +  R+ +S   P
Sbjct: 336 EALQGEYIDNRPVRLDYSTPKP 357

>AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH]
           complement(628898..630088) [1191 bp, 396 aa]
          Length = 396

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 97/204 (47%), Gaps = 14/204 (6%)

Query: 6   EKTAEQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIR 65
           E + E+ +  S + + +   ++ +++   A+++VG L  SV +  L   F  IG V   R
Sbjct: 138 EGSKEESKKRSAESEDDAVAKKQKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGAR 197

Query: 66  VCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSL-----RKK 120
           V  +  T  S GY YV+F D   A+ A+++++   I G+      S   P+      R K
Sbjct: 198 VIYERGTDKSRGYGYVDFEDVSYAEKAVKEMHGKEIDGRAINCDMSTSKPASAPREDRAK 257

Query: 121 GAGN--------IFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFX 171
             G+        +F+ NL  + D  AL++ FS  GN++S ++ T  E+ + KGFGYV + 
Sbjct: 258 KYGDTPSQPSDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYG 317

Query: 172 XXXXXXXXXXXLNGMLLNGQEIYV 195
                      L G  ++ + + +
Sbjct: 318 SVEEAQAALDALQGEYIDNRPVRI 341

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 82/174 (47%), Gaps = 9/174 (5%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXL 183
           IF+  L   +D++ L   F   G ++ ++V  +  T KS+G+GYV F            +
Sbjct: 169 IFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDVSYAEKAVKEM 228

Query: 184 NGMLLNGQEIYVGPHLSK------KERESKFEEMKANFTN-VYIKNINTETTDKEFEELV 236
           +G  ++G+ I      SK      ++R  K+ +  +  ++ +++ N++         EL 
Sbjct: 229 HGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDALFELF 288

Query: 237 AKFGKTDSVVLERTPEG-ENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVN 289
           +K G   SV +   PE  + KGFG+V + + E+A   ++ L       +P+ ++
Sbjct: 289 SKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVRID 342

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 85/177 (48%), Gaps = 19/177 (10%)

Query: 222 NINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEF 281
           +++ E    EF+ +    G    V+ ER  + +++G+G+V+F +   A K V+E++  E 
Sbjct: 177 SVDDEWLKTEFDHIGGVVGA--RVIYERGTD-KSRGYGYVDFEDVSYAEKAVKEMHGKEI 233

Query: 282 KGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGI------NLFIKNLDDSIDDKKL 335
            G+ +  + +           K   A R ++  KY          LF+ NL  + D   L
Sbjct: 234 DGRAINCDMS---------TSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDAL 284

Query: 336 EEEFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
            E F+ +G + S ++ T  E+ + KGFG+V + + EEA  A+     + +  +P+ +
Sbjct: 285 FELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVRI 341

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 57/111 (51%), Gaps = 3/111 (2%)

Query: 289 NRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSA 348
           N   K+  +++  + + +A   ++    Q   +F+  L  S+DD+ L+ EF   G +  A
Sbjct: 137 NEGSKEESKKRSAESEDDAVAKKQKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGA 196

Query: 349 KVMTTENG--KSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397
           +V+  E G  KS+G+G+V F     A KA+ E + + + G+ +   ++  K
Sbjct: 197 RVI-YERGTDKSRGYGYVDFEDVSYAEKAVKEMHGKEIDGRAINCDMSTSK 246

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           S +L++G+L  +     L+++FS  G V S+R+     +    G+ YV +   + A+ A+
Sbjct: 267 SDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAAL 326

Query: 94  EKLNFTPIKGKLCRIMWSQRDP 115
           + L    I  +  RI +S   P
Sbjct: 327 DALQGEYIDNRPVRIDFSSPRP 348

>Kwal_55.20154
          Length = 522

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 82/352 (23%), Positives = 150/352 (42%), Gaps = 75/352 (21%)

Query: 17  LQDKQEGTNEEN----QSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVS-SIRVCRDAI 71
           L     GT  ++       T S SLY+GDLDP+  EA +  +++ +G  +  I++ R + 
Sbjct: 23  LHTSMSGTRSQSPASEHHSTRSNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSG 82

Query: 72  TK-TSLGYAYVNFNDHDAAKTAIEKLNFT-PIKG-KLCRIMWSQRDPSLRKKGAGN---I 125
           +   + GY +V F  H  A  A+ K     P  G ++ ++ W+    +      GN   +
Sbjct: 83  SPGHNSGYCFVEFPSHTNASNALLKNGLVIPNTGNRILKLNWASFATT-----PGNEYSV 137

Query: 126 FIKNLHPDIDNKALYDTF-SVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXL 183
           F+ ++ P++    L++ F S + + L++K+  D+ TG SKG+G+V F            +
Sbjct: 138 FVGDVAPNVTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEM 197

Query: 184 NGMLLNGQEIYV--------------------------------GPHLSKKERESKF--- 208
            G+ LNG+ I V                                 P  +  + +S+F   
Sbjct: 198 QGVFLNGRAIRVSTTSKNRPKFQQVQPPLQQQQHQQHAFAKHSHAPQFNAVQPQSQFIYP 257

Query: 209 --------EEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGF 260
                   +    N T V+I  +++  T+ E       FG   S+V  + P G  KG GF
Sbjct: 258 VQQQPTLTQYTDPNNTTVFIGGLSSLVTEDELRAFFQPFG---SIVYVKIPVG--KGCGF 312

Query: 261 VNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQE----LKKQYEAT 308
           V +V+   A   + ++     +G P+  +R +  + R  +    ++K Y +T
Sbjct: 313 VQYVDRLSAETAIAKM-----QGFPIGNSRIRLSWGRSAKQAAVMQKVYAST 359

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/296 (18%), Positives = 114/296 (38%), Gaps = 51/296 (17%)

Query: 122 AGNIFIKNLHPDIDNKALYDTFSVFG--NILSSKV-ATDETGKSKGFGYVHFXXXXXXXX 178
           + ++++ +L P+ D  A+   ++  G  N+    + ++   G + G+ +V F        
Sbjct: 44  SNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYCFVEFPSHTNAS- 102

Query: 179 XXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKE-FEELVA 237
                N +L NG  I    +   K   + F     N  +V++ ++    T+ + FE  ++
Sbjct: 103 -----NALLKNGLVIPNTGNRILKLNWASFATTPGNEYSVFVGDVAPNVTEAQLFELFIS 157

Query: 238 KFGKT--DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKY 295
           ++  T    +V ++   G +KG+GFV F    +  + + E+      G+ + V+   K  
Sbjct: 158 RYASTLNAKIVFDQM-TGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRAIRVSTTSKNR 216

Query: 296 ER------------------------------QQELKKQYEATRMEKMAKYQGIN---LF 322
            +                              Q + +  Y   +   + +Y   N   +F
Sbjct: 217 PKFQQVQPPLQQQQHQQHAFAKHSHAPQFNAVQPQSQFIYPVQQQPTLTQYTDPNNTTVF 276

Query: 323 IKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITE 378
           I  L   + + +L   F P+G+I   K+        KG GFV +     A  AI +
Sbjct: 277 IGGLSSLVTEDELRAFFQPFGSIVYVKIPV-----GKGCGFVQYVDRLSAETAIAK 327

 Score = 36.6 bits (83), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 40/204 (19%), Positives = 88/204 (43%), Gaps = 22/204 (10%)

Query: 199 LSKKERESKFEEMKANFTN-VYIKNINTETTDKEFEELVAKFGKTD---SVVLERTPEGE 254
           +S    +S   E  +  +N +Y+ +++    +     + A  G+ +    ++      G 
Sbjct: 27  MSGTRSQSPASEHHSTRSNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGH 86

Query: 255 NKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMA 314
           N G+ FV F +H +A       +N   K   +  N   +       LK  + +       
Sbjct: 87  NSGYCFVEFPSHTNA-------SNALLKNGLVIPNTGNRI------LKLNWASFATTPGN 133

Query: 315 KYQGINLFIKNLDDSIDDKKLEEEF-APYGTITSAKVMTTE-NGKSKGFGFVCFSTPEEA 372
           +Y   ++F+ ++  ++ + +L E F + Y +  +AK++  +  G SKG+GFV F    E 
Sbjct: 134 EY---SVFVGDVAPNVTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQ 190

Query: 373 TKAITEKNQQIVAGKPLYVAIAQR 396
            +++ E     + G+ + V+   +
Sbjct: 191 QRSLLEMQGVFLNGRAIRVSTTSK 214

>ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH]
           complement(408687..410267) [1581 bp, 526 aa]
          Length = 526

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 79/135 (58%), Gaps = 5/135 (3%)

Query: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           +++G L+   +E +L + FS  G V+ +++ RD  T  S G+ +++F D  +    ++  
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 97  NFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVAT 156
           +   + GK+  I   + DP+ R + AG IF+  + PD+  K   + FS +G+I+ +++  
Sbjct: 225 HI--LDGKV--IDPKESDPTGRARKAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDAQLML 280

Query: 157 D-ETGKSKGFGYVHF 170
           D +TG+S+GFG++ +
Sbjct: 281 DKDTGRSRGFGFITY 295

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 82/174 (47%), Gaps = 26/174 (14%)

Query: 210 EMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSV-VLERTPEGENKGFGFVNFVNHED 268
           ++  +   ++I  +N ETT+    E  +K+G    V ++     G ++GFGF++F +   
Sbjct: 157 DLSRDINKMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFAD--- 213

Query: 269 AVKCVEELNNTE--FKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNL 326
               V+E+  T+    G+ +             + K+     R  K  K     +F+  +
Sbjct: 214 -ASSVDEVVKTQHILDGKVI-------------DPKESDPTGRARKAGK-----IFVAGI 254

Query: 327 DDSIDDKKLEEEFAPYGTITSAKVMTTEN-GKSKGFGFVCFSTPEEATKAITEK 379
              +  K+ EE F+ +G+I  A++M  ++ G+S+GFGF+ + +P+   +    K
Sbjct: 255 GPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDSPDAVDRVCQNK 308

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTT-ENGKSKGFGFVCFSTPEEATKAITEK 379
           +FI  L+    +  L E F+ YG +T  K+M     G+S+GFGF+ F+      + +  K
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVV--K 222

Query: 380 NQQIVAGK 387
            Q I+ GK
Sbjct: 223 TQHILDGK 230

>Scas_621.10
          Length = 415

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 85/178 (47%), Gaps = 13/178 (7%)

Query: 29  QSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDA 88
           ++E   A+++VG L  S+ +  L   F  IG V S RV  +  T  S GY YV+F D   
Sbjct: 156 KTEGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSY 215

Query: 89  AKTAIEKLNFTPIKGKLCRIMWSQRDPSL----RKKGAGNI--------FIKNLHPDIDN 136
           A+ AI+++    I G+   +  S   P+     R K  G++        F+ NL  + D 
Sbjct: 216 AEKAIKEMQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADR 275

Query: 137 KALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEI 193
            A+ + FS +G I+S ++ T  ET + KGFGYV +            L G  ++ + +
Sbjct: 276 DAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPV 333

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 85/173 (49%), Gaps = 8/173 (4%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXL 183
           IF+  L   ID++ L   F   G ++S++V  +  T +S+G+GYV F            +
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 184 NGMLLNGQEIYVG-----PHLSKKERESKFEEMKANFT-NVYIKNINTETTDKEFEELVA 237
            G  ++G+EI V      P     +R  KF ++ +  +  +++ N++         EL +
Sbjct: 224 QGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELFS 283

Query: 238 KFGKTDSVVLERTPEGEN-KGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVN 289
           K+G+  SV +   PE E  KGFG+V + N EDA K +E L       +P+ ++
Sbjct: 284 KYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPVRLD 336

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 82/169 (48%), Gaps = 8/169 (4%)

Query: 222 NINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEF 281
           +I+ E   KEFE +      +  V++ER  +  ++G+G+V+F +   A K ++E+   E 
Sbjct: 172 SIDDEWLKKEFEHIGGVV--SARVIMERGTD-RSRGYGYVDFEDKSYAEKAIKEMQGKEI 228

Query: 282 KGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAP 341
            G+ + V+ +  K            A +   +       LF+ NL  + D   + E F+ 
Sbjct: 229 DGREINVDMSTSK----PAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELFSK 284

Query: 342 YGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
           YG I S ++ T  E  + KGFG+V ++  E+A KA+     + +  +P+
Sbjct: 285 YGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPV 333

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKV-MTTENGKSKGFGFVCFSTPEEATKAITEK 379
           +F+  L  SIDD+ L++EF   G + SA+V M     +S+G+G+V F     A KAI E 
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 380 NQQIVAGKPLYVAIAQRK 397
             + + G+ + V ++  K
Sbjct: 224 QGKEIDGREINVDMSTSK 241

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 42/82 (51%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           S +L++G+L  +     + ++FS  G + S+R+     T+   G+ YV + + + AK A+
Sbjct: 261 SETLFLGNLSFNADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKAL 320

Query: 94  EKLNFTPIKGKLCRIMWSQRDP 115
           E L    I  +  R+ +S   P
Sbjct: 321 EGLQGEYIDNRPVRLDYSTPRP 342

>Scas_645.14
          Length = 717

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 97/221 (43%), Gaps = 35/221 (15%)

Query: 106 CRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSK-- 163
           C   WS           GNIFI  ++  ID   +   F  FG+ILS K+  D    S   
Sbjct: 164 CIEKWSISINKHALTHPGNIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTN 223

Query: 164 --------GFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERES-KFEEMKAN 214
                   G+G++ F             NG ++ G ++++  H+ +KERE  ++  +K N
Sbjct: 224 NSTSSNPIGYGFISFVLGSQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKEN 283

Query: 215 -----FTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERT-------PEGEN------- 255
                F  ++I N+ T  TD   + ++ K     S VL          P+ +N       
Sbjct: 284 NDDEKFKCIFIGNLPTTLTDLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINN 343

Query: 256 -----KGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRA 291
                KG+GFVN  +HE A+K ++ L+  E+KG  L VN+A
Sbjct: 344 KSSPLKGYGFVNLGSHEQALKVIQTLDGLEWKGNRLVVNKA 384

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 77/189 (40%), Gaps = 33/189 (17%)

Query: 217 NVYIKNINTETTDKEFEELVAKFGKTDSVVL--ERTPEGENK--------GFGFVNFVNH 266
           N++I  IN +  + +   L  KFG   S+ L  +R               G+GF++FV  
Sbjct: 182 NIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLG 241

Query: 267 EDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNL 326
             A +C+ E N    +G  L++N   ++ ER++      +    ++  K     +FI NL
Sbjct: 242 SQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFKC----IFIGNL 297

Query: 327 DDSIDDKKLE----------EEFAPYGTITS---------AKVMTTENGKSKGFGFVCFS 367
             ++ D  ++           E  P   I S            +  ++   KG+GFV   
Sbjct: 298 PTTLTDLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGFVNLG 357

Query: 368 TPEEATKAI 376
           + E+A K I
Sbjct: 358 SHEQALKVI 366

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 54/131 (41%), Gaps = 50/131 (38%)

Query: 317 QGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTT----------ENGK--------- 357
           Q  NL++K++  S  D +L + F+ +G I S+KV+T           EN K         
Sbjct: 522 QESNLYVKHIPLSWRDDELNDFFSQFGDIISSKVITVGGSKKLDNQNENDKENQEEQEQE 581

Query: 358 ------------------------------SKGFGFVCFSTPEEATKAITEKNQQIVA-G 386
                                         S+G+GFVCF  P +A++AI   +  I++  
Sbjct: 582 HNDKNDQEVEEGGEEEEEEEDEDENLPVGFSRGYGFVCFENPLDASRAIMATDGVIISPN 641

Query: 387 KPLYVAIAQRK 397
             L V+ AQ++
Sbjct: 642 NILNVSFAQKR 652

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 123 GNIFIKNLHPDIDNKALYDTFSVFGNILSSKVAT 156
            N+++K++     +  L D FS FG+I+SSKV T
Sbjct: 524 SNLYVKHIPLSWRDDELNDFFSQFGDIISSKVIT 557

>AEL217W [2289] [Homologous to ScYGR250C - SH]
           complement(225217..227721) [2505 bp, 834 aa]
          Length = 834

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 96/216 (44%), Gaps = 47/216 (21%)

Query: 123 GNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXX 181
           GN++I+ +  D+    L   FS FG +LS K+  D  T +S G+G++ +           
Sbjct: 217 GNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIK 276

Query: 182 XLNGMLLNGQEIYVGPHLSKKERES-KFEEMKAN-----FTNVYIKNINTETTDKEF--- 232
            LNG L+NG  +++  H+ +KERE    + +K +     F  V++ N+ TE  D      
Sbjct: 277 ELNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLITP 336

Query: 233 EELVAKFGKT-DSVVL-------------------------------ERTPEGEN----- 255
           E++  KF    D V +                                 T + +N     
Sbjct: 337 EQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDSQNEDSPL 396

Query: 256 KGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRA 291
           KG+GF+ F  H+ A+K +++LN+  + G  L VN+A
Sbjct: 397 KGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVVNKA 432

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 53/98 (54%), Gaps = 17/98 (17%)

Query: 317 QGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTEN----------------GKSKG 360
           Q  NL++K++  S  D+ L + ++ YG I SAK++T                   G S+G
Sbjct: 597 QESNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRG 656

Query: 361 FGFVCFSTPEEATKAITEKNQ-QIVAGKPLYVAIAQRK 397
           +GFVCF  P +A++A+   ++ Q+     LYV+ AQ++
Sbjct: 657 YGFVCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 94/220 (42%), Gaps = 53/220 (24%)

Query: 217 NVYIKNINTETTDKEFEELVAKFGKTDSV-VLERTPEGENKGFGFVNFVNHEDAVKCVEE 275
           N+YI+ I  + +  +   + +KFG   S+ ++      E+ G+GF+++     A +C++E
Sbjct: 218 NLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKE 277

Query: 276 LNNTEFKGQPLYVNRAQKKYERQQ----ELKKQYEATRMEKMAKYQGINLFIKNLDDSID 331
           LN     G PL++N   ++ ER++     LK+  +  R      ++G+  F+ NL    +
Sbjct: 278 LNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDER------FRGV--FVGNLPTEYE 329

Query: 332 DKKL---EEEFAPYGTIT-----------------------------------SAKVMTT 353
           D  L   E+ F  +  I                                    +A+   +
Sbjct: 330 DGTLITPEQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDS 389

Query: 354 ENGKS--KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           +N  S  KG+GF+ FST + A KAI + N     G  L V
Sbjct: 390 QNEDSPLKGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVV 429

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 55/102 (53%), Gaps = 6/102 (5%)

Query: 320 NLFIKNL--DDSIDDKKLEEEFAPYGTITSAKVMTTENGK-SKGFGFVCFSTPEEATKAI 376
           NL+I+ +  D S+DD  L   F+ +GT+ S K++   N + S G+GF+ +    +A + I
Sbjct: 218 NLYIRGIPKDLSVDD--LIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCI 275

Query: 377 TEKNQQIVAGKPLYVAI-AQRKDVRRSQLAQQIQARNQMRFQ 417
            E N  ++ G PL++    +RK+  R  L    +  +  RF+
Sbjct: 276 KELNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFR 317

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 62/139 (44%), Gaps = 9/139 (6%)

Query: 13  ENLSLQDKQEG--TNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDA 70
           ENL   D  E    ++   + T   +LY+  +   +S   L  IFS  G V S+++  D 
Sbjct: 193 ENLEKSDHVEAWSISQNPHALTHPGNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDG 252

Query: 71  ITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNL 130
            T+ SLGY ++++     A   I++LN   + G    I +      + +K    I + +L
Sbjct: 253 NTRESLGYGFISYPLGSQAARCIKELNGNLMNGSPLFINY-----HVERKERERIHLDHL 307

Query: 131 HPDIDNKALYDTFSVFGNI 149
             D D++     F   GN+
Sbjct: 308 KEDNDDERFRGVF--VGNL 324

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 17/96 (17%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKT----------------DSVVLERTPEGENKGFG 259
           +N+Y+K+I     D++  +  +++G+                 +S  LE  P G ++G+G
Sbjct: 599 SNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRGYG 658

Query: 260 FVNFVNHEDAVKCVEELNNTEF-KGQPLYVNRAQKK 294
           FV F N  DA + +   +  +      LYV+ AQK+
Sbjct: 659 FVCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

>Scas_637.2
          Length = 377

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 125/308 (40%), Gaps = 31/308 (10%)

Query: 117 LRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXX 176
           + K     IFI NL  D   + L D FS  G +++++V +   G+SKG G V F      
Sbjct: 72  VEKHHENGIFIGNLSFDATEEDLRDFFSQVGEVVNAEVMS-YRGRSKGMGTVEFTNPADA 130

Query: 177 XXXXXXLNGMLLNGQEIYVG----PHLSKKERESKFEEMKANFTNVYIKNINTETTDKEF 232
                  NG+   G++I+V     P  S++E +S   E        ++ N+    T +  
Sbjct: 131 EEAIRQYNGVPFMGRDIFVKQDQPPPGSRQEFKSS--EPTQQGYEAFVVNLPYSITWQNL 188

Query: 233 EELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQ 292
           +++  + G      +E    G ++GFG V + N ED  K ++  N  E +G+ L V   +
Sbjct: 189 KDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEVREGK 248

Query: 293 KKY----------------------ERQQELKKQYEATRMEKMAKYQGIN--LFIKNLDD 328
             +                      E +  L   +  +  E ++     N  ++  NL  
Sbjct: 249 FNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSFTEGVSGDGERNNTVYCNNLPL 308

Query: 329 SIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 388
           S     L + F   G I  A+++  E G S G   V +++ + A   I + N     G+ 
Sbjct: 309 STTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCINKLNGYNYGGRD 368

Query: 389 LYVAIAQR 396
           L++  A R
Sbjct: 369 LHITYASR 376

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 91/187 (48%), Gaps = 11/187 (5%)

Query: 205 ESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFV 264
           ES  E+   N   ++I N++ + T+++  +  ++ G+  +  +  +  G +KG G V F 
Sbjct: 69  ESGVEKHHEN--GIFIGNLSFDATEEDLRDFFSQVGEVVNAEV-MSYRGRSKGMGTVEFT 125

Query: 265 NHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIK 324
           N  DA + + + N   F G+ ++V + Q     +QE K   E T+       QG   F+ 
Sbjct: 126 NPADAEEAIRQYNGVPFMGRDIFVKQDQPPPGSRQEFKSS-EPTQ-------QGYEAFVV 177

Query: 325 NLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIV 384
           NL  SI  + L++ F   G +  A V    NG S+GFG V ++  E+  KAI   N   +
Sbjct: 178 NLPYSITWQNLKDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAEL 237

Query: 385 AGKPLYV 391
            G+ L V
Sbjct: 238 EGRILEV 244

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 110/307 (35%), Gaps = 60/307 (19%)

Query: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           +++G+L    +E  L D FS +G V +  V   +    S G   V F +   A+ AI + 
Sbjct: 80  IFIGNLSFDATEEDLRDFFSQVGEVVNAEVM--SYRGRSKGMGTVEFTNPADAEEAIRQY 137

Query: 97  NFTPIKGKLCRIMWSQRDPSLRKKGAGN--------IFIKNLHPDIDNKALYDTFSVFGN 148
           N  P  G+   +   Q  P  R++   +         F+ NL   I  + L D F   G+
Sbjct: 138 NGVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLKDIFRECGD 197

Query: 149 ILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERESKF 208
           ++ + V  D  G S+GFG V +             NG  L G+ + V        RE KF
Sbjct: 198 VIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEV--------REGKF 249

Query: 209 EE-------------------------------MKANFT-----------NVYIKNINTE 226
                                               +FT            VY  N+   
Sbjct: 250 NHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSFTEGVSGDGERNNTVYCNNLPLS 309

Query: 227 TTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPL 286
           TT  +  +L    G+     L     G + G   V + + + A  C+ +LN   + G+ L
Sbjct: 310 TTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCINKLNGYNYGGRDL 369

Query: 287 YVNRAQK 293
           ++  A +
Sbjct: 370 HITYASR 376

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 44/100 (44%), Gaps = 7/100 (7%)

Query: 14  NLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITK 73
           N S  +   G  E N +      +Y  +L  S +   LYD+F  +G ++   +  D  T 
Sbjct: 284 NPSFTEGVSGDGERNNT------VYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDE-TG 336

Query: 74  TSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQR 113
           TS G A V +   DAA   I KLN     G+   I ++ R
Sbjct: 337 TSTGAAVVEYASQDAADVCINKLNGYNYGGRDLHITYASR 376

>YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein
           involved in mRNA export, binds poly(A)+ RNA and
           single-stranded G-strand telomere sequence, has three
           RNA recognition (RRM) domains [1284 bp, 427 aa]
          Length = 427

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 98/198 (49%), Gaps = 8/198 (4%)

Query: 195 VGPHLSKKERESKFEEMKANFTN-VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEG 253
           +GP + +++ E +F+  K NF N ++++N+  + T ++ +EL    G+     +  T +G
Sbjct: 101 LGP-IVERDLERQFDATKRNFENSIFVRNLTFDCTPEDLKELFGTVGEVVEADI-ITSKG 158

Query: 254 ENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKM 313
            ++G G V F  +E     + + +   F  + L V +     E  +E  K+  ATR E  
Sbjct: 159 HHRGMGTVEFTKNESVQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKK--ATREEID 216

Query: 314 AKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEAT 373
               G  +FI NL  S++ + L++ F   G +  A V    NG S+GFG V + T +E  
Sbjct: 217 ---NGFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMI 273

Query: 374 KAITEKNQQIVAGKPLYV 391
           +AI   N   V G+ L V
Sbjct: 274 RAIDTFNGMEVEGRVLEV 291

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 67/304 (22%), Positives = 124/304 (40%), Gaps = 33/304 (10%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           IF++NL  D   + L + F   G ++ + + T + G  +G G V F             +
Sbjct: 124 IFVRNLTFDCTPEDLKELFGTVGEVVEADIITSK-GHHRGMGTVEFTKNESVQDAISKFD 182

Query: 185 GMLLNGQEIYVG-----PHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKF 239
           G L   +++ V      P  +K+  +    E   N   V+I N+      +  +++  + 
Sbjct: 183 GALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKDMFKEC 242

Query: 240 GKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQ----KKY 295
           G      +E    G ++GFG V +   ++ ++ ++  N  E +G+ L V   +    K  
Sbjct: 243 GHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNKRKNN 302

Query: 296 ERQQELKKQYEATRM--------------EKMAKY-QGIN--------LFIKNLDDSIDD 332
           +R  + ++  E TR               E  AK+ +G+N        ++  NL  S   
Sbjct: 303 DRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNLPFSTAR 362

Query: 333 KKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 392
             L + F P G I +A++   ENG+  G   V +    +A   I + N     G  L ++
Sbjct: 363 SDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQIS 422

Query: 393 IAQR 396
            A+R
Sbjct: 423 YARR 426

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/310 (22%), Positives = 121/310 (39%), Gaps = 58/310 (18%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTS--LGYAYVNFNDHDAAKTAI 93
           S++V +L    +   L ++F  +G V    V  D IT      G   V F  +++ + AI
Sbjct: 123 SIFVRNLTFDCTPEDLKELFGTVGEV----VEADIITSKGHHRGMGTVEFTKNESVQDAI 178

Query: 94  EKLNFTPIKGKLCRIMWSQRDP------SLRKKGAGN-------IFIKNLHPDIDNKALY 140
            K +      +  ++M  Q +P         KK           +FI NL   ++ ++L 
Sbjct: 179 SKFDGALFMDR--KLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLK 236

Query: 141 DTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGP-HL 199
           D F   G++L + V  D  G S+GFG V +             NGM + G+ + V     
Sbjct: 237 DMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRF 296

Query: 200 SKKERESKF-------------------------EEMKANFTN-----------VYIKNI 223
           +K++   ++                         +E  A FT            +Y  N+
Sbjct: 297 NKRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNL 356

Query: 224 NTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKG 283
              T   +  +L    GK ++  L+    G+  G   V + N  DA  C+++LNN  + G
Sbjct: 357 PFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGG 416

Query: 284 QPLYVNRAQK 293
             L ++ A++
Sbjct: 417 CSLQISYARR 426

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           +Y  +L  S + + L+D+F PIG +++  + +        G A V + +   A   I+KL
Sbjct: 351 IYCSNLPFSTARSDLFDLFGPIGKINNAEL-KPQENGQPTGVAVVEYENLVDADFCIQKL 409

Query: 97  NFTPIKGKLCRIMWSQRD 114
           N     G   +I +++RD
Sbjct: 410 NNYNYGGCSLQISYARRD 427

>Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement
          Length = 421

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 84/173 (48%), Gaps = 14/173 (8%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
           A+++VG L  S+ +  L   F  IG V S RV  +  +  S GY YV+F D   A+ A++
Sbjct: 173 ATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVK 232

Query: 95  KLNFTPIKGKL--CRIMWSQ-----RDPSLRKKG------AGNIFIKNLHPDIDNKALYD 141
           +++   I G+   C +  S+     RD   +K G      +  +F+ NL  + D   L++
Sbjct: 233 EMHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFE 292

Query: 142 TFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEI 193
            FS  G ++S ++ T  ET + KGFGYV +            L G  ++ + +
Sbjct: 293 IFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPV 345

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 84/174 (48%), Gaps = 9/174 (5%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXL 183
           IF+  L   ID++ L   F   G ++S++V  +  + +S+G+GYV F            +
Sbjct: 175 IFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKEM 234

Query: 184 NGMLLNGQEIYVGPHLSK------KERESKFEEMKANFTN-VYIKNINTETTDKEFEELV 236
           +G  ++G+ I      SK       +R  KF ++ +  ++ +++ N++         E+ 
Sbjct: 235 HGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFEIF 294

Query: 237 AKFGKTDSVVLERTPEGEN-KGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVN 289
           ++ G+  SV +   PE E  KGFG+V + + +DA K  E L       +P+ ++
Sbjct: 295 SQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPVRLD 348

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 84/175 (48%), Gaps = 19/175 (10%)

Query: 222 NINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEF 281
           +I+ E    EF+ +      +  V+ ER  +  ++G+G+V+F +   A K V+E++  E 
Sbjct: 183 SIDDEWLKTEFDHIGGVV--SARVIYERGSD-RSRGYGYVDFEDKHYAEKAVKEMHGKEI 239

Query: 282 KGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGI------NLFIKNLDDSIDDKKL 335
            G+P+  + +           K   A R ++  K+  +       LF+ NL  + D   L
Sbjct: 240 DGRPINCDMS---------TSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNL 290

Query: 336 EEEFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
            E F+ +G + S ++ T  E  + KGFG+V + + ++A KA      + +  +P+
Sbjct: 291 FEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPV 345

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTE-NGKSKGFGFVCFSTPEEATKAITEK 379
           +F+  L  SIDD+ L+ EF   G + SA+V+    + +S+G+G+V F     A KA+ E 
Sbjct: 175 IFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKEM 234

Query: 380 NQQIVAGKPLYVAIAQRK 397
           + + + G+P+   ++  K
Sbjct: 235 HGKEIDGRPINCDMSTSK 252

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           S +L++G+L  +    +L++IFS  G V S+R+     T+   G+ YV +   D AK A 
Sbjct: 273 SDTLFLGNLSFNADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAF 332

Query: 94  EKLNFTPIKGKLCRIMWS 111
           E L    I  +  R+ +S
Sbjct: 333 EALQGEYIDNRPVRLDYS 350

>YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar
           protein involved in processing 20S to 18S rRNA, has 2
           RNA recognition (RRM) domains and is member of GAR
           (glycine/arginine-rich repeats) family of proteins [1245
           bp, 414 aa]
          Length = 414

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 85/182 (46%), Gaps = 12/182 (6%)

Query: 26  EENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFND 85
           ++N+     A+++VG L  S+ +  L   F  IG V   RV  +  T  S GY YV+F +
Sbjct: 159 QKNEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFEN 218

Query: 86  HDAAKTAIEKLNFTPIKGKLCRIMWSQRDPS---LRKKGAGN--------IFIKNLHPDI 134
              A+ AI+++    I G+      S   P+    R K  G+        +F+ NL  + 
Sbjct: 219 KSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNA 278

Query: 135 DNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEI 193
           D  A+++ F+  G ++S ++ T  ET + KGFGYV F            L G  ++ + +
Sbjct: 279 DRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPV 338

Query: 194 YV 195
            +
Sbjct: 339 RL 340

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 94/193 (48%), Gaps = 9/193 (4%)

Query: 200 SKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFG 259
           +KK++  + EE    F      +I+ E   KEFE +    G    V+ ER  +  ++G+G
Sbjct: 156 NKKQKNEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGA--RVIYERGTD-RSRGYG 212

Query: 260 FVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGI 319
           +V+F N   A K ++E+   E  G+P+  + +  K     +  K++  T  E        
Sbjct: 213 YVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSE-----PSD 267

Query: 320 NLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITE 378
            LF+ NL  + D   + E FA +G + S ++ T  E  + KGFG+V FS  E+A KA+  
Sbjct: 268 TLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDA 327

Query: 379 KNQQIVAGKPLYV 391
              + +  +P+ +
Sbjct: 328 LQGEYIDNRPVRL 340

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 82/172 (47%), Gaps = 7/172 (4%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXL 183
           IF+  L   ID++ L   F   G ++ ++V  +  T +S+G+GYV F            +
Sbjct: 170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEM 229

Query: 184 NGMLLNGQEIYVGPHLSK----KERESKFEEMKANFTN-VYIKNINTETTDKEFEELVAK 238
            G  ++G+ I      SK     +R  KF +  +  ++ +++ N++         EL AK
Sbjct: 230 QGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAK 289

Query: 239 FGKTDSVVLERTPEGEN-KGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVN 289
            G+  SV +   PE E  KGFG+V F N EDA K ++ L       +P+ ++
Sbjct: 290 HGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLD 341

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (56%), Gaps = 3/79 (3%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENG--KSKGFGFVCFSTPEEATKAITE 378
           +F+  L  SIDD+ L++EF   G +  A+V+  E G  +S+G+G+V F     A KAI E
Sbjct: 170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIY-ERGTDRSRGYGYVDFENKSYAEKAIQE 228

Query: 379 KNQQIVAGKPLYVAIAQRK 397
              + + G+P+   ++  K
Sbjct: 229 MQGKEIDGRPINCDMSTSK 247

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 45/83 (54%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           S +L++G+L  +     ++++F+  G V S+R+     T+   G+ YV F++ + AK A+
Sbjct: 266 SDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKAL 325

Query: 94  EKLNFTPIKGKLCRIMWSQRDPS 116
           + L    I  +  R+ +S   P+
Sbjct: 326 DALQGEYIDNRPVRLDFSSPRPN 348

>CAGL0M03795g complement(428607..430148) highly similar to sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 513

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 115/236 (48%), Gaps = 41/236 (17%)

Query: 189 NGQEIYVGPHLSKK-----ERESKFE----EMKANFTN----VYIKNINTETTDKEFEEL 235
           NG  +   P +S +     +RES  E    ++KA+ +     ++I  +N ETT+    E 
Sbjct: 90  NGSNVSSEPQVSNQTQNSEQRESIEEANRRQVKADLSRENCKMFIGGLNWETTEDGLREY 149

Query: 236 VAKFGKTDSVVLERTPE-GENKGFGFVNFVNHEDAVKCVEELNNTE--FKGQPLYVNRAQ 292
            +K+G    + + + P  G ++GFGF++F    DA   V+E+  T+    G+ +   RA 
Sbjct: 150 FSKYGNVVELKIMKDPNTGRSRGFGFLSF----DAPSSVDEVVKTQHILDGKVIDPKRAI 205

Query: 293 KKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMT 352
            + E+ +  K                  +F+  L   +  K+ EE F+ +GTI  A++M 
Sbjct: 206 PREEQDKTGK------------------IFVGGLGTDVRPKEFEEYFSQWGTIIDAQLML 247

Query: 353 TEN-GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQ 407
            ++ G+S+GFGFV + +P+ A K + E   +   GK + +  A+ +  ++ Q  QQ
Sbjct: 248 DKDTGRSRGFGFVTYDSPDAAEK-VCESRYREFKGKQIEIKRAEPRHQQK-QAGQQ 301

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 90/177 (50%), Gaps = 13/177 (7%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXL 183
           +FI  L+ +     L + FS +GN++  K+  D  TG+S+GFG++ F             
Sbjct: 132 MFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVDE----- 186

Query: 184 NGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGK-T 242
              ++  Q I  G  +  K    + E+ K     +++  + T+   KEFEE  +++G   
Sbjct: 187 ---VVKTQHILDGKVIDPKRAIPREEQDKTG--KIFVGGLGTDVRPKEFEEYFSQWGTII 241

Query: 243 DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQ 299
           D+ ++     G ++GFGFV + +  DA + V E    EFKG+ + + RA+ +++++Q
Sbjct: 242 DAQLMLDKDTGRSRGFGFVTY-DSPDAAEKVCESRYREFKGKQIEIKRAEPRHQQKQ 297

>Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement
          Length = 697

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 96/192 (50%), Gaps = 8/192 (4%)

Query: 214 NFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCV 273
           +   +++++I  +  D+EF +  ++F      V+ +  E +++GFGFV+F   +D  + +
Sbjct: 24  DMKTLFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEAL 83

Query: 274 EELNNTEFKGQPLYVN------RAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLD 327
            +    +FK + L ++      R+++   RQ+   K Y+ +  E++ K +   L I+N+ 
Sbjct: 84  AQARKAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKP-KLIIRNMP 142

Query: 328 DSIDDKK-LEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAG 386
            S  D   L++ F+ +GT+  AK+     GK  GF FV         +AI E     + G
Sbjct: 143 WSCRDAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKIDG 202

Query: 387 KPLYVAIAQRKD 398
           + + +  A +K+
Sbjct: 203 RQVAIDFAIQKN 214

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 39/196 (19%), Positives = 78/196 (39%), Gaps = 16/196 (8%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +F++++  D +++   D FS F  I  S +  D   +S+GFG+V F              
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQAR 87

Query: 185 GMLLNGQ--EIYVGPHLSKKER-------------ESKFEEMKANFTNVYIKNINTETTD 229
                 +   I +     + +R             ES  EE+      + I+N+     D
Sbjct: 88  KAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKPKLIIRNMPWSCRD 147

Query: 230 KE-FEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYV 288
               ++L ++FG      + +   G+  GF FV         + +EE  + +  G+ + +
Sbjct: 148 AAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKIDGRQVAI 207

Query: 289 NRAQKKYERQQELKKQ 304
           + A +K + ++  K Q
Sbjct: 208 DFAIQKNKWEEHKKVQ 223

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 311 EKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSA-KVMTTENGKSKGFGFVCFSTP 369
           +K  K +  ++F++N+      + LE  F  +G +  A  V+  E G +KG  FV F T 
Sbjct: 290 QKKNKQESFSIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAFKTE 349

Query: 370 EEATKAI 376
           E  ++ +
Sbjct: 350 EAFSECV 356

>Scas_558.1
          Length = 435

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 111/241 (46%), Gaps = 31/241 (12%)

Query: 196 GPHLSKKERESKFEE-MKANFTN-VYIKNINTETTDKEFEELVAKFG---KTDSVVLERT 250
           GP L++ E +S +EE +  N+ N +++ N+  + T ++  +  +  G   + D +    T
Sbjct: 84  GPVLAR-ELDSTYEEKVNRNYANSIFVGNLTYDCTPEDLRDYFSGIGEVVRADII----T 138

Query: 251 PEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVN-----------------RAQK 293
            +G ++G G V F N  D  + + + +++ F  + ++V                  R   
Sbjct: 139 SKGHHRGMGTVEFTNSRDVEEAIRQYDSSYFMDRQIFVRQDNPPPDNGRNERTPSRRTTA 198

Query: 294 KYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTT 353
              RQQ++     A  M+   K QG  +F+ NL  SI+ + L++ F   G +  A V   
Sbjct: 199 PSSRQQDISSG--AYSMQSNMK-QGYEIFVANLPYSINWQALKDMFKECGDVMRADVELD 255

Query: 354 ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQ 413
             G+S+GFG V F T ++  +AI   N+  V G+ L V      + R   +  Q Q +N 
Sbjct: 256 RAGRSRGFGTVIFRTRDDMERAIDRYNRFEVDGRTLDVREGHSNN-RNDDMNIQHQTQNA 314

Query: 414 M 414
           M
Sbjct: 315 M 315

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 78/353 (22%), Positives = 122/353 (34%), Gaps = 91/353 (25%)

Query: 22  EGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTS--LGYA 79
           + T EE  +   + S++VG+L    +   L D FS IG V    V  D IT      G  
Sbjct: 92  DSTYEEKVNRNYANSIFVGNLTYDCTPEDLRDYFSGIGEV----VRADIITSKGHHRGMG 147

Query: 80  YVNFNDHDAAKTAIEKLNFT---------------PIKGKLCRIMWSQRDPSLRKKGAGN 124
            V F +    + AI + + +               P  G+      ++R PS R     +
Sbjct: 148 TVEFTNSRDVEEAIRQYDSSYFMDRQIFVRQDNPPPDNGR------NERTPSRRTTAPSS 201

Query: 125 ---------------------IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSK 163
                                IF+ NL   I+ +AL D F   G+++ + V  D  G+S+
Sbjct: 202 RQQDISSGAYSMQSNMKQGYEIFVANLPYSINWQALKDMFKECGDVMRADVELDRAGRSR 261

Query: 164 GFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVG--------------------------- 196
           GFG V F             N   ++G+ + V                            
Sbjct: 262 GFGTVIFRTRDDMERAIDRYNRFEVDGRTLDVREGHSNNRNDDMNIQHQTQNAMTNDATS 321

Query: 197 ------------PHLSKKERESKFEEMKA----NFTNVYIKNINTETTDKEFEELVAKFG 240
                       P      R S F E         T +Y  N+   T   +  +L    G
Sbjct: 322 DATSNERSLPTQPSEPASNRTSTFTEGVVEGGERNTLIYCSNLPPSTARSDLYDLFESIG 381

Query: 241 KTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQK 293
           K  +  L+    GE  G   V F++ +DA  C+E LN   + G  L ++ A++
Sbjct: 382 KVRNAELKYDRNGETTGVAIVEFISQDDADVCIERLNKYNYGGCDLEISYAKR 434

>CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces
           cerevisiae YCL011c GBP2 or sp|P38922 Saccharomyces
           cerevisiae YNL004w HRB1, hypothetical start
          Length = 419

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 89/196 (45%), Gaps = 4/196 (2%)

Query: 199 LSKKERESKFEE-MKANFTN-VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENK 256
           +  +E E  +EE +  N+ N ++I N++ + T ++  +   + G+     +  T  G ++
Sbjct: 100 MMAREMEPPYEEKIDRNYDNSIFIGNLSFDATPEDLHDFFGQAGEVLRADI-ITSRGRHR 158

Query: 257 GFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEA-TRMEKMAK 315
           G G V F + E     + + N  EF G+PL+V +     E  + L    E         +
Sbjct: 159 GMGTVEFTSPEGVDNAIRDFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGR 218

Query: 316 YQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKA 375
                +FI NL  S+  + L++ F   G +  A +    NG S+GFG V + T EE   A
Sbjct: 219 PPMFEVFIVNLPYSMTWQTLKDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNA 278

Query: 376 ITEKNQQIVAGKPLYV 391
           I   N   V G+ L V
Sbjct: 279 IERFNGFDVDGRILQV 294

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/315 (20%), Positives = 111/315 (35%), Gaps = 55/315 (17%)

Query: 26  EENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSL--GYAYVNF 83
           EE        S+++G+L    +   L+D F   G V    +  D IT      G   V F
Sbjct: 110 EEKIDRNYDNSIFIGNLSFDATPEDLHDFFGQAGEV----LRADIITSRGRHRGMGTVEF 165

Query: 84  NDHDAAKTAIEKLNFTPIKGKLCRIMWSQRD----------PSLRKK----------GAG 123
              +    AI   N     G   R ++ ++D          P +R++             
Sbjct: 166 TSPEGVDNAIRDFNGVEFMG---RPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMF 222

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXL 183
            +FI NL   +  + L D F   G+++ + +  D  G S+GFG V +             
Sbjct: 223 EVFIVNLPYSMTWQTLKDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNAIERF 282

Query: 184 NGMLLNGQEIYV----------------------GPHLSKKERESKFEEMKAN----FTN 217
           NG  ++G+ + V                         +      S+F E         T 
Sbjct: 283 NGFDVDGRILQVREGKNSTGYQAPYQAPPPPQEQEIEMEPPTGPSQFTENVVGGGERSTL 342

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277
           +Y  N+   T   +  +L    G+     L+    G   G   + + N EDA  C++ LN
Sbjct: 343 IYCSNLPLTTATGDLYDLFETIGRVRHAELKFDESGAPTGIAVIEYENVEDADFCIQRLN 402

Query: 278 NTEFKGQPLYVNRAQ 292
           N  + G  L ++ A+
Sbjct: 403 NYNYGGCDLDISYAK 417

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 63/299 (21%), Positives = 108/299 (36%), Gaps = 28/299 (9%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXL 183
           +IFI NL  D   + L+D F   G +L + + T   G+ +G G V F             
Sbjct: 120 SIFIGNLSFDATPEDLHDFFGQAGEVLRADIITSR-GRHRGMGTVEFTSPEGVDNAIRDF 178

Query: 184 NGMLLNGQEIYVGPHLSKKERESKFEEMKANFTN-----------VYIKNINTETTDKEF 232
           NG+   G+ ++V       E       M+  F +           V+I N+    T +  
Sbjct: 179 NGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSMTWQTL 238

Query: 233 EELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYV---- 288
           ++L  + G      +E    G ++GFG V +   E+    +E  N  +  G+ L V    
Sbjct: 239 KDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQVREGK 298

Query: 289 NRAQKKYERQQELKKQYEATRMEKM------------AKYQGINLFIKNLDDSIDDKKLE 336
           N    +   Q     Q +   ME                 +   ++  NL  +     L 
Sbjct: 299 NSTGYQAPYQAPPPPQEQEIEMEPPTGPSQFTENVVGGGERSTLIYCSNLPLTTATGDLY 358

Query: 337 EEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 395
           + F   G +  A++   E+G   G   + +   E+A   I   N     G  L ++ A+
Sbjct: 359 DLFETIGRVRHAELKFDESGAPTGIAVIEYENVEDADFCIQRLNNYNYGGCDLDISYAK 417

>KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1 CF Ib (RNA3
           Cleavage factor Ib), hypothetical start
          Length = 570

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 74/135 (54%), Gaps = 5/135 (3%)

Query: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           +++G L+   +E  L D FS  GAV+ +++ +D  T  S G+ ++ F +  +    ++  
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 97  NFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVAT 156
           +   + GK+  I   +  P   +   G IF+  + PD+  K   + FS +G+I+ +++  
Sbjct: 248 HI--LDGKV--IDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLML 303

Query: 157 D-ETGKSKGFGYVHF 170
           D +TG+S+GFG++ +
Sbjct: 304 DKDTGRSRGFGFITY 318

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 85/174 (48%), Gaps = 26/174 (14%)

Query: 210 EMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSV-VLERTPEGENKGFGFVNFVNHED 268
           ++  +   ++I  +N ETT++   +  +K+G    V +++ T  G ++GFGF+ F N   
Sbjct: 180 DLSRDINKMFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFEN--- 236

Query: 269 AVKCVEELNNTE--FKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNL 326
               V+E+  T+    G+ +   RA  + E+ +  K                  +F+  +
Sbjct: 237 -ASSVDEVVKTQHILDGKVIDPKRAIPREEQDKTGK------------------IFVGGI 277

Query: 327 DDSIDDKKLEEEFAPYGTITSAKVMTTEN-GKSKGFGFVCFSTPEEATKAITEK 379
              +  K+ EE F+ +G+I  A++M  ++ G+S+GFGF+ + TP+   +    K
Sbjct: 278 GPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVCQNK 331

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVM-TTENGKSKGFGFVCFSTPEEATKAITEK 379
           +FI  L+    ++ L + F+ YG +   K+M  T  G+S+GFGF+ F       + +  K
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVV--K 245

Query: 380 NQQIVAGK 387
            Q I+ GK
Sbjct: 246 TQHILDGK 253

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 1/75 (1%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           +  ++VG + P V      + FS  G++   ++  D  T  S G+ ++ ++  DA     
Sbjct: 269 TGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVC 328

Query: 94  EKLNFTPIKGKLCRI 108
           +   F   KGK   I
Sbjct: 329 QN-KFIEFKGKQIEI 342

>AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH]
           complement(232080..234269) [2190 bp, 729 aa]
          Length = 729

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 92/197 (46%), Gaps = 14/197 (7%)

Query: 214 NFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCV 273
           +   ++++NI  + TD E  +  ++F      V+ +   G ++GFGFV+F    D    +
Sbjct: 14  DLKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAAL 73

Query: 274 EELNNTEFKGQPLYVNRAQKKYERQQ---ELKKQYEATRMEK--------MAKYQGI-NL 321
           ++   T+FKG+ L V+ A K+ ER +   E + Q  A   EK         A  +G   L
Sbjct: 74  DKGRKTQFKGRLLRVDVA-KRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKL 132

Query: 322 FIKNLDDSIDD-KKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKN 380
            I+N+  S  D  KL++ F  +G +  A +    +GK  GF FV         KAI E  
Sbjct: 133 IIRNMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECK 192

Query: 381 QQIVAGKPLYVAIAQRK 397
              + G+ + V  A +K
Sbjct: 193 GLKIDGREVAVDFAVQK 209

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 76/193 (39%), Gaps = 24/193 (12%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +F++N+  D  +  L D FS F  I  + +  D  G S+GFG+V F              
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKGR 77

Query: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFT----------------------NVYIKN 222
                G+ + V     ++ER  K +E +A  +                       + I+N
Sbjct: 78  KTQFKGRLLRVDV-AKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLIIRN 136

Query: 223 INTETTD-KEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEF 281
           +     D  + +++  +FG      + R  +G+  GF FV      +  K +EE    + 
Sbjct: 137 MPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKGLKI 196

Query: 282 KGQPLYVNRAQKK 294
            G+ + V+ A +K
Sbjct: 197 DGREVAVDFAVQK 209

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 80/205 (39%), Gaps = 33/205 (16%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           +L+V ++    ++A L D FS    +    + +D    +S G+ +V+F      + A++K
Sbjct: 17  TLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAG-SSRGFGFVSFAVESDTQAALDK 75

Query: 96  LNFTPIKGKLCRIMWSQRDPSLRK---------------------------KGAGNIFIK 128
              T  KG+L R+  ++R    +K                           +G   + I+
Sbjct: 76  GRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLIIR 135

Query: 129 NLHPDI-DNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGML 187
           N+     D   L   F  FG +  + +     GK  GF +V                G+ 
Sbjct: 136 NMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKGLK 195

Query: 188 LNGQEIYVGPHLSKKERESKFEEMK 212
           ++G+E+ V   + K    SK+E+ K
Sbjct: 196 IDGREVAVDFAVQK----SKWEDYK 216

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 48/90 (53%), Gaps = 2/90 (2%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKN 380
           LF++N+     D +L + F+ +  I  A ++    G S+GFGFV F+   +   A+ +  
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKGR 77

Query: 381 QQIVAGKPLYVAIAQRKDVRRSQLAQQIQA 410
           +    G+ L V +A+R++  RS+   + +A
Sbjct: 78  KTQFKGRLLRVDVAKRRE--RSKKGDEAEA 105

>KLLA0A05346g 485886..488510 some similarities with sp|P53316
           Saccharomyces cerevisiae YGR250c singleton, hypothetical
           start
          Length = 874

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 139/316 (43%), Gaps = 38/316 (12%)

Query: 110 WSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYV 168
           WS  +        GN++++ +  ++  + L   F+ FG IL  K+  D  T +S GFG+V
Sbjct: 178 WSISENPHALNHPGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFV 237

Query: 169 HFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERES-KFEEMKAN-------FTNVYI 220
            +            LNG L+NG  ++V  H+ +KERE   F++ K N       F  V++
Sbjct: 238 SYALGSQASNCIKELNGNLMNGSPLFVNYHVERKERERIHFDQWKQNEQEESTKFKGVFV 297

Query: 221 KNINTETTDKEFEELVAKFGKTDSVVLER----TPEGENKGFGFVNFVNHEDAVKCVEEL 276
            N+   TT+ +          T S+VLE+     P+ E   + F    N +  V+  E  
Sbjct: 298 GNLPIFTTENKL--------LTPSIVLEKFKKALPDCEMVSYFFPK-TNSQTNVEYSETD 348

Query: 277 NNTEFKGQPLYVN----------RAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNL 326
            +++ +  PL++N           + +  +R  E  +  +   +EK       ++ +KN 
Sbjct: 349 EDSKSES-PLHLNAESFPVKSKHNSDETNKRNNEKIEDPQLKTIEKHHDNGDEDIVMKND 407

Query: 327 DDSIDDKKLEEEFAPYGTITSA---KVMTTENGKS--KGFGFVCFSTPEEATKAITEKNQ 381
             +  D ++ +  +     T A   +  +++N +S  KG+GF  F+T E A K I   N 
Sbjct: 408 ATTSSDTEVPKSSSSSDDETEATNEETCSSQNEESPLKGYGFFRFATHEMALKCIETFND 467

Query: 382 QIVAGKPLYVAIAQRK 397
               G  L V  A +K
Sbjct: 468 SQWYGHQLVVNKAIQK 483

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/334 (23%), Positives = 133/334 (39%), Gaps = 54/334 (16%)

Query: 7   KTAEQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRV 66
           K++  LE  S+ +     N          +LYV  +  ++++  L  IF+  G +  +++
Sbjct: 170 KSSSILECWSISENPHALNH-------PGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKI 222

Query: 67  CRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRI---------------MWS 111
             D+ T  S+G+ +V++     A   I++LN   + G    +                W 
Sbjct: 223 ILDSNTNESMGFGFVSYALGSQASNCIKELNGNLMNGSPLFVNYHVERKERERIHFDQWK 282

Query: 112 Q--RDPSLRKKGA--GNIFI-----KNLHPDID----NKALYDT--FSVFGNILSSKV-- 154
           Q  ++ S + KG   GN+ I     K L P I      KAL D    S F    +S+   
Sbjct: 283 QNEQEESTKFKGVFVGNLPIFTTENKLLTPSIVLEKFKKALPDCEMVSYFFPKTNSQTNV 342

Query: 155 ---ATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEM 211
               TDE  KS+    +H              +       E    P L   E+     + 
Sbjct: 343 EYSETDEDSKSES--PLHLNAESFPVKSKHNSDETNKRNNEKIEDPQLKTIEKHHDNGD- 399

Query: 212 KANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGEN-----KGFGFVNFVNH 266
                ++ +KN  T ++D E  +  +          E T   +N     KG+GF  F  H
Sbjct: 400 ----EDIVMKNDATTSSDTEVPKSSSSSDDETEATNEETCSSQNEESPLKGYGFFRFATH 455

Query: 267 EDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQE 300
           E A+KC+E  N++++ G  L VN+A +K+ + Q 
Sbjct: 456 EMALKCIETFNDSQWYGHQLVVNKAIQKFHQHQH 489

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 17/98 (17%)

Query: 317 QGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTEN----------------GKSKG 360
           Q  NL++K+L     D+ L + F  +G I SAK++T                   GKSKG
Sbjct: 728 QESNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKG 787

Query: 361 FGFVCFSTPEEATKAITEKN-QQIVAGKPLYVAIAQRK 397
           +GFVCF  P +A++A+   +  ++ +   L+V+ AQR+
Sbjct: 788 YGFVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRR 825

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 16/84 (19%)

Query: 123 GNIFIKNLHPDIDNKALYDTFSVFGNILSSKVAT---------------DET-GKSKGFG 166
            N+++K+L  D  ++ LY  F  FG I+S+K+ T               DE  GKSKG+G
Sbjct: 730 SNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYG 789

Query: 167 YVHFXXXXXXXXXXXXLNGMLLNG 190
           +V F             +G+ LN 
Sbjct: 790 FVCFQNPLDASRAMYHTDGLKLNS 813

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 50/104 (48%), Gaps = 17/104 (16%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSV--------VLERTPE--------GENKGFG 259
           +N+Y+K++  +  D++  +   KFG+  S         + E+  +        G++KG+G
Sbjct: 730 SNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYG 789

Query: 260 FVNFVNHEDAVKCVEELNNTEFKG-QPLYVNRAQKKYERQQELK 302
           FV F N  DA + +   +  +      L+V+ AQ++ +    +K
Sbjct: 790 FVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRRSKSIDSIK 833

>AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C
           (GBP2) - SH] complement(309542..310555) [1014 bp, 337
           aa]
          Length = 337

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 87/192 (45%), Gaps = 8/192 (4%)

Query: 211 MKANFTN-VYIKNINTETTDKEFEELVAKFGKTDSVVLER--TPEGENKGFGFVNFVNHE 267
           M  N++N V+I N+  +TT ++  +L   FG+   VV     T  G ++G G V + N +
Sbjct: 1   MSRNYSNSVFIGNLTYDTTPEDLRQL---FGEVGHVVRADIITSRGHHRGMGTVEYTNAQ 57

Query: 268 DAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLD 327
           D  + +   N  +F  + L+V R         E +++     + +     G  +F+ NL 
Sbjct: 58  DVDEAIRRFNGMDFMHRELFVRRDNPP--PVGERRERRGPGPLPRRTHPGGFEIFVANLP 115

Query: 328 DSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK 387
            SI  + L++ F     +  A V    +G S+GFG V  +T E    AI   N   + G+
Sbjct: 116 YSISWQTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGR 175

Query: 388 PLYVAIAQRKDV 399
            L V   +  DV
Sbjct: 176 ILEVREGKGTDV 187

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 67/184 (36%), Gaps = 24/184 (13%)

Query: 30  SETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYA-YVNFNDHDA 88
           S   S S+++G+L    +   L  +F  +G V    +         +G   Y N  D D 
Sbjct: 2   SRNYSNSVFIGNLTYDTTPEDLRQLFGEVGHVVRADIITSRGHHRGMGTVEYTNAQDVDE 61

Query: 89  AKTAIEKLNFTPIKGKLCRIMWSQRD-----------------PSLRKKGAGNIFIKNLH 131
           A      ++F      + R ++ +RD                 P     G   IF+ NL 
Sbjct: 62  AIRRFNGMDF------MHRELFVRRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANLP 115

Query: 132 PDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQ 191
             I  + L D F     ++ + V+ D  G S+GFG V+              NG  L G+
Sbjct: 116 YSISWQTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGR 175

Query: 192 EIYV 195
            + V
Sbjct: 176 ILEV 179

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 54/256 (21%), Positives = 88/256 (34%), Gaps = 29/256 (11%)

Query: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           ++V +L  S+S   L D+F     V    V  DA    S G+  V     +    AIE+ 
Sbjct: 109 IFVANLPYSISWQTLKDMFKECSEVIHADVSVDA-DGYSRGFGTVYVTTRENQIAAIERW 167

Query: 97  NFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVAT 156
           N   ++G++  +    +   +   G G+ ++    P  D    Y    V   +  S+ A+
Sbjct: 168 NGYELEGRILEVR-EGKGTDVGSAGRGDSYVPKQIPSYDYDGEYRGTEVRAELPHSENAS 226

Query: 157 DETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFT 216
                     Y  +                             S  E  SK     A   
Sbjct: 227 VSVSGKASPEYEQYTP---------------------------SDVEFTSKAAPGGAKNR 259

Query: 217 NVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEEL 276
            +Y +N+   T + +  +L    GK     L+   EG   G     F    DA +C+E L
Sbjct: 260 IIYCENMPLATAESDLYDLFETAGKVLRANLQYDSEGNPTGSSVCEFETVADAQECIERL 319

Query: 277 NNTEFKGQPLYVNRAQ 292
           NN  + G  L ++ A 
Sbjct: 320 NNYHYGGCDLKMSYAS 335

>Scas_635.7
          Length = 581

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 88/176 (50%), Gaps = 13/176 (7%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXL 183
           +FI  L+ +     L + FS +GN++  K+  D  TG+S+GFG++ F             
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDE----- 252

Query: 184 NGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGK-T 242
              ++  Q I  G  +  K    + E+ K     +++  I T+   KEFE+  A++G   
Sbjct: 253 ---VVKTQHILDGKVIDPKRSIPREEQDKTG--KIFVGGIGTDVRPKEFEDFFAQYGTII 307

Query: 243 DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQ 298
           D+ ++     G ++GFGFV + +  DAV  V +    EFKG+ + + RA+ ++ ++
Sbjct: 308 DAQLMLDKDTGRSRGFGFVTY-DSGDAVDRVCQNKYIEFKGKQIEIKRAEPRHNQR 362

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 93/195 (47%), Gaps = 27/195 (13%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSV-VLERTPEGENKGFGFVNFVNHEDAVKCVEEL 276
           ++I  +N ETT+   +   +K+G    + +++    G ++GFGF+ F N       V+E+
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFEN----PSSVDEV 253

Query: 277 NNTE--FKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKK 334
             T+    G+ +   R+  + E+ +  K                  +F+  +   +  K+
Sbjct: 254 VKTQHILDGKVIDPKRSIPREEQDKTGK------------------IFVGGIGTDVRPKE 295

Query: 335 LEEEFAPYGTITSAKVMTTEN-GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 393
            E+ FA YGTI  A++M  ++ G+S+GFGFV + + +   +    K  +   GK + +  
Sbjct: 296 FEDFFAQYGTIIDAQLMLDKDTGRSRGFGFVTYDSGDAVDRVCQNKYIEF-KGKQIEIKR 354

Query: 394 AQRKDVRRSQLAQQI 408
           A+ +  +R+  +Q +
Sbjct: 355 AEPRHNQRAAASQPM 369

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 31/75 (41%), Gaps = 1/75 (1%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           +  ++VG +   V      D F+  G +   ++  D  T  S G+ +V ++  DA     
Sbjct: 279 TGKIFVGGIGTDVRPKEFEDFFAQYGTIIDAQLMLDKDTGRSRGFGFVTYDSGDAVDRVC 338

Query: 94  EKLNFTPIKGKLCRI 108
           +   +   KGK   I
Sbjct: 339 QN-KYIEFKGKQIEI 352

>Kwal_55.21960
          Length = 597

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 73/135 (54%), Gaps = 5/135 (3%)

Query: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           +++G L+   +E +L D FS  G V+ +++ RD  T  S G+ ++ F +  +    ++  
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 97  NFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVAT 156
           +   + GK+  I   +  P   +   G IF+  + PD+  K   + FS +G I+ +++  
Sbjct: 271 HI--LDGKV--IDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLML 326

Query: 157 D-ETGKSKGFGYVHF 170
           D +TG+S+GFG++ +
Sbjct: 327 DKDTGRSRGFGFITY 341

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 84/174 (48%), Gaps = 26/174 (14%)

Query: 210 EMKANFTNVYIKNINTETTDKEFEELVAKFGK-TDSVVLERTPEGENKGFGFVNFVNHED 268
           ++  +   ++I  +N ETT+   ++  +K+G+ TD  ++     G ++GFGF+ F     
Sbjct: 203 DLSRDICKMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAE--- 259

Query: 269 AVKCVEELNNTE--FKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNL 326
               V+E+  T+    G+ +   RA  + E+ +  K                  +F+  +
Sbjct: 260 -ASSVDEVVKTQHILDGKVIDPKRAIPREEQDKTGK------------------IFVGGI 300

Query: 327 DDSIDDKKLEEEFAPYGTITSAKVMTTEN-GKSKGFGFVCFSTPEEATKAITEK 379
              +  K+ EE F+ +GTI  A++M  ++ G+S+GFGF+ + TP+   +    K
Sbjct: 301 GPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVCENK 354

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 83/173 (47%), Gaps = 13/173 (7%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXL 183
           +FI  L+ +     L D FS +G +   K+  D  TG+S+GFG++ F             
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDE----- 265

Query: 184 NGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKT- 242
              ++  Q I  G  +  K    + E+ K     +++  I  +   KEFEE  +++G   
Sbjct: 266 ---VVKTQHILDGKVIDPKRAIPREEQDKTG--KIFVGGIGPDVRPKEFEEFFSQWGTII 320

Query: 243 DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKY 295
           D+ ++     G ++GFGF+ + +  DAV  V E    EFKG+ + + RA+ ++
Sbjct: 321 DAQLMLDKDTGRSRGFGFITY-DTPDAVDRVCENKFIEFKGKRIEIKRAEPRH 372

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 37/90 (41%), Gaps = 3/90 (3%)

Query: 19  DKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGY 78
           D +     E Q +T    ++VG + P V      + FS  G +   ++  D  T  S G+
Sbjct: 279 DPKRAIPREEQDKT--GKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGRSRGF 336

Query: 79  AYVNFNDHDAAKTAIEKLNFTPIKGKLCRI 108
            ++ ++  DA     E   F   KGK   I
Sbjct: 337 GFITYDTPDAVDRVCEN-KFIEFKGKRIEI 365

>YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein
           with three RNA recognition motif (RRM) domains, has
           similarity to human 64K polyadenylation factor [2346 bp,
           781 aa]
          Length = 781

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 92/222 (41%), Gaps = 53/222 (23%)

Query: 123 GNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDET-GKSKGFGYVHFXXXXXXXXXXX 181
           GNIF+  +   +    L   FS +G ILS K+  D+T G+  G+G++ +           
Sbjct: 195 GNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIK 254

Query: 182 XLNGMLLNGQEIYVGPHLSKKERES-KFEEMKA-----NFTNVYIKN--------INTET 227
            LNG  +NG  +++  H+ +KERE   ++ +K      NF  ++I N        + T  
Sbjct: 255 ELNGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPEKVETLI 314

Query: 228 TDKEFEELVAK-----------------------------FGKTDSVVLERTPEGEN--- 255
           T KE  E++ K                             F +  SV   ++    N   
Sbjct: 315 TPKEVIEVIKKELSKKFPDFDIISYYFPKRSNTRSSSSVSFNEEGSVESNKSSNNTNGNA 374

Query: 256 ------KGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRA 291
                 KG+GF+  +NHE A+  +E  N   + G  L VN+A
Sbjct: 375 QDEDMLKGYGFIKLINHEQALAAIETFNGFMWHGNRLVVNKA 416

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 95/468 (20%), Positives = 168/468 (35%), Gaps = 122/468 (26%)

Query: 32  TVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKT 91
           T   +++VG +  S+S   L  +FS  G + S+++  D       GY ++++     A  
Sbjct: 192 TYPGNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASL 251

Query: 92  AIEKLNFTPIKGKLC------------RIMWSQRDPSLRKKGAGNIFIKNL--------- 130
            I++LN   + G               RI W     +        +FI NL         
Sbjct: 252 CIKELNGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPEKVE 311

Query: 131 -------------------HPDIDNKALY------------DTFSVFGNILSSKVATDET 159
                               PD D  + Y             +F+  G++ S+K + +  
Sbjct: 312 TLITPKEVIEVIKKELSKKFPDFDIISYYFPKRSNTRSSSSVSFNEEGSVESNKSSNNTN 371

Query: 160 GKS------KGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKK--------ERE 205
           G +      KG+G++               NG + +G  + V   +  K        +R 
Sbjct: 372 GNAQDEDMLKGYGFIKLINHEQALAAIETFNGFMWHGNRLVVNKAVQHKVYNNHNSHDRH 431

Query: 206 ---SKFEEMKA-NFTNVYIKNINTETTDKEFEELVAKFGKTDSV------VLERTPEGEN 255
              S   +M+   F N  + + N  T D+ +          D+        +  TP  E 
Sbjct: 432 PSISNHNDMEVLEFANNPMYDYNNYTYDRYYFNNNKNGNSNDTSNVRYFDSVRSTPVAEK 491

Query: 256 KGFGFVNFVNHEDAVKCVEELNNTEFKGQ--PLYVNRAQKKYERQQELKKQYEATRME-- 311
                  F    ++         +E +GQ  P ++      Y        QY +T     
Sbjct: 492 MDL----FYPQRESF--------SEGRGQRVPRFMGNKFDMY--------QYPSTSYSLP 531

Query: 312 -KMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMT----------------TE 354
             M+  Q  NL++K++  S  D+ L + +  +G I S KV+T                ++
Sbjct: 532 IPMSNQQESNLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSD 591

Query: 355 N----GKSKGFGFVCFSTPEEATKAITEKN-QQIVAGKPLYVAIAQRK 397
           N    G S+G+GFV F +P +A KAI   +  Q+   + L V+ AQ++
Sbjct: 592 NDLPVGSSRGYGFVSFESPLDAAKAILNTDGYQVSKDQVLSVSFAQKR 639

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 48/100 (48%), Gaps = 2/100 (2%)

Query: 320 NLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTEN-GKSKGFGFVCFSTPEEATKAITE 378
           N+F+  +  S+   +L   F+ YG I S K++  +  G+  G+GF+ +    +A+  I E
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKE 255

Query: 379 KNQQIVAGKPLYVAI-AQRKDVRRSQLAQQIQARNQMRFQ 417
            N + V G  L++    +RK+  R       +  N   F+
Sbjct: 256 LNGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFR 295

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 44/103 (42%), Gaps = 20/103 (19%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVC-------------------RDAITKTS 75
           ++LYV  +  S ++  LYD +   G + S++V                     D    +S
Sbjct: 540 SNLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPVGSS 599

Query: 76  LGYAYVNFND-HDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSL 117
            GY +V+F    DAAK  +    +   K ++  + ++Q+  +L
Sbjct: 600 RGYGFVSFESPLDAAKAILNTDGYQVSKDQVLSVSFAQKRGNL 642

>CAGL0E01947g 193225..194583 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 452

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 86/174 (49%), Gaps = 26/174 (14%)

Query: 210 EMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE-GENKGFGFVNFVNHED 268
           ++  +   ++I  +N ETT+    +  +K+GK + + + + P  G ++GFGF+ F    +
Sbjct: 116 DLSKDSCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTF----E 171

Query: 269 AVKCVEELNNTE--FKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNL 326
           +   V+E+  T+    G+ +   RA  + E+ +  K                  +F+  +
Sbjct: 172 SASSVDEVVKTQHILDGKVIDPKRAIPREEQDKTGK------------------IFVGGI 213

Query: 327 DDSIDDKKLEEEFAPYGTITSAKVMTTEN-GKSKGFGFVCFSTPEEATKAITEK 379
              +  K+ EE FA +GTI  A++M  ++ G+S+GFGF+ + TP+   K    K
Sbjct: 214 GPDVRPKEFEEFFAQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDKVCQNK 267

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 71/138 (51%), Gaps = 5/138 (3%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           S  +++G L+   +E  L D FS  G V  +++ +D  T  S G+ ++ F    +    +
Sbjct: 121 SCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVV 180

Query: 94  EKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSK 153
           +  +   + GK+  I   +  P   +   G IF+  + PD+  K   + F+ +G I+ ++
Sbjct: 181 KTQHI--LDGKV--IDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 236

Query: 154 VATD-ETGKSKGFGYVHF 170
           +  D +TG+S+GFG++ +
Sbjct: 237 LMLDKDTGRSRGFGFITY 254

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/75 (21%), Positives = 32/75 (42%), Gaps = 1/75 (1%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           +  ++VG + P V      + F+  G +   ++  D  T  S G+ ++ ++  DA     
Sbjct: 205 TGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDKVC 264

Query: 94  EKLNFTPIKGKLCRI 108
           +   F   KG+   I
Sbjct: 265 QN-KFIDFKGRKIEI 278

>CAGL0H02123g complement(188454..190121) similar to sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 555

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 130/333 (39%), Gaps = 78/333 (23%)

Query: 30  SETVSASLYVGDLDPSVSEAHLYDIFSPIG----AVSSIRVCRDAITKTSLGYAYVNFND 85
           + T  + LY+GDLDPS  EA +  I++ +G     V  +        + +LGY +V F  
Sbjct: 79  ASTPGSQLYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFPS 138

Query: 86  HDAAKTAIEKLNFTPIKG---KLCRIMWSQRD------PSLRKKGAGN------IFIKNL 130
              A  A+ K N   I G   K  ++ WS +        S+      N      IF+ +L
Sbjct: 139 PAHASNALMK-NGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNSIFVGDL 197

Query: 131 HPDIDNKALYDTF-SVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXLNGMLL 188
            P +    L+D F + + + + +KV  D+ TG SKG+G+V F            + G  L
Sbjct: 198 APSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCFL 257

Query: 189 NGQEIYVGPH-------------------------LSKKERE------------------ 205
           NG+ I +G                           L ++ R                   
Sbjct: 258 NGRAIKIGIAGGNNNNNSNSNYNNQRMANDNISNGLGQQSRSLNGQLPQQFVNATPQQPV 317

Query: 206 -SKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFV 264
            + F +   N T V++  ++   T+ E       FG   +++  + P G  KG GFV +V
Sbjct: 318 LNHFTD--PNNTTVFVGGLSPLVTEDELRSYFEPFG---TIIYVKIPAG--KGCGFVQYV 370

Query: 265 NHEDAVKCVEELNNTEFKGQPLYVNRAQKKYER 297
               A   +     T+ +G P+  +R +  + R
Sbjct: 371 ERSSAETAI-----TKMQGFPIANSRVRLSWGR 398

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 52/117 (44%), Gaps = 13/117 (11%)

Query: 3   DITEKTAEQLENLSLQDKQEGTNEENQSETVS-------ASLYVGDLDPSVSEAHLYDIF 55
           +I+    +Q  +L+ Q  Q+  N   Q   ++        +++VG L P V+E  L   F
Sbjct: 288 NISNGLGQQSRSLNGQLPQQFVNATPQQPVLNHFTDPNNTTVFVGGLSPLVTEDELRSYF 347

Query: 56  SPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQ 112
            P G +  +++          G  +V + +  +A+TAI K+   PI     R+ W +
Sbjct: 348 EPFGTIIYVKI------PAGKGCGFVQYVERSSAETAITKMQGFPIANSRVRLSWGR 398

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 66/145 (45%), Gaps = 8/145 (5%)

Query: 254 ENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKM 313
           +N G+ FV F +   A   + + N  E  G   +V++  K     Q +     A+     
Sbjct: 127 KNLGYCFVEFPSPAHASNALMK-NGMEIPG---FVHKKLKLNWSAQSVNNGSGASVANGA 182

Query: 314 AKYQGIN--LFIKNLDDSIDDKKLEEEFA-PYGTITSAKVMTTE-NGKSKGFGFVCFSTP 369
              Q  N  +F+ +L  S+ + +L + F   Y +   AKVM  +  G SKG+GFV F + 
Sbjct: 183 VANQQTNNSIFVGDLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSS 242

Query: 370 EEATKAITEKNQQIVAGKPLYVAIA 394
            +  +A+ E     + G+ + + IA
Sbjct: 243 MDQQRALVEMQGCFLNGRAIKIGIA 267

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 44/230 (19%), Positives = 91/230 (39%), Gaps = 41/230 (17%)

Query: 218 VYIKNINTETTDKE-FEELVAKFGKT-DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275
           +++ ++    T+ + F+  + K+  T  + V+     G +KG+GFV F +  D  + + E
Sbjct: 192 IFVGDLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVE 251

Query: 276 LNNTEFKGQPLYVNRA---------------------------QKKYERQQELKKQY-EA 307
           +      G+ + +  A                           Q+      +L +Q+  A
Sbjct: 252 MQGCFLNGRAIKIGIAGGNNNNNSNSNYNNQRMANDNISNGLGQQSRSLNGQLPQQFVNA 311

Query: 308 TRMEKMAKY----QGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGF 363
           T  + +  +        +F+  L   + + +L   F P+GTI   K+        KG GF
Sbjct: 312 TPQQPVLNHFTDPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPA-----GKGCGF 366

Query: 364 VCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQ 413
           V +     A  AIT+     +A     V ++  +  +++ L Q+   R++
Sbjct: 367 VQYVERSSAETAITKMQGFPIANS--RVRLSWGRSAKKTALIQKALLRSR 414

>CAGL0B04169g complement(404713..407298) highly similar to tr|Q06106
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 861

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 84/172 (48%), Gaps = 9/172 (5%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSK------GFGYVHFXXXXXXX 177
           +IFIKNL+    ++ L D F VF   + ++V T    K K      GFG+V F       
Sbjct: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700

Query: 178 XXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMK-ANFTNVYIKNINTETTDKEFEELV 236
                ++G +++G +I +   LS ++  +  +E K A    + +KN+  E T K+  EL 
Sbjct: 701 AVISAMDGTVIDGHKIQL--KLSHRQGNAGSQEKKKAKNGKIIVKNLPFEATRKDVFELF 758

Query: 237 AKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYV 288
             FG+  SV + +  +   +GF FV FV  ++A   +++L      G+ L +
Sbjct: 759 NSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 92/201 (45%), Gaps = 11/201 (5%)

Query: 8   TAEQLENLSLQDKQEGTNEENQS-ETVSASLYVGDLDPSVSEAHLYDIFSPIG--AVSSI 64
           +A+ LE++S +  ++  +E+ Q  +  + S+++ +L+   +   L D F       V+ +
Sbjct: 612 SADLLESVSSKKTEDKEDEDEQVVDGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQV 671

Query: 65  RVCRDAITKT---SLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDP---SLR 118
           +   D   K    S+G+ +V F   + A   I  ++ T I G   ++  S R     S  
Sbjct: 672 KTKPDPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQE 731

Query: 119 KKGA--GNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXX 176
           KK A  G I +KNL  +   K +++ F+ FG + S +V       ++GF +V F      
Sbjct: 732 KKKAKNGKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEA 791

Query: 177 XXXXXXLNGMLLNGQEIYVGP 197
                 L G+ L G+ + + P
Sbjct: 792 ENAMDQLQGVHLLGRRLVMQP 812

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 8/108 (7%)

Query: 296 ERQQELKKQYEATRMEKMAKYQGI-NLFIKNLDDSIDDKKLEEEFAPYGTITSAKV-MTT 353
           E Q+E+  + +A     +AK Q    LF++N+  S  +   ++ F+PYG +    V + T
Sbjct: 306 ELQEEIPDEEQA-----IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDT 360

Query: 354 ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIA-QRKDVR 400
             G SKGF +V F+ PEEA +A  E ++QI  G+ L++  A + KD R
Sbjct: 361 RTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHILAADEMKDHR 408

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 79/182 (43%), Gaps = 17/182 (9%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGK--TDSVVLERTPEGENK----GFGFVNFVNHEDA 269
            +++IKN+N +TT ++  +    F       V  +  P+ +NK    GFGFV F   E A
Sbjct: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699

Query: 270 VKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDS 329
              +  ++ T   G  + +  + +          Q  A   EK     G  + +KNL   
Sbjct: 700 TAVISAMDGTVIDGHKIQLKLSHR----------QGNAGSQEKKKAKNG-KIIVKNLPFE 748

Query: 330 IDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
              K + E F  +G + S +V    +  ++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 749 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808

Query: 390 YV 391
            +
Sbjct: 809 VM 810

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 84/216 (38%), Gaps = 41/216 (18%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277
           + +KN    TT +E  EL   FGK + +++   P G       V F +         +L 
Sbjct: 514 ILVKNFPFGTTREELGELFVPFGKLERLLM--PPAG---TIAIVQFRDIASGRSAFSKLA 568

Query: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQG------------------- 318
              FKG  +Y+ +  K    +    +       EK AK  G                   
Sbjct: 569 FKRFKGTVIYLEKGPKDCFTKAASNEDAMEHDEEKSAKEAGPSSADLLESVSSKKTEDKE 628

Query: 319 -----------INLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSK------GF 361
                      +++FIKNL+     ++L + F  +     A+V T  + K K      GF
Sbjct: 629 DEDEQVVDGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGF 688

Query: 362 GFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397
           GFV F T E+AT  I+  +  ++ G  + + ++ R+
Sbjct: 689 GFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQ 724

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           +  L++ ++  S +E     +FSP G +  + V  D  T  S G+AYV F   + A  A 
Sbjct: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383

Query: 94  EKLNFTPIKGKLCRIM 109
            +L+    +G+L  I+
Sbjct: 384 IELDKQIFQGRLLHIL 399

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 1/74 (1%)

Query: 123 GNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXX 181
           G +F++N+            FS +G +    VA D  TG SKGF YV F           
Sbjct: 325 GRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYI 384

Query: 182 XLNGMLLNGQEIYV 195
            L+  +  G+ +++
Sbjct: 385 ELDKQIFQGRLLHI 398

>ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH]
           (768392..770908) [2517 bp, 838 aa]
          Length = 838

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 97/410 (23%), Positives = 167/410 (40%), Gaps = 57/410 (13%)

Query: 33  VSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTA 92
            +  L++ ++    +E     +FSP G +  + V  D  T  S G+AYV F D + A  A
Sbjct: 299 ATGRLFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANA 358

Query: 93  IEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNL----HPDIDNKALY--DTFS-- 144
             +L+    +G+L  I+ +    + R        +KNL      ++  KA     TFS  
Sbjct: 359 YIELDKQIFQGRLLHILPADAKKTHR---LDEFDLKNLPLKKQRELKRKATAAQQTFSWN 415

Query: 145 -VFGN---ILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLS 200
            +F N   +LSS  A     KS+     +             + G +    E   G  L+
Sbjct: 416 SLFMNQDAVLSSVAAKLGMEKSQLIDPENSGSAVKQALAEAHVIGDVRKYFEAR-GVDLT 474

Query: 201 KKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGF 260
           + E+  K  E       + +KN    TT +E  EL   FGK + +++   P G       
Sbjct: 475 QFEKFKKVTERDDRI--ILVKNFPHGTTREELAELFLPFGKIERMLM--PPSG---TIAI 527

Query: 261 VNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK-YERQ----------------QELKK 303
           + + +   A     +L+   FK   LY+ +  K  + R+                +E+KK
Sbjct: 528 IQYRDVPAARGAFTKLSYKRFKAPILYLEKGPKDCFSREPRGDELLEGDAAPEDVKEIKK 587

Query: 304 QYEATRMEKMAKYQG----------INLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTT 353
             E   M+  +K             +++F+KNL+ S    +L E+F P+     A+V T 
Sbjct: 588 SVEDV-MDADSKTPSSEATAIDGPTVSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTK 646

Query: 354 ENGK------SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397
            + K      S GFGF+ F T E+A   I   +  ++ G  + + I+ ++
Sbjct: 647 PDPKNSDKKLSMGFGFIEFRTKEQAGAVIAAMDGAVIDGHKIQLKISHKQ 696

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 91/202 (45%), Gaps = 15/202 (7%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGK------SKGFGYVHFXXXXXXX 177
           +IF+KNL+    +  L + F  F   + ++V T    K      S GFG++ F       
Sbjct: 613 SIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAG 672

Query: 178 XXXXXLNGMLLNGQEIYVG-PHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELV 236
                ++G +++G +I +   H      ++     K     + +KN+  E T K+  EL 
Sbjct: 673 AVIAAMDGAVIDGHKIQLKISHKQSSLPKTSKGSKKKISGKIIVKNLPFEATRKDVFELF 732

Query: 237 AKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYE 296
           + FG+  SV + +  +   +GF FV F+   +A   +++L      G+ L +  A+++ +
Sbjct: 733 SSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVMQYAEQESD 792

Query: 297 RQQE--------LKKQYEATRM 310
             +E        +KKQ   ++M
Sbjct: 793 DVEEQISKMTMKMKKQAAVSKM 814

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKV-MTTENGKSKGFGFVCFSTPEEATKAITEK 379
           LF++N+     ++  ++ F+PYG +    V + T  G+SKGF +V F  PE A  A  E 
Sbjct: 303 LFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIEL 362

Query: 380 NQQIVAGKPLYVAIAQRKDVRR 401
           ++QI  G+ L++  A  K   R
Sbjct: 363 DKQIFQGRLLHILPADAKKTHR 384

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 89/196 (45%), Gaps = 12/196 (6%)

Query: 12  LENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIG--AVSSIRVCRD 69
           +E++   D +  ++E    +  + S++V +L+ S + A L + F P     V+ ++   D
Sbjct: 589 VEDVMDADSKTPSSEATAIDGPTVSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPD 648

Query: 70  ---AITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRK------- 119
              +  K S+G+ ++ F   + A   I  ++   I G   ++  S +  SL K       
Sbjct: 649 PKNSDKKLSMGFGFIEFRTKEQAGAVIAAMDGAVIDGHKIQLKISHKQSSLPKTSKGSKK 708

Query: 120 KGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXX 179
           K +G I +KNL  +   K +++ FS FG + S +V       ++GF +V F         
Sbjct: 709 KISGKIIVKNLPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENA 768

Query: 180 XXXLNGMLLNGQEIYV 195
              L G+ L G+ + +
Sbjct: 769 MDQLQGVHLLGRRLVM 784

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 81/188 (43%), Gaps = 15/188 (7%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENK------GFGFVNFVNHEDA 269
            ++++KN+N  TT  +  E    F       ++  P+ +N       GFGF+ F   E A
Sbjct: 612 VSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQA 671

Query: 270 VKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDS 329
              +  ++     G  + +  + K    Q  L K  + ++ +   K       +KNL   
Sbjct: 672 GAVIAAMDGAVIDGHKIQLKISHK----QSSLPKTSKGSKKKISGKII-----VKNLPFE 722

Query: 330 IDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
              K + E F+ +G + S +V    +  ++GF FV F  P EA  A+ +     + G+ L
Sbjct: 723 ATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRL 782

Query: 390 YVAIAQRK 397
            +  A+++
Sbjct: 783 VMQYAEQE 790

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 120 KGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXX 178
           +  G +F++N+  D   +     FS +G +    VA D  TG+SKGF YV F        
Sbjct: 298 RATGRLFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAAN 357

Query: 179 XXXXLNGMLLNGQEIYVGPHLSKK 202
               L+  +  G+ +++ P  +KK
Sbjct: 358 AYIELDKQIFQGRLLHILPADAKK 381

>KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces
           cerevisiae YPL043w NOP4 nucleolar protein, start by
           similarity
          Length = 685

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 95/202 (47%), Gaps = 18/202 (8%)

Query: 214 NFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCV 273
           +   ++++ +  E+TD+EF    ++F      V+ +  EG ++GFGFV+F   +D    +
Sbjct: 13  DLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTAL 72

Query: 274 EELNNTEFKGQPLYVNRAQKKYERQQELKKQYEAT--------RMEKMAKYQGIN----- 320
            +   T+F G+ L ++ A K+ ER +  K   E +        + E+ +K +  N     
Sbjct: 73  NQARKTKFMGRLLRIDIA-KRRERSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKG 131

Query: 321 ---LFIKNLDDSIDD-KKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAI 376
              L I+N+  S  D  KL++ F  YGT+  A +    +G+  GF FV  +       AI
Sbjct: 132 KPKLIIRNMPWSCRDPTKLKKIFGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAI 191

Query: 377 TEKNQQIVAGKPLYVAIAQRKD 398
                  + G+ + V  A +K+
Sbjct: 192 EGTKDLKIDGRKVAVDFAIQKN 213

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 311 EKMAKYQGINL---FIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFS 367
           +K+ K +G++L   F++ +     D++    F+ +  I  A ++    G S+GFGFV F+
Sbjct: 4   KKVIKDEGLDLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFA 63

Query: 368 TPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQ 403
             ++   A+ +  +    G+ L + IA+R++  R +
Sbjct: 64  VEDDTKTALNQARKTKFMGRLLRIDIAKRRERSRGK 99

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 34/178 (19%), Positives = 63/178 (35%), Gaps = 36/178 (20%)

Query: 50  HLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIM 109
           + +  FSPI     ++    A    S G+ +V+F   D  KTA+ +   T   G+L RI 
Sbjct: 33  NFFSQFSPIKHAVIVKDGEGA----SRGFGFVSFAVEDDTKTALNQARKTKFMGRLLRID 88

Query: 110 WSQRDPSLR-------------------------------KKGAGNIFIKNLHPDI-DNK 137
            ++R    R                                KG   + I+N+     D  
Sbjct: 89  IAKRRERSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKGKPKLIIRNMPWSCRDPT 148

Query: 138 ALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
            L   F ++G ++ + +     G+  GF +V                 + ++G+++ V
Sbjct: 149 KLKKIFGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIEGTKDLKIDGRKVAV 206

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 253 GENKGFGFVNFVNHEDAVKCVEELNNTE 280
           G ++G+GFV F +H+ A+ C+  LN  E
Sbjct: 556 GRSRGYGFVEFRDHKAALMCLRWLNAHE 583

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNI-LSSKVATDETGKSKGFGYVHF 170
           +IF++N+  D   ++L   F VFG +  +  V   ETG +KG  +V F
Sbjct: 297 SIFVRNVPYDATQESLERHFGVFGPVKYALPVIDKETGLAKGTAFVAF 344

>KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181
           Saccharomyces cerevisiae YOR319w HSH49 essential yeast
           splicing factor, start by similarity
          Length = 203

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 88/190 (46%), Gaps = 21/190 (11%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKG----FGFVNFVNHEDAVKCV 273
           VY+ N+++        EL  + G    +   +  + E+      + F+ FVN +    C 
Sbjct: 5   VYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVNDDVDYVCK 64

Query: 274 EELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDK 333
              N     G+PL V R+ K          Q E T  +  AK     LF+KNLD+SID  
Sbjct: 65  LFDNRVSLYGKPLKVRRSNK----------QPETTDFDVGAK-----LFVKNLDESIDVP 109

Query: 334 KLEEEFAPYGTITSA-KVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 392
           +L   F  +G +    +V   +NG  +   +V F+T + + +A+ + N+  +A K +Y+ 
Sbjct: 110 QLSNIFKIFGKLLRKPEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIYID 168

Query: 393 IAQRKDVRRS 402
            A + D++++
Sbjct: 169 YAYKDDMQKT 178

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 74/168 (44%), Gaps = 6/168 (3%)

Query: 33  VSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCR---DAITKTSLGYAYVNFNDHDAA 89
           +S ++YVG+LD  V+++ LY++F   G +S I+  +   D        YA++ F + D  
Sbjct: 1   MSNTVYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVNDDVD 60

Query: 90  KTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAG-NIFIKNLHPDIDNKALYDTFSVFGN 148
                  N   + GK  ++  S + P       G  +F+KNL   ID   L + F +FG 
Sbjct: 61  YVCKLFDNRVSLYGKPLKVRRSNKQPETTDFDVGAKLFVKNLDESIDVPQLSNIFKIFGK 120

Query: 149 ILSS-KVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
           +L   +V   + G  +   YV F            LN   L  + IY+
Sbjct: 121 LLRKPEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIYI 167

 Score = 33.1 bits (74), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 9/86 (10%)

Query: 33  VSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRD----AITKTSLGYAYVNFNDHDA 88
           V A L+V +LD S+    L +IF   G     ++ R      +   +L  AYV F     
Sbjct: 93  VGAKLFVKNLDESIDVPQLSNIFKIFG-----KLLRKPEVFYLQNGTLRCAYVWFTTFKH 147

Query: 89  AKTAIEKLNFTPIKGKLCRIMWSQRD 114
           +  A+++LN T +  KL  I ++ +D
Sbjct: 148 SDEALQQLNETNLANKLIYIDYAYKD 173

>CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 380

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 104/219 (47%), Gaps = 30/219 (13%)

Query: 200 SKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEG------ 253
           S KE ES  ++ + N   V+I N++ +TT ++    +   GKT    +E T E       
Sbjct: 99  SAKESESSVKDSRKN--GVWIGNLSFDTTKEDITRFIV--GKTKGTDVEITEEDLVRVNM 154

Query: 254 ----------ENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKK 303
                     +NKGF +V+F   E  V+   +L+ ++  G+ L +  + K YE       
Sbjct: 155 PLAKNDGKQIKNKGFCYVDFKTQE-QVEAAIKLSESQLNGRNLLIKNS-KSYE------G 206

Query: 304 QYEATRMEKMAKYQGIN-LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMT-TENGKSKGF 361
           + + T +  M+K      LF+ NL     D+ L + F   G I   ++ T  ++GK KGF
Sbjct: 207 RPDKTDLVSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGF 266

Query: 362 GFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVR 400
            FV F   E AT A+ +K+ + +AG+PL +   + +  R
Sbjct: 267 AFVDFKNEEGATNALKDKSCRKIAGRPLRMEFGEDRSKR 305

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (48%), Gaps = 12/105 (11%)

Query: 77  GYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQR---DP------SLRKKGAGNI-F 126
           G+ YV+F   +  + AI KL+ + + G+   I  S+     P      S+ K     I F
Sbjct: 168 GFCYVDFKTQEQVEAAI-KLSESQLNGRNLLIKNSKSYEGRPDKTDLVSMSKNPPSRILF 226

Query: 127 IKNLHPDIDNKALYDTFSVFGNILSSKVAT-DETGKSKGFGYVHF 170
           + NL  D  ++ L   F   G I+  ++AT  ++GK KGF +V F
Sbjct: 227 VGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDF 271

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           S  L+VG+L    ++  L   F   G +  IR+     +    G+A+V+F + + A  A+
Sbjct: 222 SRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNAL 281

Query: 94  EKLNFTPIKGKLCRIMWSQ 112
           +  +   I G+  R+ + +
Sbjct: 282 KDKSCRKIAGRPLRMEFGE 300

>Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement
          Length = 464

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 95/201 (47%), Gaps = 13/201 (6%)

Query: 196 GPHLSKKERESKFEE-MKANFTN-VYIKNINTETTDKEFEELVAKFG---KTDSVVLERT 250
           GP L++ E +S +EE M  N++N +++ N+  +   ++ +E  ++ G   + D +    T
Sbjct: 141 GPRLAR-ELDSTYEEKMNRNYSNSIFVGNLTYDCQPEDLKEYFSQIGEVVRADII----T 195

Query: 251 PEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRM 310
             G ++G G V F N +D  + +   + +    + ++V +     E    ++      R 
Sbjct: 196 SRGHHRGMGTVEFTNADDVDEAIRRFDGSTLLDREIFVRQDNPPPE---SMRAPPRERRP 252

Query: 311 EKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPE 370
              A   G  +FI NL  S++ + L++ F   G +  A V    +G S+G+G V + T E
Sbjct: 253 RIQASAPGYEVFIANLPYSVNWQALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKE 312

Query: 371 EATKAITEKNQQIVAGKPLYV 391
           E   AI   N   + G+ L V
Sbjct: 313 EVQVAIERYNGYELEGRVLDV 333

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 122/319 (38%), Gaps = 55/319 (17%)

Query: 17  LQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTS- 75
           L  + + T EE  +   S S++VG+L        L + FS IG V    V  D IT    
Sbjct: 144 LARELDSTYEEKMNRNYSNSIFVGNLTYDCQPEDLKEYFSQIGEV----VRADIITSRGH 199

Query: 76  -LGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDP--------------SLRKK 120
             G   V F + D    AI + + + +  +   I   Q +P               ++  
Sbjct: 200 HRGMGTVEFTNADDVDEAIRRFDGSTLLDR--EIFVRQDNPPPESMRAPPRERRPRIQAS 257

Query: 121 GAG-NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXX 179
             G  +FI NL   ++ +AL D F   G++L + V  D  G S+G+G V++         
Sbjct: 258 APGYEVFIANLPYSVNWQALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVA 317

Query: 180 XXXLNGMLLNGQEIYV-----GP--------------------HLSKKERES---KFEEM 211
               NG  L G+ + V     GP                      + +  ES   +F EM
Sbjct: 318 IERYNGYELEGRVLDVHEGKLGPASEHQQQQEQFQPQDDEPVLDFAPQIHESLNTEFTEM 377

Query: 212 KAN----FTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHE 267
                   + +++ N+   T   +  +L    GK +   L+    G+  G   V + N  
Sbjct: 378 ATGGGDQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPA 437

Query: 268 DAVKCVEELNNTEFKGQPL 286
           DA  C+  LN+  + G+ L
Sbjct: 438 DAEVCISRLNSYNYGGRDL 456

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/318 (20%), Positives = 120/318 (37%), Gaps = 30/318 (9%)

Query: 104 KLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSK 163
           +L R + S  +  + +  + +IF+ NL  D   + L + FS  G ++ + + T   G  +
Sbjct: 143 RLARELDSTYEEKMNRNYSNSIFVGNLTYDCQPEDLKEYFSQIGEVVRADIIT-SRGHHR 201

Query: 164 GFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVG-----PHLSKKERESKFEEMKANF--T 216
           G G V F             +G  L  +EI+V      P   +     +   ++A+    
Sbjct: 202 GMGTVEFTNADDVDEAIRRFDGSTLLDREIFVRQDNPPPESMRAPPRERRPRIQASAPGY 261

Query: 217 NVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEEL 276
            V+I N+      +  +++  + G      ++   +G ++G+G V +   E+    +E  
Sbjct: 262 EVFIANLPYSVNWQALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIERY 321

Query: 277 NNTEFKGQPLYVNRAQK----------------------KYERQQELKKQYEATRMEKMA 314
           N  E +G+ L V+  +                        +  Q       E T M    
Sbjct: 322 NGYELEGRVLDVHEGKLGPASEHQQQQEQFQPQDDEPVLDFAPQIHESLNTEFTEMATGG 381

Query: 315 KYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATK 374
             Q   +F+ NL  S     L + F   G +  A++    NGK  G   V +  P +A  
Sbjct: 382 GDQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEV 441

Query: 375 AITEKNQQIVAGKPLYVA 392
            I+  N     G+ L ++
Sbjct: 442 CISRLNSYNYGGRDLDIS 459

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 48/95 (50%), Gaps = 1/95 (1%)

Query: 297 RQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENG 356
           R   L ++ ++T  EKM +    ++F+ NL      + L+E F+  G +  A ++T+  G
Sbjct: 140 RGPRLARELDSTYEEKMNRNYSNSIFVGNLTYDCQPEDLKEYFSQIGEVVRADIITSR-G 198

Query: 357 KSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
             +G G V F+  ++  +AI   +   +  + ++V
Sbjct: 199 HHRGMGTVEFTNADDVDEAIRRFDGSTLLDREIFV 233

>Sklu_2085.2 YOR319W, Contig c2085 3158-3787
          Length = 209

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 60/119 (50%), Gaps = 6/119 (5%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
            +LY+G++DP+V++  LY++F  +  +S IR  RD I  T  GYA++ F   + A   ++
Sbjct: 10  TTLYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVK 69

Query: 95  KLNFT------PIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFG 147
            +N T       +K +      +   PS   +    +F+KNL   +D  AL   F  FG
Sbjct: 70  VMNNTVQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLDDLVDVAALAKIFGKFG 128

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 78/184 (42%), Gaps = 19/184 (10%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGE----NKGFGFVNFVNHEDAVK 271
           T +YI NI+   T     EL  +      +   R P  +    ++G+ F+ F   EDA  
Sbjct: 10  TTLYIGNIDPNVTKDLLYELFIQVSPISKI---RYPRDKILDTHQGYAFIEFFTKEDADY 66

Query: 272 CVEELNNT-EFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSI 330
            V+ +NNT +   + L V RA       Q   K  E           G  LF+KNLDD +
Sbjct: 67  VVKVMNNTVQLYNRTLKVRRANSNTAASQP-SKHVEI----------GAKLFVKNLDDLV 115

Query: 331 DDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 390
           D   L + F  +G  +    +           ++ ++T +++ +A+ + N QIV  + + 
Sbjct: 116 DVAALAKIFGKFGPFSKQPEIFHVKQADYKCAYIYYTTFDDSDQALAKLNNQIVFNRSIS 175

Query: 391 VAIA 394
           V  A
Sbjct: 176 VDYA 179

>YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylated
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           [1605 bp, 534 aa]
          Length = 534

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 73/138 (52%), Gaps = 5/138 (3%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           S  +++G L+   +E +L + F   G V+ +++ +D  T  S G+ +++F    +    +
Sbjct: 158 SCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVV 217

Query: 94  EKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSK 153
           +  +   + GK+  I   +  P   +   G IF+  + PD+  K   + FS +G I+ ++
Sbjct: 218 KTQHI--LDGKV--IDPKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 273

Query: 154 VATD-ETGKSKGFGYVHF 170
           +  D +TG+S+GFG+V +
Sbjct: 274 LMLDKDTGQSRGFGFVTY 291

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 88/183 (48%), Gaps = 30/183 (16%)

Query: 205 ESKFEEMKANFTN----VYIKNINTETTDKEFEELVAKFGK-TDSVVLERTPEGENKGFG 259
           ++K E  KA+ +     ++I  +N +TT+    E   K+G  TD  +++    G ++GFG
Sbjct: 144 QTKEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFG 203

Query: 260 FVNFVNHEDAVKCVEELNNTE--FKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQ 317
           F++F    +    V+E+  T+    G+ +   RA  + E+ +  K               
Sbjct: 204 FLSF----EKPSSVDEVVKTQHILDGKVIDPKRAIPRDEQDKTGK--------------- 244

Query: 318 GINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTEN-GKSKGFGFVCFSTPEEATKAI 376
              +F+  +   +  K+ EE F+ +GTI  A++M  ++ G+S+GFGFV + + +   +  
Sbjct: 245 ---IFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVC 301

Query: 377 TEK 379
             K
Sbjct: 302 QNK 304

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTT-ENGKSKGFGFVCFSTPEEATKAITEK 379
           +FI  L+    +  L E F  YGT+T  K+M     G+S+GFGF+ F  P    + +  K
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVV--K 218

Query: 380 NQQIVAGK 387
            Q I+ GK
Sbjct: 219 TQHILDGK 226

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 26/56 (46%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAA 89
           +  ++VG + P V      + FS  G +   ++  D  T  S G+ +V ++  DA 
Sbjct: 242 TGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAV 297

>Kwal_23.3985
          Length = 876

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 90/200 (45%), Gaps = 11/200 (5%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGK------SKGFGYVHFXXXXXXX 177
           +IF+KNL+     K L + F  FG  + ++V T    K      S GFG+  F       
Sbjct: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709

Query: 178 XXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVA 237
                ++G +L+G  I +     +  + S   + K     + +KN+  E   K+  EL +
Sbjct: 710 AVIDAMDGAVLDGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFELFS 769

Query: 238 KFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYER 297
            FG+  SV L +  +   +GF FV F+  ++A   +E+L      G+ L +  A+++ + 
Sbjct: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQD 829

Query: 298 QQELKKQYEATRMEKMAKYQ 317
            +E     +  RM K  + Q
Sbjct: 830 AEE-----QIARMTKKVRSQ 844

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 103/436 (23%), Positives = 175/436 (40%), Gaps = 74/436 (16%)

Query: 18  QDKQEGTNEENQSETVSAS--LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTS 75
           + K + T EE   + + A+  L++ ++  + +E     +F+P G +  + V  D  T  S
Sbjct: 314 ESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKS 373

Query: 76  LGYAYVNF-NDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDI 134
            G+AYV F N  DAA   +E L+    +G+L  I+  ++  S R        +KNL P  
Sbjct: 374 KGFAYVMFKNPGDAANAYVE-LDKQIFQGRLLHILPGEQKKSHR---LDEFDLKNL-PLK 428

Query: 135 DNKAL-------YDTF---SVFGN---ILSSKVATDETGKSKGFGYVHFXXXXXXXXXXX 181
             ++L       +DTF   S++ N   +L S  A     KS                   
Sbjct: 429 KQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAAKLGVQKSDLIDATDASAAVKQALAEA 488

Query: 182 XLNGMLLNGQEIYVGPHLSKKERESKFEEMKA----NFTNVYIKNINTETTDKEFEELVA 237
            + G +    E       SK    +KFE+ K+    + T + +KN    TT  E  +L  
Sbjct: 489 HVIGDVRKYFE-------SKGMDLTKFEQFKSPSDRDDTVLLVKNFPFGTTHSELADLFL 541

Query: 238 KFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK-YE 296
            FGK   ++L   P  +      V + +   A     +L+   FK   LY+ +  K  + 
Sbjct: 542 PFGKLQRLLL---PPAQT--IAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGPKNCFS 596

Query: 297 RQ-------------------------QELKKQYEATRMEKMAKYQ-----GINLFIKNL 326
           R+                          E+ +   A++ E            +++F+KNL
Sbjct: 597 REPEGDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPEDDGTDDVVDGPTVSIFVKNL 656

Query: 327 DDSIDDKKLEEEFAPYGTITSAKVMTTENGK------SKGFGFVCFSTPEEATKAITEKN 380
           + S   K+L E+F  +G    A+V T  + K      S GFGF  F T E+A   I   +
Sbjct: 657 NFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMD 716

Query: 381 QQIVAGKPLYVAIAQR 396
             ++ G  + + ++ R
Sbjct: 717 GAVLDGHRIQLKLSHR 732

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 93/212 (43%), Gaps = 16/212 (7%)

Query: 190 GQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLER 249
           G EI      SK E +   + +     ++++KN+N  TT KE  E    FG      ++ 
Sbjct: 623 GDEIMQTATASKPEDDGTDDVVDGPTVSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKT 682

Query: 250 TPEGENK------GFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKK 303
            P+ +N       GFGF  F   E A+  ++ ++     G     +R Q K        +
Sbjct: 683 KPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDG-----HRIQLKLSH-----R 732

Query: 304 QYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGF 363
           Q   +     +K     + +KNL   ++ K++ E F+ +G + S ++    +  ++GF F
Sbjct: 733 QGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAF 792

Query: 364 VCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 395
           V F  P+EA  A+ +     + G+ L +  A+
Sbjct: 793 VEFLLPKEAENAMEQLQGVHLLGRRLVMQHAE 824

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKV-MTTENGKSKGFGFVCFSTPEEATKAITEK 379
           LF++N+  +  +    + FAP+G +    V + T  GKSKGF +V F  P +A  A  E 
Sbjct: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394

Query: 380 NQQIVAGKPLYVAIAQRKDVRR 401
           ++QI  G+ L++   ++K   R
Sbjct: 395 DKQIFQGRLLHILPGEQKKSHR 416

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 92/213 (43%), Gaps = 18/213 (8%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIG--AVSSIRVCRD---AITKTSLGYAYVNFNDHDA 88
           + S++V +L+ S +   L + F   G   V+ ++   D   +    S+G+ +  F   + 
Sbjct: 648 TVSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQ 707

Query: 89  AKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGN------IFIKNLHPDIDNKALYDT 142
           A   I+ ++   + G   ++  S R          +      I +KNL  +++ K +++ 
Sbjct: 708 ALAVIDAMDGAVLDGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFEL 767

Query: 143 FSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKK 202
           FS FG + S ++       ++GF +V F            L G+ L G+ + V  H  ++
Sbjct: 768 FSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRL-VMQHAEEE 826

Query: 203 ERESKFEEMKANFTNVYIKNINTETTDKEFEEL 235
            +++  EE  A  T    K + ++ T +E   L
Sbjct: 827 PQDA--EEQIARMT----KKVRSQVTTREHAAL 853

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 29/52 (55%)

Query: 344 TITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 395
           ++T  K++    G+S+ F FV F + E+A  A+   +Q  +    + V++A+
Sbjct: 38  SLTDVKILKNRAGESRRFAFVGFKSEEDAFDAVNYFDQSFIDTSKIEVSMAK 89

>Scas_665.4
          Length = 219

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 79/177 (44%), Gaps = 17/177 (9%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
            ++YVG++DP V++  LY++F  +  +S +R  +D I +   GYA++ F      +  I+
Sbjct: 10  TTVYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQ 69

Query: 95  KLNFT-PIKGKLCRIMWSQRDPSLRKKGA--------------GNIFIKNLHPDIDNKAL 139
            +N T  +  +  ++  S ++P+    GA                +F+KNL   I+N  L
Sbjct: 70  VMNNTVALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLDESIENPQL 129

Query: 140 YDTFSVFGNILSS-KVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
              F  FG +    ++     GK +   Y++F            LN  L+  + I V
Sbjct: 130 IKLFQKFGPLFKDPEIFFLSNGKLRC-AYIYFKFYENSDMAIAKLNNELIVNKRINV 185

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 85/187 (45%), Gaps = 16/187 (8%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGE----NKGFGFVNFVNHEDAVK 271
           T VY+ NI+ + T ++  EL   F +   +   R P+ +    ++G+ F+ F   +D   
Sbjct: 10  TTVYVGNIDPKVTKEQLYEL---FIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQY 66

Query: 272 CVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGI---NLFIKNLDD 328
            ++ +NNT      LY    + +   Q        A   E   +   +    LF+KNLD+
Sbjct: 67  VIQVMNNT----VALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLDE 122

Query: 329 SIDDKKLEEEFAPYGTI-TSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK 387
           SI++ +L + F  +G +    ++    NGK +   ++ F   E +  AI + N +++  K
Sbjct: 123 SIENPQLIKLFQKFGPLFKDPEIFFLSNGKLRC-AYIYFKFYENSDMAIAKLNNELIVNK 181

Query: 388 PLYVAIA 394
            + V  A
Sbjct: 182 RINVDYA 188

>YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with
           similarity to Rlf6p, contains three RNA recognition
           motif (RRM) domains [1290 bp, 429 aa]
          Length = 429

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 76/312 (24%), Positives = 116/312 (37%), Gaps = 46/312 (14%)

Query: 22  EGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTS--LGYA 79
           + T EE  +   S S++VG+L    +   L + FS IG V    V  D IT      G  
Sbjct: 123 DSTYEEKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKV----VRADIITSRGHHRGMG 178

Query: 80  YVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDP---------------SLR-KKGAG 123
            V F + D    AI + +      +  +I   Q +P                LR  +   
Sbjct: 179 TVEFTNSDDVDRAIRQYDGAFFMDR--KIFVRQDNPPPSNNIKERKALDRGELRHNRKTH 236

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXL 183
            + +KNL   ++ +AL D F   GN+  + V  D  G S G G V F             
Sbjct: 237 EVIVKNLPASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKY 296

Query: 184 NGMLLNGQEIYV-----------GPHLSKKERESKFEEMKANFTN-----------VYIK 221
           NG  + G  + V           G  +     +S   E    FT            +Y  
Sbjct: 297 NGYSIEGNVLDVKSKESVHNHSDGDDVDIPMDDSPVNEEARKFTENVVGGGERNRLIYCS 356

Query: 222 NINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEF 281
           N+   T   +  +L    GK ++  L    +G   G   V + N +DA  C+E LNN  +
Sbjct: 357 NLPFSTAKSDLYDLFETIGKVNNAELRYDSKGAPTGIAVVEYDNVDDADVCIERLNNYNY 416

Query: 282 KGQPLYVNRAQK 293
            G  L ++ A++
Sbjct: 417 GGCDLDISYAKR 428

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 54/116 (46%), Gaps = 10/116 (8%)

Query: 301 LKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKG 360
           L ++ ++T  EK+ +    ++F+ NL      + L E F+  G +  A ++T+  G  +G
Sbjct: 118 LARELDSTYEEKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSR-GHHRG 176

Query: 361 FGFVCFSTPEEATKAITEKNQQIVAGKPLYVA---------IAQRKDVRRSQLAQQ 407
            G V F+  ++  +AI + +      + ++V          I +RK + R +L   
Sbjct: 177 MGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHN 232

>ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH]
           complement(287620..288234) [615 bp, 204 aa]
          Length = 204

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 76/165 (46%), Gaps = 5/165 (3%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
            ++YVG+LDP VS+  LY++F  +  VS IR  +D + +   G+A+V          AI+
Sbjct: 7   CTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCDFAIK 66

Query: 95  KLNFT-PIKGKLCRIMWSQRDP--SLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILS 151
            LN T  + GK+ ++  +  +   S        +F+KNL   ID   L   F  FG +  
Sbjct: 67  SLNNTVSLFGKVLKVRRTLENAKNSAPVFARAKLFVKNLDSTIDAVQLQKLFGKFGPLAK 126

Query: 152 -SKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
             ++ T + G  +   YV+F            LN  ++  Q I +
Sbjct: 127 PPQLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISI 170

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 80/184 (43%), Gaps = 22/184 (11%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEG----ENKGFGFVNFVNHEDAVK 271
             VY+ N++ + + +   EL  +      +   R P+     E++GF FV   +  D   
Sbjct: 7   CTVYVGNLDPQVSKELLYELFVQVAPVSRI---RYPKDKVKQEHQGFAFVELFSEADCDF 63

Query: 272 CVEELNNT-EFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSI 330
            ++ LNNT    G+ L V R  +  +    +              +    LF+KNLD +I
Sbjct: 64  AIKSLNNTVSLFGKVLKVRRTLENAKNSAPV--------------FARAKLFVKNLDSTI 109

Query: 331 DDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 390
           D  +L++ F  +G +     + T    +    +V F+T   + +A+ + N QIVA + + 
Sbjct: 110 DAVQLQKLFGKFGPLAKPPQLFTLKDGALRCAYVYFTTFRHSDEALEKLNNQIVANQIIS 169

Query: 391 VAIA 394
           +  A
Sbjct: 170 IDYA 173

>CAGL0F08217g complement(814508..816544) similar to sp|P53316
           Saccharomyces cerevisiae YGR250c, hypothetical start
          Length = 678

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 90/422 (21%), Positives = 154/422 (36%), Gaps = 130/422 (30%)

Query: 102 KGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGK 161
           KG L    WS    +      GN+FI  +  ++    L +TF  FG I S K+  D   K
Sbjct: 120 KGALA--YWSISLNTHALTHPGNLFIGGIPKNMSLNTLMETFDKFGTISSLKILFD--NK 175

Query: 162 SKGFGYVHFXXXXXXXXXXXXLNGMLL---NGQE--IYVGPHLSKKERESKF-------- 208
           + G G++ F            +NG  +   NG E  +++  H+ +KERE  F        
Sbjct: 176 NVGIGFLSFMLGSEAAECIRCMNGTKIRSDNGDEGTLFINYHIERKERERLFLSHESSDS 235

Query: 209 ----------------------EEMKANFTN-----------VYIKNINTETTDK-EFEE 234
                                  E+ +  TN           V+I N+ T+  ++ EF +
Sbjct: 236 SASSLSVRNMRVNTHHRGKHNSPELNSWSTNNSSDDLTINNCVFIGNLPTDIQNEGEFID 295

Query: 235 LVAKFGKTDSVVLERTPEGEN----KGFGFVNFVNHEDAVKCVEELNNT--EFKGQPLYV 288
            + +   + +V+    P   +    KG+GF+   N++ A + + E++    EF G  +  
Sbjct: 296 DLTEAFPSVTVISYYFPYDHSLNQYKGYGFIKLQNNDQARRIIHEISTDCFEFCGNHIIA 355

Query: 289 NRAQKK----------YERQQELKKQYEATRMEKMAKYQG-------------------- 318
           N+A  K          Y +  E   +     +E+ + Y G                    
Sbjct: 356 NKASNKDNKTTSHFTLYTKTTETNPKTRNNYLEQTSPYAGGINTFPPSMNNYTFGYDLYP 415

Query: 319 ------------------------INLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTE 354
                                    N+++K++     DK L   + P+G I S K++T  
Sbjct: 416 PIKRGSHNLPYIYGLPVPLEGQQESNIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVG 475

Query: 355 N-----------------GKSKGFGFVCFSTPEEATKAITEKNQQIVAG--KPLYVAIAQ 395
                             G S+G+GFV F+ P +A  AI   +   + G  + L V+ AQ
Sbjct: 476 GSSREEKSTNSSDEDLPFGISRGYGFVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQ 535

Query: 396 RK 397
           +K
Sbjct: 536 KK 537

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 63/138 (45%), Gaps = 20/138 (14%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVAT--------------DET---GKSKGFG 166
           NI++K++  D  +K L++ +  FGNI+S K+ T              DE    G S+G+G
Sbjct: 441 NIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGYG 500

Query: 167 YVHFXXXXXXXXXXXXLNGMLLNG--QEIYVG-PHLSKKERESKFEEMKANFTNVYIKNI 223
           +V+F             +G  L G  Q++ V      KK+ +S  +E  +N ++  I N 
Sbjct: 501 FVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQKKKKDGQSLLDESLSNESSDQIDNS 560

Query: 224 NTETTDKEFEELVAKFGK 241
                 ++     AKFG+
Sbjct: 561 EKTNEKEKRNHSSAKFGQ 578

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 46/105 (43%), Gaps = 19/105 (18%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVL-----------------ERTPEGENKGF 258
           +N+Y+K++  + +DK+       FG   S  +                 E  P G ++G+
Sbjct: 440 SNIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGY 499

Query: 259 GFVNFVNHEDAVKCVEELNNTEFKG--QPLYVNRAQKKYERQQEL 301
           GFV F N  DA   +   +    +G  Q L V+ AQKK +  Q L
Sbjct: 500 GFVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQKKKKDGQSL 544

 Score = 36.2 bits (82), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 6/111 (5%)

Query: 270 VKCVEELNNTEFKGQPLYVNRAQK-KYERQQELKK---QYEATRMEKMAKYQGINLFIKN 325
           ++  E +   +FK  P   N  +K K   ++E +K    Y +  +   A     NLFI  
Sbjct: 86  IESYERVIQFQFKHMPNLKNCLKKVKAILKEEFEKGALAYWSISLNTHALTHPGNLFIGG 145

Query: 326 LDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAI 376
           +  ++    L E F  +GTI+S K++   + K+ G GF+ F    EA + I
Sbjct: 146 IPKNMSLNTLMETFDKFGTISSLKILF--DNKNVGIGFLSFMLGSEAAECI 194

>Kwal_27.11832
          Length = 686

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 90/195 (46%), Gaps = 13/195 (6%)

Query: 214 NFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCV 273
           +   +++++I  + TD+E     +        V+ +  +  ++GFGFV+F   +D    +
Sbjct: 19  DMKTLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDAL 78

Query: 274 EELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGI---------NLFIK 324
           ++   T+FKG+ L V+ A++   R +  K Q  A   E  +  Q            L ++
Sbjct: 79  DKARKTKFKGRLLRVDIAKR---RDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVR 135

Query: 325 NLDDSIDD-KKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQI 383
           N+  S+ +  +L++ F  YGT+  AK+    +GK  GF FV          AI E     
Sbjct: 136 NMPWSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLK 195

Query: 384 VAGKPLYVAIAQRKD 398
           + G+ + V  A +K+
Sbjct: 196 IGGRQVAVDFAVQKN 210

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 72/183 (39%), Gaps = 24/183 (13%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           +L+V  +    ++  L + FS +  +    + +D   K S G+ +V+F   D  K A++K
Sbjct: 22  TLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDD-QKNSRGFGFVSFAVEDDTKDALDK 80

Query: 96  LNFTPIKGKLCRIMWSQRDPSLRKK----------------------GAGNIFIKNLHPD 133
              T  KG+L R+  ++R    +K                       G   + ++N+   
Sbjct: 81  ARKTKFKGRLLRVDIAKRRDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVRNMPWS 140

Query: 134 IDN-KALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQE 192
           + N   L   F  +G ++ +K+     GK  GF +V                 + + G++
Sbjct: 141 VRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLKIGGRQ 200

Query: 193 IYV 195
           + V
Sbjct: 201 VAV 203

>YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein with
           similarity to Pab1p, Pub1p, Nsr1p, Nop4p and other
           RNA-binding proteins, contains multiple RNA-binding
           domains, is required for 35S rRNA processing [2664 bp,
           887 aa]
          Length = 887

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 88/174 (50%), Gaps = 11/174 (6%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD----ETGK--SKGFGYVHFXXXXXXX 177
           +IFIKNL+    N+ L D F VF   + ++V T       GK  S GFG+V F       
Sbjct: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723

Query: 178 XXXXXLNGMLLNGQEIYVGPHLSKKE-RESKFEEMKANFTN--VYIKNINTETTDKEFEE 234
                ++G +++G +I +   LS ++  +S   + K+N  +  + +KN+  E T K+  E
Sbjct: 724 AVIAAMDGTVIDGHKIQL--KLSHRQASQSGNTKTKSNKKSGKIIVKNLPFEATRKDVFE 781

Query: 235 LVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYV 288
           L   FG+  SV + +  +   +GF FV F+  ++A   +++L+     G+ L +
Sbjct: 782 LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVM 835

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 86/193 (44%), Gaps = 15/193 (7%)

Query: 18  QDKQEGTNEENQSETV---SASLYVGDLDPSVSEAHLYDIFSPIG--AVSSIRVCRDAIT 72
           +D  EG++  +  + +   + S+++ +L+ S +  +L D F       V+ ++   D   
Sbjct: 643 KDVTEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKH 702

Query: 73  K---TSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLR-------KKGA 122
           +    S+G+ +V F   + A   I  ++ T I G   ++  S R  S          K +
Sbjct: 703 QGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKTKSNKKS 762

Query: 123 GNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXX 182
           G I +KNL  +   K +++ F+ FG + S +V       ++GF +V F            
Sbjct: 763 GKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQ 822

Query: 183 LNGMLLNGQEIYV 195
           L+G+ L G+ + +
Sbjct: 823 LHGVHLLGRRLVM 835

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKV-MTTENGKSKGFGFVCFSTPEEATKAITEK 379
           LF++N+  +  ++   + F+P+G +    V + T  G+SKGF +V F   + A  A  E 
Sbjct: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406

Query: 380 NQQIVAGKPLYVAIAQRKDVRR 401
           ++QI  G+ L++   + K   R
Sbjct: 407 DKQIFQGRLLHILPGEEKKSHR 428

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 80/182 (43%), Gaps = 15/182 (8%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKG------FGFVNFVNHEDA 269
            +++IKN+N  TT++   +    F       ++  P+ +++G      FGFV F   E A
Sbjct: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722

Query: 270 VKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDS 329
              +  ++ T   G  + +  + ++  +    K         K  K  G  + +KNL   
Sbjct: 723 NAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKT--------KSNKKSG-KIIVKNLPFE 773

Query: 330 IDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
              K + E F  +G + S +V    +  ++GF FV F  P+EA  A+ + +   + G+ L
Sbjct: 774 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833

Query: 390 YV 391
            +
Sbjct: 834 VM 835

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 60/107 (56%), Gaps = 15/107 (14%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSV-VLERTPEGENKGFGFVNFVNHEDAVKCVEEL 276
           ++++NI   + +++F +L + FG+ + V V   T  G++KGF +V F + ++AV    EL
Sbjct: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406

Query: 277 NNTEFKGQPLYVNRAQKK--------------YERQQELKKQYEATR 309
           +   F+G+ L++   ++K               ++Q+ELK++  A+R
Sbjct: 407 DKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASR 453

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 6/85 (7%)

Query: 319 INLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGK------SKGFGFVCFSTPEEA 372
           +++FIKNL+ S  ++ L + F  +     A+V T  + K      S GFGFV F T E+A
Sbjct: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722

Query: 373 TKAITEKNQQIVAGKPLYVAIAQRK 397
              I   +  ++ G  + + ++ R+
Sbjct: 723 NAVIAAMDGTVIDGHKIQLKLSHRQ 747

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 2/97 (2%)

Query: 24  TNEENQSETV--SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYV 81
           T+EE   E +  +  L++ ++  +  E     +FSP G +  + V  D  T  S G+AYV
Sbjct: 332 TDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYV 391

Query: 82  NFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLR 118
            F D   A  A  +L+    +G+L  I+  +   S R
Sbjct: 392 LFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSHR 428

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

Query: 122 AGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXX 180
            G +F++N+      +     FS FG +    VA D  TG+SKGF YV F          
Sbjct: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403

Query: 181 XXLNGMLLNGQEIYVGPHLSKK 202
             L+  +  G+ +++ P   KK
Sbjct: 404 VELDKQIFQGRLLHILPGEEKK 425

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 28/51 (54%)

Query: 345 ITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 395
           IT  K++   NG+S+ FGF+ +   E+A  A+   N   +    + V++A+
Sbjct: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 242 TDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQ 292
           TD  +L R   GE++ FGF+ + N EDA   VE  N +      + V+ A+
Sbjct: 44  TDVKIL-RDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93

>YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated
           protein, essential for meiotic recombination, suppressor
           of mitochondrial splicing defects, has 3 RNA recognition
           (RRM) domains [1572 bp, 523 aa]
          Length = 523

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 88/407 (21%), Positives = 158/407 (38%), Gaps = 84/407 (20%)

Query: 32  TVSASLYVGDLDPSVSEAHLYDIFSPIG-AVSSIRVCRDAI----TKTSLG------YAY 80
           T    LY+GDLDP+  +  +  I++ +G A  ++R+  +      +++S+G      Y +
Sbjct: 51  TTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCF 110

Query: 81  VNFNDHDAAKTAIEK--LNFTPIKGKLCRIMWS--------QRDPSLRKKGAGNIFIKNL 130
           V+F     A  A+ K  +       K  ++ W+            +++     +IF+ +L
Sbjct: 111 VDFPSSTHAANALLKNGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFVGDL 170

Query: 131 HPDIDNKALYDTF-SVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXLNGMLL 188
            P++    L++ F + + +   +K+  D+ TG SKG+G+V F            + G+ L
Sbjct: 171 APNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFL 230

Query: 189 NGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLE 248
           NG+ I VGP   +++  S   +      N    ++N E  D  F                
Sbjct: 231 NGRAIKVGPTSGQQQHVSGNNDY-----NRSSSSLNNENVDSRFLS-------------- 271

Query: 249 RTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEAT 308
                  KG  F++  N           NN  FK   +    +Q  Y  QQ+        
Sbjct: 272 -------KGQSFLSNGN-----------NNMGFKRNHM----SQFIYPVQQQ-------P 302

Query: 309 RMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFST 368
            +          +FI  L   + + +L   F P+GTI   K+        K  GFV +  
Sbjct: 303 SLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPV-----GKCCGFVQYVD 357

Query: 369 PEEATKAITEKNQQIVAGKPLY---VAIAQRKDVRRSQLAQQIQARN 412
              A  AI       + G P+    V ++  +  +++ L QQ    N
Sbjct: 358 RLSAEAAIAG-----MQGFPIANSRVRLSWGRSAKQTALLQQAMLSN 399

>YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein and
           pre-mRNA splicing factor with similarity to human SAP49,
           has 2 RNA recognition (RRM) domains [642 bp, 213 aa]
          Length = 213

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 82/180 (45%), Gaps = 13/180 (7%)

Query: 28  NQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHD 87
           N S     ++YVG++DP +++  LY++F  I  V  I+  +D + +   GYA++ F +  
Sbjct: 2   NYSADSGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQG 61

Query: 88  AAKTAIEKLNFTP-IKGKLCRI------MWSQRDPSLRKKG----AGNIFIKNLHPDIDN 136
            A+ AI+ +N T  +  +L ++        +   PS   K        +FIKNL   ID+
Sbjct: 62  DAQYAIKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDS 121

Query: 137 KALYDTFSVFGNILSS-KVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
             L   F+ FG ++   ++     GK K   YV+F            LN  L+    I V
Sbjct: 122 DQLVKIFNKFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITV 180

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 81/182 (44%), Gaps = 14/182 (7%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGE----NKGFGFVNFVNHEDAVKCV 273
           VY+ NI+   T ++  EL   F + + V+  + P+ +     +G+ F+ F N  DA   +
Sbjct: 11  VYVGNIDPRITKEQLYEL---FIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAI 67

Query: 274 EELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDK 333
           + +NNT      L   R          L        +  +AK     LFIKNL DSID  
Sbjct: 68  KIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAK-----LFIKNLADSIDSD 122

Query: 334 KLEEEFAPYG-TITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 392
           +L + F  +G  I   ++    NGK K   +V F   E+A  AI   N Q+VA   + V 
Sbjct: 123 QLVKIFNKFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITVD 181

Query: 393 IA 394
            A
Sbjct: 182 YA 183

>Scas_157.1
          Length = 232

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 83/171 (48%), Gaps = 8/171 (4%)

Query: 32  TVSASLYVGDLDPSVSEAHLYDIFSPIGAVS-SIRVCRDAITKTSLGYAYVNFNDHDAAK 90
           T S+ LY+GDLDP+  E  +  I+  +G  +  +++  ++    + GY +V F   +   
Sbjct: 44  TGSSQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPSMEHGN 103

Query: 91  TAIEKLNFTPIKG---KLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTF-SVF 146
            A+ K N   I G   +  ++ W+    +    G  ++F+ +L P++    L++ F   +
Sbjct: 104 NALLK-NGIVIPGFPQRRLKLNWASAGANGNNSGF-SVFVGDLSPNVTEAQLFELFIGRY 161

Query: 147 GNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVG 196
            +   +KV  D+ TG SK +G+V F            + G+ LNG+ I VG
Sbjct: 162 PSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKVG 212

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 9/97 (9%)

Query: 15  LSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIG---AVSSIRVCRDAI 71
           L L     G N  N   +V    +VGDL P+V+EA L+++F  IG   +    +V  D +
Sbjct: 121 LKLNWASAGANGNNSGFSV----FVGDLSPNVTEAQLFELF--IGRYPSTCHAKVVHDQL 174

Query: 72  TKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRI 108
           T  S  Y +V FN     +  + ++    + G+  ++
Sbjct: 175 TGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKV 211

>YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein
           required for ribosome biogenesis, contains three
           canonical RNA recognition motif (RRM) domains and one
           degenerate RNA recognition motif (RRM) domain [2058 bp,
           685 aa]
          Length = 685

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 89/205 (43%), Gaps = 21/205 (10%)

Query: 214 NFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCV 273
           +   +++++I  + TD++  +  + F      V+ +     ++GFGFV+F   +D  + +
Sbjct: 24  DMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEAL 83

Query: 274 EELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGIN------------- 320
            +   T+F G  L V+ A K+ +R ++  +  E +  E   K  G N             
Sbjct: 84  AKARKTKFNGHILRVDIA-KRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSM 142

Query: 321 ------LFIKNLDDSIDDK-KLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEAT 373
                 L I+N+  S  D  KL++ F  YGT+  A +    +GK  GF FV         
Sbjct: 143 LKGKPKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCR 202

Query: 374 KAITEKNQQIVAGKPLYVAIAQRKD 398
            A+       + G+ + V  A +K+
Sbjct: 203 IALENTKDLKIDGRKVAVDFAVQKN 227

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/195 (19%), Positives = 69/195 (35%), Gaps = 36/195 (18%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           +L+V  +   V++  L D FS    +    V +D   K S G+ +V+F   D  K A+ K
Sbjct: 27  TLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT-NKRSRGFGFVSFAVEDDTKEALAK 85

Query: 96  LNFTPIKGKLCRIMWSQRDPSLRK----------------------------------KG 121
              T   G + R+  ++R    +K                                  KG
Sbjct: 86  ARKTKFNGHILRVDIAKRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLKG 145

Query: 122 AGNIFIKNLHPDI-DNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXX 180
              + I+N+     D   L   F  +G ++ + +     GK  GF +V            
Sbjct: 146 KPKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIAL 205

Query: 181 XXLNGMLLNGQEIYV 195
                + ++G+++ V
Sbjct: 206 ENTKDLKIDGRKVAV 220

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 54/312 (17%), Positives = 112/312 (35%), Gaps = 71/312 (22%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +F++++  D+ ++ L D FS F  I  + V  D   +S+GFG+V F              
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKAR 87

Query: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFT---------------------------- 216
               NG  + V     +++R  K  E+    T                            
Sbjct: 88  KTKFNGHILRVDI-AKRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLKGK 146

Query: 217 -NVYIKNINTETTDK-EFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVE 274
             + I+N+     D  + +++  ++G      + R  +G+  GF FV      +    +E
Sbjct: 147 PKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALE 206

Query: 275 ELNNTEFKGQPLYVNRAQKK---------------------------------------Y 295
              + +  G+ + V+ A +K                                        
Sbjct: 207 NTKDLKIDGRKVAVDFAVQKNRWEDYKKAQPEMNDKDDNESGNEDAEENHDDEEDENEEE 266

Query: 296 ERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSA-KVMTTE 354
           +RQ +   + + ++ +   K +  ++F++N+     ++ L   F+ +G++  A  V+   
Sbjct: 267 DRQVDQASKNKESKRKAQNKREDFSVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKS 326

Query: 355 NGKSKGFGFVCF 366
            G +KG  FV F
Sbjct: 327 TGLAKGTAFVAF 338

>Sklu_905.1 YMR268C, Contig c905 196-1743
          Length = 515

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 103/222 (46%), Gaps = 26/222 (11%)

Query: 199 LSKKERESKFEEMKANF---TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE--- 252
           L+K  ++    E+  NF     +++ N    +T +  + L +++G   SV+  R P    
Sbjct: 163 LTKTYKKLNNHEIVVNFLKDATLWVTNFAPNSTVETLKALFSQYG--GSVLSVRLPSLKF 220

Query: 253 GENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEK 312
             N+ F +++F + ++A   + +LNNT   G  L V ++        E  K+ +A  +EK
Sbjct: 221 DSNRRFAYIDFASSDEANTAMSKLNNTSHDGYILVVKKSN-----PHEKSKRTDAATLEK 275

Query: 313 MAKYQGINLFIKNLD-DSIDDKKLEEEFAPYGTITSAKVMTTE-----NGKSKGFGFVCF 366
                   +FI+ LD   +   KL +    YG +    +  +E     N ++ GF FV +
Sbjct: 276 R------EIFIRKLDFYKVSLSKLTKLVEKYGPVERVSMPNSEDSVNSNKQNDGFAFVTY 329

Query: 367 STPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 408
           +  E A KA+ E N  +  G+ L V+IA RK     Q  ++I
Sbjct: 330 TNEESAQKAL-ELNMSVFEGRVLAVSIADRKPYLERQEVKRI 370

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 7/102 (6%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIG-AVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           A+L+V +  P+ +   L  +FS  G +V S+R+       ++  +AY++F   D A TA+
Sbjct: 183 ATLWVTNFAPNSTVETLKALFSQYGGSVLSVRLPSLKF-DSNRRFAYIDFASSDEANTAM 241

Query: 94  EKLNFTPIKGKLCRIMWSQRDPSLRKKGAGN-----IFIKNL 130
            KLN T   G +  +  S      ++  A       IFI+ L
Sbjct: 242 SKLNNTSHDGYILVVKKSNPHEKSKRTDAATLEKREIFIRKL 283

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 77  GYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIF 126
           G+A+V + + ++A+ A+E LN +  +G++  +  + R P L ++    I 
Sbjct: 323 GFAFVTYTNEESAQKALE-LNMSVFEGRVLAVSIADRKPYLERQEVKRIL 371

>KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 589

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 83/173 (47%), Gaps = 12/173 (6%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVS-SIRVCRDAITKTS-----LGYAYVNFNDHD 87
           S  LY+GDL+P  +E  +  I+S +G  +  +++ + +    S      GY +V F +  
Sbjct: 55  STQLYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQM 114

Query: 88  AAKTAIEKLNF-TPIKGKLC-RIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTF-S 144
           AA  A+ K     P+      ++ W+    +        +F+ +L P++    L++ F S
Sbjct: 115 AASNALMKSGLRVPMDSNYALKLNWASF--ATAPGSEFTLFVGDLAPNVTEAQLFELFIS 172

Query: 145 VFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVG 196
            + + L++K+  D+ TG SKG+G+V F            + G  LNG+ I VG
Sbjct: 173 RYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVG 225

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/185 (20%), Positives = 78/185 (42%), Gaps = 11/185 (5%)

Query: 214 NFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCV 273
           N T +Y+ ++N + T+ + + + +  G+ +  V        NK     N      +  C 
Sbjct: 54  NSTQLYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNN------SGYCF 107

Query: 274 EELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDK 333
            E  N       L  +  +   +    LK  + +      +++    LF+ +L  ++ + 
Sbjct: 108 VEFPNQMAASNALMKSGLRVPMDSNYALKLNWASFATAPGSEF---TLFVGDLAPNVTEA 164

Query: 334 KLEEEF-APYGTITSAKVMTTE-NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           +L E F + Y +  +AK++  +  G SKG+GFV F    E  +A+ E     + G+ + V
Sbjct: 165 QLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRV 224

Query: 392 AIAQR 396
               +
Sbjct: 225 GTTSK 229

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/178 (18%), Positives = 78/178 (43%), Gaps = 15/178 (8%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFG--NILSSKVATDETGKS-----KGFGYVHFXXXXXXX 177
           +++ +L+PD     +   +S+ G  N+    + +    KS      G+ +V F       
Sbjct: 58  LYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMAAS 117

Query: 178 XXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKE-FEELV 236
                 N ++ +G  + +  + + K   + F     +   +++ ++    T+ + FE  +
Sbjct: 118 ------NALMKSGLRVPMDSNYALKLNWASFATAPGSEFTLFVGDLAPNVTEAQLFELFI 171

Query: 237 AKFGKT-DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQK 293
           +++  T ++ ++     G +KG+GFV FVN  +  + + E+  T   G+ + V    K
Sbjct: 172 SRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGTTSK 229

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 6/76 (7%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
            ++++G L   ++E  L   F P G +  +++          G  +V + D  +A+TAI 
Sbjct: 316 TTVFIGGLSTLITEDELRSYFQPFGQIVYVKI------PVGKGCGFVQYVDRISAETAIS 369

Query: 95  KLNFTPIKGKLCRIMW 110
           K+   PI     R+ W
Sbjct: 370 KMQGFPIGNSRIRLSW 385

>KLLA0D14949g complement(1259860..1262496) similar to sgd|S0006316
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 878

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 99/208 (47%), Gaps = 20/208 (9%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD----ETGK--SKGFGYVHFXXXXXXX 177
           +IFIKNL+    ++ L + F  F   + ++V T     + GK  S GFG+  F       
Sbjct: 652 SIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQAN 711

Query: 178 XXXXXLNGMLLNGQEIYVGPHLSKKERES----KFEEMKANFTNVYIKNINTETTDKEFE 233
                + G +L+G ++ +   LS ++  S      ++ K N   + +KN+  E T K+  
Sbjct: 712 AVISAMEGTILDGHKLQL--KLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVF 769

Query: 234 ELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPL---YVNR 290
           EL + FG+  SV + +  +   +GF FV F+  ++A   +++L      G+ L   +V +
Sbjct: 770 ELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMEFVEQ 829

Query: 291 AQKKYERQQE-----LKKQYEATRMEKM 313
             +  E+Q E     +KKQ   T++  M
Sbjct: 830 DPEDVEQQIEKMTRKVKKQVNTTKIANM 857

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 56/118 (47%), Gaps = 15/118 (12%)

Query: 296 ERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKV-MTTE 354
           E ++ LKK  E  R           LF++N+  +  +    + F+PYG +    + + T 
Sbjct: 318 EEEKSLKKIRETGR-----------LFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTR 366

Query: 355 NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARN 412
            G+SKGF +V F   + A  A  E ++QI  G+ L++  A   D ++S    +   +N
Sbjct: 367 TGQSKGFAYVLFKNADNAATAFVELDKQIFQGRLLHILPA---DAKKSHKLDEFDLKN 421

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 76/175 (43%), Gaps = 13/175 (7%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIG--AVSSIRVCRDAIT--KT-SLGYAYVNFNDHDA 88
           + S+++ +L+ S +   L + F P     V+ ++   D     KT S+G+ +  F   + 
Sbjct: 650 TVSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQ 709

Query: 89  AKTAIEKLNFTPIKGKLCRIMWSQRDPS--------LRKKGAGNIFIKNLHPDIDNKALY 140
           A   I  +  T + G   ++  S R  +         +KK  G I +KNL  +   K ++
Sbjct: 710 ANAVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVF 769

Query: 141 DTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
           + FS FG + S +V       ++GF +V F            L G+ L G+ + +
Sbjct: 770 ELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 824

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 6/85 (7%)

Query: 319 INLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGK------SKGFGFVCFSTPEEA 372
           +++FIKNL+ S   ++L E+F P+     A+V T  + K      S GFGF  F T E+A
Sbjct: 651 VSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQA 710

Query: 373 TKAITEKNQQIVAGKPLYVAIAQRK 397
              I+     I+ G  L + ++ R+
Sbjct: 711 NAVISAMEGTILDGHKLQLKLSHRQ 735

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 40/76 (52%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           +  L++ ++  + +E     +FSP G +  + +  D  T  S G+AYV F + D A TA 
Sbjct: 329 TGRLFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNADNAATAF 388

Query: 94  EKLNFTPIKGKLCRIM 109
            +L+    +G+L  I+
Sbjct: 389 VELDKQIFQGRLLHIL 404

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 77/187 (41%), Gaps = 14/187 (7%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGE------NKGFGFVNFVNHEDA 269
            +++IKN+N  TT ++  E    F       ++  P+ +      + GFGF  F   E A
Sbjct: 651 VSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQA 710

Query: 270 VKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDS 329
              +  +  T   G  L +  + ++         + +     K        + +KNL   
Sbjct: 711 NAVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGK--------IIVKNLPFE 762

Query: 330 IDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
              K + E F+ +G + S +V    +  ++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 763 ATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 822

Query: 390 YVAIAQR 396
            +   ++
Sbjct: 823 VMEFVEQ 829

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 53/101 (52%), Gaps = 9/101 (8%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSV-VLERTPEGENKGFGFVNFVNHEDAVKCVEEL 276
           ++++NI    T+ +F +L + +G+ + V +   T  G++KGF +V F N ++A     EL
Sbjct: 332 LFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNADNAATAFVEL 391

Query: 277 NNTEFKGQPLYVNRAQKKYERQQE--------LKKQYEATR 309
           +   F+G+ L++  A  K   + +        LKKQ E  R
Sbjct: 392 DKQIFQGRLLHILPADAKKSHKLDEFDLKNLPLKKQRELKR 432

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 2/94 (2%)

Query: 111 SQRDPSLRK-KGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYV 168
           S+ + SL+K +  G +F++N+            FS +G +    +A D  TG+SKGF YV
Sbjct: 317 SEEEKSLKKIRETGRLFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYV 376

Query: 169 HFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKK 202
            F            L+  +  G+ +++ P  +KK
Sbjct: 377 LFKNADNAATAFVELDKQIFQGRLLHILPADAKK 410

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 245 VVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQ 292
           V L +  +GE++ F F+ F + EDA  CV   N T      + V+ A+
Sbjct: 42  VKLMKNRDGESRRFAFIGFRDEEDAFDCVNYFNGTFVDTSKIEVSMAK 89

>CAGL0L12672g complement(1359637..1361685) similar to sp|P37838
           Saccharomyces cerevisiae YPL043w nucleolar protein,
           start by similarity
          Length = 682

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 88/205 (42%), Gaps = 20/205 (9%)

Query: 214 NFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCV 273
           +   +++++I    TD++  +  + F      V+ +    +++GFGFV+F   +D    +
Sbjct: 20  DMKTLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIAL 79

Query: 274 EELNNTEFKGQPLYVNRAQKKYE--RQQELKKQYEATRMEKMAKYQGIN----------- 320
           +E   T+  G  L V+ A+++    + ++   Q E  R      Y   N           
Sbjct: 80  KEARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSL 139

Query: 321 ------LFIKNLDDSIDD-KKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEAT 373
                 L I+N+  S  D  KL++ F  YG +  A +    +GK  GF FV  +      
Sbjct: 140 LKGKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCK 199

Query: 374 KAITEKNQQIVAGKPLYVAIAQRKD 398
           KA+ +     + G+ + V  A +K+
Sbjct: 200 KALEDTKNLTIDGRKVAVDFAVQKN 224

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 85/212 (40%), Gaps = 31/212 (14%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +F++++   + ++ L D FS F  I  + V  D   KS+GFG+V F              
Sbjct: 24  LFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKEAR 83

Query: 185 GMLLNGQEIYVG-----PHLSKKERESKFEEMKANFTNVYIKNINTETTDKE-------- 231
              L+G ++ V          K E +S  +E+  N +     + NTE  +++        
Sbjct: 84  KTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLKGK 143

Query: 232 -----------------FEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVE 274
                             +++  K+G      + R  +G+  GF FV      +  K +E
Sbjct: 144 PKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKALE 203

Query: 275 ELNNTEFKGQPLYVNRAQKKYERQQELKKQYE 306
           +  N    G+ + V+ A +K  + +E K +YE
Sbjct: 204 DTKNLTIDGRKVAVDFAVQK-NKWEEYKTKYE 234

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/216 (20%), Positives = 83/216 (38%), Gaps = 41/216 (18%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           +L+V  +  SV++  L D FS    +    V +D + K S G+ +V+F   D  K A+++
Sbjct: 23  TLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKD-VNKKSRGFGFVSFAVEDDTKIALKE 81

Query: 96  LNFTPIKGKLCRIMWSQR--------DPSLRK---------------------------K 120
              T + G   ++  ++R        D S +K                           K
Sbjct: 82  ARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLK 141

Query: 121 GAGNIFIKNLHPDI-DNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXX 179
           G   + I+N+     D   L   F  +G ++ + +     GK  GF +V           
Sbjct: 142 GKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKA 201

Query: 180 XXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANF 215
                 + ++G+++ V   + K    +K+EE K  +
Sbjct: 202 LEDTKNLTIDGRKVAVDFAVQK----NKWEEYKTKY 233

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHF 170
           ++F++N+  D   ++L+D FS FG +  +    D+ TG +KG  +V F
Sbjct: 291 SVFVRNVPYDATEESLFDHFSKFGPVKYALPVIDKNTGLAKGTAFVAF 338

>Scas_598.1
          Length = 516

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 69/138 (50%), Gaps = 8/138 (5%)

Query: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           L++G L+   +E  L D FS  G V  +++ +D  T  S G+ ++ F    +    ++  
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 261

Query: 97  NFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVA- 155
           +   + GK+  I   +  P   +   G IF+  + PD+  K   + F+ +G I+ +++  
Sbjct: 262 HI--LDGKV--IDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLML 317

Query: 156 ---TDETGKSKGFGYVHF 170
                +TG+S+GFG++ +
Sbjct: 318 LMLDKDTGRSRGFGFITY 335

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 97/212 (45%), Gaps = 38/212 (17%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKT-DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEEL 276
           ++I  +N ETT+ + ++  +K+G   D  +++    G ++GFGF+ F    +    V+E+
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTF----ELSSSVDEV 257

Query: 277 NNTE--FKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKK 334
             T+    G+ +   RA  + E+ +  K                  +F+  +   +  K+
Sbjct: 258 VKTQHILDGKVIDPKRAIPREEQDKTGK------------------IFVGGIGPDVRPKE 299

Query: 335 LEEEFAPYGTITSAKVM----TTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 390
            EE FA +GTI  A++M      + G+S+GFGF+ + +  EA   + +       GK + 
Sbjct: 300 FEEFFAQWGTIIDAQLMLLMLDKDTGRSRGFGFITYDS-SEAVDRVCQNKYIDFKGKQIE 358

Query: 391 VAIAQRKDVRRS--------QLAQQIQARNQM 414
           +  A  + +++         Q   Q+QA  QM
Sbjct: 359 IKRAAPRHMQKGANNGRNPRQFQNQMQAPPQM 390

>Kwal_27.12337
          Length = 209

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 62/126 (49%), Gaps = 22/126 (17%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           ++YVG++DP V+   LY++F  I  V+ IR  +D I +T  G+A+V F +    + A + 
Sbjct: 11  TVYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYATKC 70

Query: 96  LNFTPIKGKLCRIMWSQRDPSLRK-KGAGN-------------IFIKNLHPDIDNKALYD 141
           LN +        +    R   +RK  GAG+             +F+KN+   +D  AL  
Sbjct: 71  LNNS--------LRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATALTR 122

Query: 142 TFSVFG 147
            FS FG
Sbjct: 123 IFSKFG 128

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 84/179 (46%), Gaps = 23/179 (12%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGE----NKGFGFVNFVNHEDAVKCV 273
           VY+ N++ + T +   EL   F +   V   R P+ +    ++GF FV F N +D     
Sbjct: 12  VYVGNVDPKVTREILYEL---FLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYAT 68

Query: 274 EELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRM--EKMAKYQGINLFIKNLDDSID 331
           + LNN+             + Y+R  +++K   A      + A   G  LF+KN+D+ +D
Sbjct: 69  KCLNNS------------LRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVD 116

Query: 332 DKKLEEEFAPYGTITSA-KVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
              L   F+ +G +  A ++   + G  K   +V ++T E + KA+ + N Q+V  K +
Sbjct: 117 ATALTRIFSKFGPLAKAPEIFYLKQGVLKC-AYVSYTTFEHSDKALAKLNNQMVMNKCI 174

>AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH]
           complement(617434..618879) [1446 bp, 481 aa]
          Length = 481

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 109/268 (40%), Gaps = 30/268 (11%)

Query: 13  ENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIF-SPIGAVSSIRVCRDAI 71
            N  L      T + +   T   SL+VGDL P+ +EAHL  +F +   +V ++RV  D I
Sbjct: 140 RNFRLNWASGATLQSDIPATPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPI 199

Query: 72  TKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSL--RKKGAGNIFIKN 129
           T  S  + +V F D    + A+ ++N    +G+  R+ ++    +L  +++         
Sbjct: 200 TGASRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVAYATPRNNLLQQQQAHPAPPAPP 259

Query: 130 LHPDIDNKALYDTFSVFGNILS-SKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLL 188
             P    + L D+  +   + S +++     G+++                      +LL
Sbjct: 260 SPPAPPAQTLPDSLGLLVGVPSLAQLDAASLGRAQ--------------------QPLLL 299

Query: 189 NGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLE 248
                 VG +        +     AN T V+I  ++   ++ +   L   FG   SV   
Sbjct: 300 GAAGSLVGSNSLPLAAPRQLPADTANTT-VFIGGLSNMISEGQLHALFMPFGNILSV--- 355

Query: 249 RTPEGENKGFGFVNFVNHEDAVKCVEEL 276
           + P G  +G GFV F N  DA   ++ +
Sbjct: 356 KVPPG--RGCGFVRFENRMDAEAAIQGM 381

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 84/216 (38%), Gaps = 56/216 (25%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCR-------DAITKTSL------------ 76
           +L++GDLDPS  EA +  ++  +G    +++ R          T ++L            
Sbjct: 23  TLWMGDLDPSFDEATIQHVWLTVGHQVQVKLIRAKKNLLIPCSTSSTLSASHVDEERIQI 82

Query: 77  ----------------GYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRK- 119
                           GY +V F +   A+  ++ LN TP+   +     +  +P+ ++ 
Sbjct: 83  NGVSFIDPNTTQLHHAGYCFVQFANLQEAQAGLQ-LNATPLPNVVSPTTRNPTNPTGKRN 141

Query: 120 ------KGAG-----------NIFIKNLHPDIDNKALYDTFSV-FGNILSSKVATDE-TG 160
                  GA            ++F+ +L P      L   F   F ++ + +V TD  TG
Sbjct: 142 FRLNWASGATLQSDIPATPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITG 201

Query: 161 KSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVG 196
            S+ FG+V F            +NG+   G+++ V 
Sbjct: 202 ASRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVA 237

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 41/83 (49%), Gaps = 6/83 (7%)

Query: 30  SETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAA 89
           ++T + ++++G L   +SE  L+ +F P G + S++V          G  +V F +   A
Sbjct: 321 ADTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKV------PPGRGCGFVRFENRMDA 374

Query: 90  KTAIEKLNFTPIKGKLCRIMWSQ 112
           + AI+ +    + G   R+ W +
Sbjct: 375 EAAIQGMQGFIVGGNAIRLSWGR 397

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 5/73 (6%)

Query: 320 NLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEK 379
            +FI  L + I + +L   F P+G I S KV        +G GFV F    +A  AI   
Sbjct: 327 TVFIGGLSNMISEGQLHALFMPFGNILSVKV-----PPGRGCGFVRFENRMDAEAAIQGM 381

Query: 380 NQQIVAGKPLYVA 392
              IV G  + ++
Sbjct: 382 QGFIVGGNAIRLS 394

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 29/72 (40%), Gaps = 5/72 (6%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXL 183
            +FI  L   I    L+  F  FGNILS KV        +G G+V F            +
Sbjct: 327 TVFIGGLSNMISEGQLHALFMPFGNILSVKVP-----PGRGCGFVRFENRMDAEAAIQGM 381

Query: 184 NGMLLNGQEIYV 195
            G ++ G  I +
Sbjct: 382 QGFIVGGNAIRL 393

>CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces
           cerevisiae YNL110c, hypothetical start
          Length = 255

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%)

Query: 5   TEKTAEQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSI 64
           TE++   ++ L    KQ+ T ++++   +S  +YVG L     E  L   FS  G +  +
Sbjct: 95  TEQSGHHIKKLDTSKKQKATKKDDKDSDISGIIYVGRLPKGFHERELSKYFSQFGDLKEV 154

Query: 65  RVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRI 108
           R+ R+  T  S  Y +V F + D ++ A + +N   + G L ++
Sbjct: 155 RLARNKKTGNSRHYGFVQFVNTDDSRVAYDTMNNYLLMGHLLQV 198

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 68/141 (48%), Gaps = 25/141 (17%)

Query: 200 SKKERESKFEEMKANFTNV-YIKNINTETTDKEFEELVAKFGKTDSVVLERTPE-GENKG 257
           SKK++ +K ++  ++ + + Y+  +     ++E  +  ++FG    V L R  + G ++ 
Sbjct: 108 SKKQKATKKDDKDSDISGIIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRH 167

Query: 258 FGFVNFVNHEDAVKCVEELNNTEFKGQPLYV------NRAQKKYERQQ------------ 299
           +GFV FVN +D+    + +NN    G  L V      ++ +K Y+ +Q            
Sbjct: 168 YGFVQFVNTDDSRVAYDTMNNYLLMGHLLQVRLLPKGSKIEKLYKYKQRAFMSPPKAKKS 227

Query: 300 --ELKKQYEAT---RMEKMAK 315
             ELKK  E     RMEK++K
Sbjct: 228 AKELKKLAEEKHKERMEKLSK 248

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 3/92 (3%)

Query: 122 AGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXX 180
           +G I++  L      + L   FS FG++   ++A ++ TG S+ +G+V F          
Sbjct: 124 SGIIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAY 183

Query: 181 XXLNGMLLNGQ--EIYVGPHLSKKERESKFEE 210
             +N  LL G   ++ + P  SK E+  K+++
Sbjct: 184 DTMNNYLLMGHLLQVRLLPKGSKIEKLYKYKQ 215

>KLLA0F18216g 1677731..1679857 some similarities with sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation
           singleton, hypothetical start
          Length = 708

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 73/319 (22%), Positives = 132/319 (41%), Gaps = 45/319 (14%)

Query: 111 SQRDPSLRKKGAGNIFIKNLHPDID----NKALYDTFSVFGNILSSKVATDETGKSKGFG 166
           S  DPS  +  +  IF+ +L   +     N ++   F+ +G I+S KV  D   +   + 
Sbjct: 109 SSDDPSFSRPSSC-IFVASLAATLSDSELNASVTKEFAKYGKIVSVKVLRDPANRP--YA 165

Query: 167 YVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKN---- 222
           +V +              G  LN + I             + E  K N T V+I +    
Sbjct: 166 FVQYASDDEALNALSQAQGTTLNNRNI-------------RCERAKVNRT-VFISSSFAN 211

Query: 223 -INTETTDKEFEELVAKFGKTDSVVLERTP-------EGENKGFGFVNFVNHEDAVKCVE 274
            +  + T ++  +L++KFG+ + VV  R           E     F+ +   +DA++   
Sbjct: 212 PLEGKLTVEKVVDLMSKFGELEQVVPSRDQMYKKNYYPSEVANSWFIQYAYRDDAIRAYL 271

Query: 275 ELN-NTEFKGQ-------PLYVNRAQKKYERQQELKKQYEATRMEKMAKY-QGINLFIKN 325
           ++  N E+  +       P   N    K +  +  K++ E  R  K   +    ++FI  
Sbjct: 272 QMKLNYEYMVEWAQNVDVPPRFNLLLSKAKICE--KERLERERFGKQPIFIDNKSIFIGQ 329

Query: 326 LDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVA 385
           L+  +    L E F+ YG I +  ++  +  + K F F+ + TP  A KA+  +N  I  
Sbjct: 330 LNFKVTKPLLLERFSKYGEIDNCNLIHKQE-QLKCFAFIKYKTPASAAKALERENHSIFV 388

Query: 386 GKPLYVAIAQRKDVRRSQL 404
            K L+V I +  + RRS +
Sbjct: 389 EKILHVQIREVSNSRRSSI 407

>Kwal_0.250
          Length = 216

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 56/118 (47%), Gaps = 2/118 (1%)

Query: 259 GFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQG 318
           G V F N E   K +++ +   F G+ L+V   +      +  +   +   +E+   + G
Sbjct: 2   GTVEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERF--HPG 59

Query: 319 INLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAI 376
             +FI NL  S   + L++ F   G  T A V    NG+SKGFG V F T +EA  A+
Sbjct: 60  YEIFIANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTAL 117

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 45/104 (43%), Gaps = 14/104 (13%)

Query: 81  VNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDP-SLRKKGAG-------------NIF 126
           V F++ +    AI+K +     G+   +   +  P S+R + +G              IF
Sbjct: 4   VEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGYEIF 63

Query: 127 IKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHF 170
           I NL      ++L D F   GN   + V  D  G+SKGFG V F
Sbjct: 64  IANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIF 107

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 13/82 (15%)

Query: 2   ADITEKTAEQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAV 61
           AD++   A Q EN S         E ++S T+    YV +L  + +++ LYD+F  IG V
Sbjct: 148 ADVSTTIAPQTENAS--------GEGHKSNTI----YVDNLPYATAQSDLYDLFETIGVV 195

Query: 62  SSIRVCRDAITKTSLGYAYVNF 83
               +  D   K + G A V++
Sbjct: 196 ERAELKYDRKVKPT-GAAIVSY 216

>Scas_705.22
          Length = 869

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 52/97 (53%), Gaps = 3/97 (3%)

Query: 306 EATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKV-MTTENGKSKGFGFV 364
           E   MEK++K     LF++N+  +  +    + F P+G +    V + T  GKSKGF ++
Sbjct: 316 EDIAMEKISKTG--RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYI 373

Query: 365 CFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRR 401
            F  P+EA +A  E ++QI  G+ L++  A  K   R
Sbjct: 374 LFKDPKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 100/225 (44%), Gaps = 17/225 (7%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGK------SKGFGYVHFXXXXXXX 177
           +IFIKNL+    +  L   F  F   + ++V T    K      S GFG+  F       
Sbjct: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701

Query: 178 XXXXXLNGMLLNGQEIYVGPHLSKKE----RESKFEEMKANFTNVYIKNINTETTDKEFE 233
                L+G +++G  I +   LS ++      S  +  K     + +KN+  E T K+  
Sbjct: 702 AVISALDGTVIDGHRIQL--KLSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFEATRKDVF 759

Query: 234 ELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQK 293
           EL   FG+  SV + +  +   +GF FV F+  ++A   +++L      G+ L +     
Sbjct: 760 ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM----- 814

Query: 294 KYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEE 338
           +Y +++    + E  RM K  K Q ++  +  L +S   KKLE E
Sbjct: 815 QYAQEEAADAEEEIARMTKKVKKQVVSSELAALRNSGGRKKLELE 859

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 59/107 (55%), Gaps = 15/107 (14%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSV-VLERTPEGENKGFGFVNFVNHEDAVKCVEEL 276
           ++++NI   TT+ +F +L   FG+ + V V   T  G++KGF ++ F + ++AV+   EL
Sbjct: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388

Query: 277 NNTEFKGQPLYVNRAQKK--------------YERQQELKKQYEATR 309
           +   F+G+ L++  A  K               ++Q+ELKK+  A+R
Sbjct: 389 DKQIFQGRLLHILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASR 435

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 76/189 (40%), Gaps = 17/189 (8%)

Query: 24  TNEENQSETV----SASLYVGDLDPSVSEAHLYDIFSPIG--AVSSIRVCRD---AITKT 74
           +NEE++ E V    + S+++ +L+ + +   L   F       V+ ++   D   A    
Sbjct: 626 SNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTL 685

Query: 75  SLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIK------ 128
           S+G+ +  F   + A   I  L+ T I G   ++  S R  S     +            
Sbjct: 686 SMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTSSAKGKKIKSGKII 745

Query: 129 --NLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGM 186
             NL  +   K +++ F+ FG + S +V       ++GF +V F            L G+
Sbjct: 746 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGV 805

Query: 187 LLNGQEIYV 195
            L G+ + +
Sbjct: 806 HLLGRRLVM 814

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 6/93 (6%)

Query: 311 EKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGK------SKGFGFV 364
           E +A    +++FIKNL+ +    +L + F  +     A+V T  + K      S GFGF 
Sbjct: 633 EHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFA 692

Query: 365 CFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397
            F T E+A   I+  +  ++ G  + + ++ R+
Sbjct: 693 EFRTKEQANAVISALDGTVIDGHRIQLKLSHRQ 725

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

Query: 122 AGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXX 180
            G +F++N+            F  FG +    VA D  TGKSKGF Y+ F          
Sbjct: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385

Query: 181 XXLNGMLLNGQEIYVGPHLSKK 202
             L+  +  G+ +++ P  +KK
Sbjct: 386 IELDKQIFQGRLLHILPADAKK 407

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 76/182 (41%), Gaps = 14/182 (7%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENK------GFGFVNFVNHEDA 269
            +++IKN+N  TT  E  +    F       ++  P+ ++       GFGF  F   E A
Sbjct: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700

Query: 270 VKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDS 329
              +  L+ T   G     +R Q K   +Q        T   K  K +   + +KNL   
Sbjct: 701 NAVISALDGTVIDG-----HRIQLKLSHRQ---GSSNTTSSAKGKKIKSGKIIVKNLPFE 752

Query: 330 IDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
              K + E F  +G + S +V    +  ++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 753 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812

Query: 390 YV 391
            +
Sbjct: 813 VM 814

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           +  L++ ++  + +E     +F P G +  + V  D  T  S G+AY+ F D   A  A 
Sbjct: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385

Query: 94  EKLNFTPIKGKLCRIM 109
            +L+    +G+L  I+
Sbjct: 386 IELDKQIFQGRLLHIL 401

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 242 TDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQ 292
           TD  +L R  EGE++ F F+ + N EDA   V   N +      L V+ A+
Sbjct: 40  TDVKIL-RNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAK 89

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 26/51 (50%)

Query: 345 ITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 395
           IT  K++    G+S+ F F+ +   E+A  A+   N   +    L V++A+
Sbjct: 39  ITDVKILRNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAK 89

>KLLA0D05016g complement(431592..432380) similar to sp|P25555
           Saccharomyces cerevisiae YCL011c GBP2 potential
           telomere-associated protein, start by similarity
          Length = 262

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 57/134 (42%)

Query: 258 FGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQ 317
            G V F N  D    + + +     G+ ++V +                     K A  +
Sbjct: 1   MGTVEFNNSTDVDTAIRDCDGAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDE 60

Query: 318 GINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAIT 377
           G  +F+  L  S++ ++L++ F P G +  A V+T  +GKS+GFG V  +T E+   AI 
Sbjct: 61  GFEVFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIR 120

Query: 378 EKNQQIVAGKPLYV 391
                   G+ L V
Sbjct: 121 HWTGTEYKGRVLDV 134

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/201 (20%), Positives = 76/201 (37%), Gaps = 36/201 (17%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +F+  L   ++ + L D F   G++L + V TD  GKS+GFG V+               
Sbjct: 64  VFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIRHWT 123

Query: 185 GMLLNGQEIYV---------------GPHLSKKERESKFEEMKANFTN------------ 217
           G    G+ + V                 ++ ++ R      +K    +            
Sbjct: 124 GTEYKGRVLDVKEGKGTSTRTAATGADTYIPRQPRNEPPATLKPKPLDIDPLAITTGGDR 183

Query: 218 ---VYIKNINTETTDKEFEELVAKFGKTDSVVLER---TPEGENKGFGFVNFVNHEDAVK 271
              ++ +N+ + TT+ +  +L   FG    V++ +    PEG      +  F   EDA  
Sbjct: 184 NSVIFCENMPSSTTESDLYDL---FGSVAPVIITKLLLNPEGHFTRNSYCQFETPEDADI 240

Query: 272 CVEELNNTEFKGQPLYVNRAQ 292
           C+ +L+   +    L V  A+
Sbjct: 241 CISKLDKYSYGDHELKVTYAR 261

>CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces
           cerevisiae YOR319w essential yeast splicing factor,
           hypothetical start
          Length = 211

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 91/188 (48%), Gaps = 9/188 (4%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTP-EGENKGFGFVNFVNHEDAVKCVEEL 276
           +Y+ NI+T+ T +   EL  + G+   V   +     E +GF F+ F +  DA   +  +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 277 -NNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKL 335
            NN +   + L + R+ +  ++    KK      +  +AK     +F+K++ D+++ + L
Sbjct: 68  NNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAK-----VFVKDIADTVEVRHL 122

Query: 336 EEEFAPYGTIT-SAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIA 394
            + F+ +G +  + +V T  NG+ +   F+ F   + A  AI   N Q +  K   +  A
Sbjct: 123 TQLFSKFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMNKKASLEYA 181

Query: 395 QRKDVRRS 402
            +++ R++
Sbjct: 182 FKENGRKN 189

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 80/167 (47%), Gaps = 14/167 (8%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
           A++YVG++D  V++  LY++F+ +G V  ++  +D I++   G+A++ F     A   + 
Sbjct: 6   ATIYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLN 65

Query: 95  KL-NFTPIKGKLCRIMWS----QRDPSLRKKG-------AGNIFIKNLHPDIDNKALYDT 142
            + N   +  K+ +I  S    Q+D + +K            +F+K++   ++ + L   
Sbjct: 66  VMNNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQL 125

Query: 143 FSVFGNILSS-KVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLL 188
           FS FG +  + +V T   G+ +   +++F            LNG  +
Sbjct: 126 FSKFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFI 171

>Kwal_14.1851
          Length = 535

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 36  SLYVGDLDPSVSEAHLYDIFS-PIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
           SL+VGDL P+ +EAHL  +F     +V ++RV  D IT  S  + +V F D    + A+ 
Sbjct: 175 SLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALV 234

Query: 95  KLNFTPIKGKLCRIMWS 111
           ++N    +G+  R+ ++
Sbjct: 235 EMNGVWCQGRNLRVAYA 251

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKN 380
           +FI  L   I +++L   F+P+G I + K+        KG GFV ++   +A  AI    
Sbjct: 398 VFIGGLTSQISERQLHSLFSPFGAIINVKI-----PPGKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 381 QQIVAGKPLYVA 392
             IV G P+ ++
Sbjct: 453 GFIVGGNPIRLS 464

 Score = 35.8 bits (81), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 55/140 (39%), Gaps = 21/140 (15%)

Query: 77  GYAYVNFNDHDAAKTAIEKLNFTPIKGKLC---------------RIMWSQRDPSLRKKG 121
           GY +V F     A+ A+  LN +P+    C               R+ W+     L    
Sbjct: 111 GYCFVEFESLADAQWAL-TLNSSPLPDITCGNGHVSTNPSGLRNFRLNWASGATLLSAIP 169

Query: 122 AG---NIFIKNLHPDIDNKALYDTFSV-FGNILSSKVATDE-TGKSKGFGYVHFXXXXXX 176
           +    ++F+ +L P      L   F   F ++ + +V TD  TG S+ FG+V F      
Sbjct: 170 STPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQER 229

Query: 177 XXXXXXLNGMLLNGQEIYVG 196
                 +NG+   G+ + V 
Sbjct: 230 RRALVEMNGVWCQGRNLRVA 249

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           ++++G L   +SE  L+ +FSP GA+ ++++          G  +V +     A+ AI+ 
Sbjct: 397 TVFIGGLTSQISERQLHSLFSPFGAIINVKI------PPGKGCGFVKYAYRIDAEAAIQG 450

Query: 96  LNFTPIKGKLCRIMW 110
           +    + G   R+ W
Sbjct: 451 MQGFIVGGNPIRLSW 465

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/106 (19%), Positives = 48/106 (45%), Gaps = 10/106 (9%)

Query: 214 NFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCV 273
           N T V+I  + ++ ++++   L + FG   +++  + P G  KG GFV +    DA   +
Sbjct: 394 NNTTVFIGGLTSQISERQLHSLFSPFG---AIINVKIPPG--KGCGFVKYAYRIDAEAAI 448

Query: 274 EELNNTEFKGQPLYVNRAQK-----KYERQQELKKQYEATRMEKMA 314
           + +      G P+ ++  +      ++   Q++     A  + + A
Sbjct: 449 QGMQGFIVGGNPIRLSWGRTSADTGRHSAMQDMPSCLPAANLNRAA 494

>ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH]
           (1024792..1025754) [963 bp, 320 aa]
          Length = 320

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 7/85 (8%)

Query: 311 EKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPE 370
           E+  +Y    L +K     +++ +L+E F+PYG +   K+M+       GF FV F  PE
Sbjct: 29  EQEGEYSTTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLMS-------GFAFVEFEKPE 81

Query: 371 EATKAITEKNQQIVAGKPLYVAIAQ 395
            A +AI + N ++ A  PL V+ ++
Sbjct: 82  SAEQAIKDVNGKMFADMPLTVSYSR 106

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 73/180 (40%), Gaps = 15/180 (8%)

Query: 16  SLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTS 75
           S  ++  G + E + E  +  L+V    P V E  L +IFSP GA+  +++         
Sbjct: 18  SYGNEPYGGHREQEGEYSTTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLMS------- 70

Query: 76  LGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDID 135
            G+A+V F   ++A+ AI+ +N          + +S R P  R +    I I+NL   I 
Sbjct: 71  -GFAFVEFEKPESAEQAIKDVNGKMFADMPLTVSYS-RMPMPRFR----IKIRNLPEGIA 124

Query: 136 NKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
            + L D      N L +   + +T    G G + F            LN     G  + V
Sbjct: 125 WQELKDLARE--NNLETTFLSVDTSNFDGTGALEFSSEEILEEALEKLNNYEFRGNVLAV 182

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 65/166 (39%), Gaps = 20/166 (12%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           + +K   PD++   L + FS +G +   K+ +       GF +V F            +N
Sbjct: 39  LHVKPFPPDVEEHELDEIFSPYGALKEVKLMS-------GFAFVEFEKPESAEQAIKDVN 91

Query: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDS 244
           G +     + V            +  M      + I+N+      +E ++L A+    ++
Sbjct: 92  GKMFADMPLTV-----------SYSRMPMPRFRIKIRNLPEGIAWQELKDL-ARENNLET 139

Query: 245 VVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNR 290
             L         G G + F + E   + +E+LNN EF+G  L V R
Sbjct: 140 TFLS-VDTSNFDGTGALEFSSEEILEEALEKLNNYEFRGNVLAVER 184

 Score = 35.4 bits (80), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 46/101 (45%), Gaps = 12/101 (11%)

Query: 197 PHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENK 256
           P+   +E+E ++     + T +++K    +  + E +E+ + +G    V L         
Sbjct: 23  PYGGHREQEGEY-----STTRLHVKPFPPDVEEHELDEIFSPYGALKEVKL-------MS 70

Query: 257 GFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYER 297
           GF FV F   E A + ++++N   F   PL V+ ++    R
Sbjct: 71  GFAFVEFEKPESAEQAIKDVNGKMFADMPLTVSYSRMPMPR 111

>YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA
           splicing factor, responsible for reannealing U4 and U6
           snRNAs to recycle snRNPs for subsequent splicing
           reactions, has 3 RNA recognition (RRM) domains [1335 bp,
           444 aa]
          Length = 444

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/300 (19%), Positives = 123/300 (41%), Gaps = 34/300 (11%)

Query: 118 RKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXX 177
           R +    + +KNL    +   +Y  F   G I+   VA D   K+  F  + F       
Sbjct: 36  RNRELTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVA-DSLKKNFRFARIEFARYDGAL 94

Query: 178 XXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVA 237
                 + ++  GQ   +  HL++                +++ N     T +   +L+ 
Sbjct: 95  AAITKTHKVV--GQNEIIVSHLTE--------------CTLWMTNFPPSYTQRNIRDLLQ 138

Query: 238 KFGKTD-SVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYE 296
                  S+ L       ++ F +++  + EDA  CVE+LN  + +G  L          
Sbjct: 139 DINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVT-------- 190

Query: 297 RQQELKKQYEATRMEKMAKYQGINLFIKNLD-DSIDDKKLEEEFAPYGTITSAKVMT--T 353
              ++    E ++    A  +G  + I+NL  + +D+  L E F  +G+I    +     
Sbjct: 191 ---KVSNPLEKSKRTDSATLEGREIMIRNLSTELLDENLLRESFEGFGSIEKINIPAGQK 247

Query: 354 ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD-VRRSQLAQQIQARN 412
           E+  +    F+ F   + A +A+ + N+ ++  + + V++A +K  + R+++ + + +RN
Sbjct: 248 EHSFNNCCAFMVFENKDSAERAL-QMNRSLLGNREISVSLADKKPFLERNEVKRLLASRN 306

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 96/237 (40%), Gaps = 32/237 (13%)

Query: 23  GTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVS-SIRVCRDAITKTSLGYAYV 81
           G NE   S     +L++ +  PS ++ ++ D+   I  V+ SIR+       TS  +AY+
Sbjct: 105 GQNEIIVSHLTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFN-TSRRFAYI 163

Query: 82  NFNDHDAAKTAIEKLNFTPIKG-KLCRIMWSQRDPSLRKKGAG----NIFIKNLHPD-ID 135
           +    + A+  +EKLN   I+G  L   + +  + S R   A      I I+NL  + +D
Sbjct: 164 DVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLEKSKRTDSATLEGREIMIRNLSTELLD 223

Query: 136 NKALYDTFSVFGNI--LSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEI 193
              L ++F  FG+I  ++      E   +    ++ F            +N  LL  +EI
Sbjct: 224 ENLLRESFEGFGSIEKINIPAGQKEHSFNNCCAFMVF-ENKDSAERALQMNRSLLGNREI 282

Query: 194 YVG-----PHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSV 245
            V      P L + E                +K +      KE E L+  F  +D V
Sbjct: 283 SVSLADKKPFLERNE----------------VKRLLASRNSKELETLICLFPLSDKV 323

>ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH]
           (140625..141752) [1128 bp, 375 aa]
          Length = 375

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 70/139 (50%), Gaps = 8/139 (5%)

Query: 254 ENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKM 313
           +NKGF +V+F      +  V  L+  +  G+ L +  A K Y+ +     + +   M K 
Sbjct: 158 KNKGFAYVDFATSAQ-MDAVIGLSEAQLNGRNLLIKNA-KSYDGRPA---KNDLISMSKN 212

Query: 314 AKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEA 372
              +   LF+ NL     D+ L++ F   G I   ++ T  ++GK KGF FV F     A
Sbjct: 213 PPSR--ILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGA 270

Query: 373 TKAITEKNQQIVAGKPLYV 391
           T A+T+++ + +AG+PL +
Sbjct: 271 TAALTDRSCRAIAGRPLRM 289

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 35/76 (46%)

Query: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           L+VG+L    ++  L   F   G +  IR+     +    G+A+V+F D   A  A+   
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 97  NFTPIKGKLCRIMWSQ 112
           +   I G+  R+ + +
Sbjct: 278 SCRAIAGRPLRMEYGE 293

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVAT-DETGKSKGFGYVHF 170
           +F+ NL  D  ++ L   F   G I+  ++AT  ++GK KGF +V F
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDF 264

>Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement
          Length = 396

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 81/157 (51%), Gaps = 11/157 (7%)

Query: 255 NKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMA 314
           NKGF +++F N E  +  V  L+ ++  G+ + +  +   YE + +   + +   M K  
Sbjct: 172 NKGFAYMDFKNKE-QMNAVIGLSESQLNGRNMLIKNSSS-YEGRPD---KNDLIAMSKNP 226

Query: 315 KYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEAT 373
             +   LF+ NL     D+ L + F   G I   ++ T  ++GK KGF F+ F   +  T
Sbjct: 227 PSRI--LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPT 284

Query: 374 KAITEKNQQIVAGKPLYVAIAQ---RKDVRRSQLAQQ 407
           +A+T+K+ + +AG+PL +   +   ++ V+R + + Q
Sbjct: 285 EALTDKSCRKIAGRPLRMEFGEDRSKRQVKRRENSSQ 321

>Sklu_1790.3 YOL041C, Contig c1790 1701-3122
          Length = 473

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 45/84 (53%), Gaps = 2/84 (2%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           S+++G+LD    E +L+  FSP G V  IR+ RD+ T    G+AYV F D  +   A+  
Sbjct: 308 SVFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKAL-L 366

Query: 96  LNFTPIKGKLCRIMWSQRDPSLRK 119
           LN   I G   R +   R  ++RK
Sbjct: 367 LNEKKINGN-GRKLRVSRCKNMRK 389

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 320 NLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITE 378
           ++FI NLD    ++ L + F+P G +   +++  ++    KGF +V F   +   KA+  
Sbjct: 308 SVFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKALL- 366

Query: 379 KNQQIVAGKPLYVAIAQRKDVRRSQLAQ 406
            N++ + G    + +++ K++R+SQ AQ
Sbjct: 367 LNEKKINGNGRKLRVSRCKNMRKSQPAQ 394

>KLLA0C08019g complement(704199..705104) some similarities with
           sp|Q00916 Saccharomyces cerevisiae YIL061c SNP1 U1 small
           nuclear ribonucleoprotein singleton, hypothetical start
          Length = 301

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 53/96 (55%), Gaps = 3/96 (3%)

Query: 286 LYVNRAQKKYERQQELKKQYEATRMEKMAKYQG---INLFIKNLDDSIDDKKLEEEFAPY 342
           +Y     + ++ Q+EL K+ +    E  A         LF+  L  ++D+ +L++ F  Y
Sbjct: 79  VYDEAMNESHKEQEELMKKIQEWHPESDANISSDPYRTLFVGRLHYAVDEVELQKSFVKY 138

Query: 343 GTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITE 378
           G I S +++  ++GKS+G+GFV F++ E++ +   E
Sbjct: 139 GDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFRE 174

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 37/62 (59%)

Query: 215 FTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVE 274
           +  +++  ++    + E ++   K+G  +S  + R  +G+++G+GFV F ++ED+ +C  
Sbjct: 114 YRTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFR 173

Query: 275 EL 276
           EL
Sbjct: 174 EL 175

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHF 170
           +F+  LH  +D   L  +F  +G+I S ++  D+ GKS+G+G+V F
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQF 162

>Scas_88.1
          Length = 256

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 339 FAPYGTITSAKV-MTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397
           F+PYG +    V + T  G+SKGF ++ F  PE A  A  E ++QI  G+ L++  A+ K
Sbjct: 19  FSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHILPAEAK 78

Query: 398 DVRR 401
              R
Sbjct: 79  KSHR 82

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 53/101 (52%), Gaps = 11/101 (10%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSV-VLERTPEGENKGFGFVNFVNHEDAVKCVEEL 276
           +++  I+ +  D  F +L + +G+ + V V   T  G +KGF ++ F N E+AV    EL
Sbjct: 3   LFVHFIHCKGID--FXQLFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIEL 60

Query: 277 NNTEFKGQPLYVNRAQ-KKYERQQE-------LKKQYEATR 309
           +   F+G+ L++  A+ KK  R  E       LKKQ E  R
Sbjct: 61  DKQIFQGRLLHILPAEAKKSHRLDEFDLKNLPLKKQRELKR 101

 Score = 36.2 bits (82), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%)

Query: 54  IFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQR 113
           +FSP G +  + V  D  T  S G+AY+ F + + A  A  +L+    +G+L  I+ ++ 
Sbjct: 18  LFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHILPAEA 77

Query: 114 DPSLR 118
             S R
Sbjct: 78  KKSHR 82

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 5/80 (6%)

Query: 125 IFIKNLHPD-IDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXX 182
           +F+  +H   ID   L   FS +G +    VA D  TG+SKGF Y+ F            
Sbjct: 3   LFVHFIHCKGIDFXQL---FSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIE 59

Query: 183 LNGMLLNGQEIYVGPHLSKK 202
           L+  +  G+ +++ P  +KK
Sbjct: 60  LDKQIFQGRLLHILPAEAKK 79

>CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces
           cerevisiae YBR212w Negative growth regulatory protein,
           hypothetical start
          Length = 802

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 36  SLYVGDLDPSVSEAHLYDIF-SPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
           SL+VGDL P+ +EA L  +F +   +V ++RV  D IT  S  + +V F + +  + A+ 
Sbjct: 235 SLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALI 294

Query: 95  KLNFTPIKGKLCRIMWS 111
           ++N    +G+  R+ ++
Sbjct: 295 EMNGVHFQGRTLRVAYA 311

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 218 VYIKNINTETTDKEFEELV-AKFGKTDSVVLERTP-EGENKGFGFVNFVNHEDAVKCVEE 275
           +++ +++   T+ +   L   KF    +V +   P  G ++ FGFV F N E+  + + E
Sbjct: 236 LFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIE 295

Query: 276 LNNTEFKGQPLYVNRAQKK 294
           +N   F+G+ L V  A  +
Sbjct: 296 MNGVHFQGRTLRVAYATPR 314

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 54/140 (38%), Gaps = 21/140 (15%)

Query: 77  GYAYVNFNDHDAAKTAIEKLNFTPIKG---------------KLCRIMWSQ---RDPSLR 118
           GY +V F     A+  +  LN TP+                 +  R+ W+       S+ 
Sbjct: 171 GYCFVEFESQKDAQEGL-ALNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGATLQSSIP 229

Query: 119 KKGAGNIFIKNLHPDIDNKALYDTFSV-FGNILSSKVATDE-TGKSKGFGYVHFXXXXXX 176
                ++F+ +L P      L   F   F ++ + +V TD  TG S+ FG+V F      
Sbjct: 230 TTPEYSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEER 289

Query: 177 XXXXXXLNGMLLNGQEIYVG 196
                 +NG+   G+ + V 
Sbjct: 290 RRALIEMNGVHFQGRTLRVA 309

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 6/81 (7%)

Query: 30  SETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAA 89
           ++  + +++VG L P+V E  L  IF P G + SI++             +V F     A
Sbjct: 462 TDPTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKI------PPGKNCGFVKFEHKIDA 515

Query: 90  KTAIEKLNFTPIKGKLCRIMW 110
           + AI+ L    +     R+ W
Sbjct: 516 EAAIQGLQGFVLVENPIRLSW 536

 Score = 32.7 bits (73), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 23/33 (69%)

Query: 36 SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCR 68
          +L++GDLDPS  E  + +I+S +G   ++++ R
Sbjct: 47 TLWMGDLDPSYDEETIQEIWSHLGKHVTVKLIR 79

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 5/64 (7%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +F+  L P +  + L   F  FGNILS K+        K  G+V F            L 
Sbjct: 469 VFVGGLGPTVQEQQLRKIFQPFGNILSIKIP-----PGKNCGFVKFEHKIDAEAAIQGLQ 523

Query: 185 GMLL 188
           G +L
Sbjct: 524 GFVL 527

>YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleolar
           protein with similarity to Nsr1p, has two RNA
           recognition (RRM) domains [1212 bp, 403 aa]
          Length = 403

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 78/160 (48%), Gaps = 8/160 (5%)

Query: 254 ENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKM 313
           +NKGF ++ F N E  +K V EL+ +   G+ + +  ++    R      + +   M K 
Sbjct: 181 KNKGFCYMFFKNVE-QMKAVLELSESHLNGRNMLIKDSENYSGRPD----KDDLVAMSKN 235

Query: 314 AKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTEN-GKSKGFGFVCFSTPEEA 372
              +   LF+ NL   + D  L + F   G I   ++ T E+ GK KGF F+ F   E +
Sbjct: 236 PPSRI--LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGS 293

Query: 373 TKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARN 412
           T  + +K+ + +AG+PL +   + +  R+ +   +  +RN
Sbjct: 294 TNELKDKSCRKIAGRPLRMEYGEDRSKRQVRKKVENVSRN 333

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVAT-DETGKSKGFGYVHF 170
           +F+ NL  D+ +  L   F   G+I+  ++AT +++GK KGF ++ F
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDF 287

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 50/108 (46%), Gaps = 4/108 (3%)

Query: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           L+VG+L   V++  L   F   G +  IR+     +    G+A+++F + + +   ++  
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNELKDK 300

Query: 97  NFTPIKGKLCRIMWSQRDPSLR--KKGAGNIFIKNLHP-DIDNKALYD 141
           +   I G+  R+ + + D S R  +K   N+   N    DI N   YD
Sbjct: 301 SCRKIAGRPLRMEYGE-DRSKRQVRKKVENVSRNNSSSFDISNNKGYD 347

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 66/153 (43%), Gaps = 26/153 (16%)

Query: 161 KSKGFGYVHFXXXXXXXX----XXXXLNG--MLLNGQEIYVGPHLSKKERESKFEEMKAN 214
           K+KGF Y+ F                LNG  ML+   E Y G       R  K +++ A 
Sbjct: 181 KNKGFCYMFFKNVEQMKAVLELSESHLNGRNMLIKDSENYSG-------RPDK-DDLVAM 232

Query: 215 FTN-----VYIKNINTETTDKEFEELVAKFGKTDSVVLERTP----EGENKGFGFVNFVN 265
             N     +++ N++ + TD   + L   F     +V  R       G+ KGF F++F N
Sbjct: 233 SKNPPSRILFVGNLSFDVTD---DLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKN 289

Query: 266 HEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQ 298
            E +   +++ +  +  G+PL +   + + +RQ
Sbjct: 290 EEGSTNELKDKSCRKIAGRPLRMEYGEDRSKRQ 322

>Kwal_55.20972
          Length = 135

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 7/110 (6%)

Query: 12  LENLSLQDKQEGTNEENQSETVS----ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVC 67
           ++NLS ++ ++G      S        A ++VG L   ++E  +  IFS  G    +++ 
Sbjct: 7   IQNLSFRELEQGILSPTASWHFEYKDQAYIFVGGLHKDLTEGDILTIFSQYGIPVDLKLV 66

Query: 68  RDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRI---MWSQRD 114
           RD  +  S G+AY+ + D  +   A++ LN   I G+  R+   M++ RD
Sbjct: 67  RDRESGESKGFAYLKYEDQRSTVLAVDNLNGVKIAGRSIRVDHTMFTPRD 116

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 2/95 (2%)

Query: 120 KGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXX 178
           K    IF+  LH D+    +   FS +G  +  K+  D E+G+SKGF Y+ +        
Sbjct: 31  KDQAYIFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVL 90

Query: 179 XXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKA 213
               LNG+ + G+ I V  H     R+  ++  +A
Sbjct: 91  AVDNLNGVKIAGRSIRV-DHTMFTPRDDDYDYARA 124

 Score = 34.7 bits (78), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE-GENKGFGFVNFVNHEDAVKCVEEL 276
           +++  ++ + T+ +   + +++G    + L R  E GE+KGF ++ + +    V  V+ L
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 277 NNTEFKGQPLYVNRA-------QKKYER--QQELKKQYEA 307
           N  +  G+ + V+            Y R  ++ELKK ++ 
Sbjct: 96  NGVKIAGRSIRVDHTMFTPRDDDYDYARAVEKELKKDFDC 135

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAK-VMTTENGKSKGFGFVCFSTPEEATKAITEK 379
           +F+  L   + +  +   F+ YG     K V   E+G+SKGF ++ +        A+   
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 380 NQQIVAGKPLYV 391
           N   +AG+ + V
Sbjct: 96  NGVKIAGRSIRV 107

>Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement
          Length = 188

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
           A +Y G L+  ++E  +  IFS  G    I++ RD  T+ S G+ Y+ + D  +   A++
Sbjct: 34  AYIYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVD 93

Query: 95  KLNFTPIKGKLCRI 108
            LN   I G+  ++
Sbjct: 94  NLNGATIAGRTIKV 107

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 80/178 (44%), Gaps = 32/178 (17%)

Query: 199 LSKKERESKFEEMKANFTN-------VYIKNINTETTDKEFEELVAKFGKTDSVVLERTP 251
           LS+KE E      KA++         +Y  ++N E T+ +   + +++G    + L R  
Sbjct: 10  LSEKELECGILSAKASWHKEYEEQAYIYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDK 69

Query: 252 EG-ENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRA---------QKKYERQQEL 301
           E  E+KGFG++ + +    V  V+ LN     G+ + V+ A         Q     Q EL
Sbjct: 70  ETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTIKVDHAFYTPRDDDWQYAEAVQNEL 129

Query: 302 KKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKL-------EEEFA-PYGTITSAKVM 351
           KK      + +  K+  + L  + ++  I++ +L       E+EFA P   ++  +VM
Sbjct: 130 KKD-----IVREQKHNTVGL--RQIESGIEENRLSTEINNQEDEFADPIAAVSRNEVM 180

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXL 183
           I+  +L+ ++    +   FS +G  +  K+  D ET +SKGFGY+ +            L
Sbjct: 36  IYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNL 95

Query: 184 NGMLLNGQEIYV 195
           NG  + G+ I V
Sbjct: 96  NGATIAGRTIKV 107

>CAGL0H03861g complement(361189..362520) similar to sp|P38922
           Saccharomyces cerevisiae YNL004w HRB1, start by
           similarity
          Length = 443

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 87/226 (38%), Gaps = 22/226 (9%)

Query: 81  VNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALY 140
           VN    D  K A  K +F P   +L R + S  +  + +    +IF+ NL  D   + L 
Sbjct: 68  VNKFRRDKEKAARTKGDFGP---RLARELDSTYEEKVNRNYTNSIFVGNLTYDCTPEDLK 124

Query: 141 DTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV----- 195
           D FS  G ++ + + T   G  +G G V F             +G  L  ++I+V     
Sbjct: 125 DFFSQVGKVVRADIITSR-GHHRGMGTVEFTSGEEVDEAIRKFDGAYLMNRQIFVRQDNP 183

Query: 196 -------------GPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKT 242
                          H +   +  K  + +     + I N+    + +  + +  +FG  
Sbjct: 184 PPESSSTHSSGSNSGHTTNVTKPKKAVKPQKKGYELMILNLPYSISWQTLKTMFKEFGDV 243

Query: 243 DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYV 288
               +E    G + G G V F N ED VK  E  N  E +G+ L V
Sbjct: 244 LKANVEVDSTGMSIGVGNVIFKNQEDMVKAYEHFNGFEIEGKVLEV 289

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 72/201 (35%), Gaps = 32/201 (15%)

Query: 22  EGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTS--LGYA 79
           + T EE  +   + S++VG+L    +   L D FS +G V    V  D IT      G  
Sbjct: 94  DSTYEEKVNRNYTNSIFVGNLTYDCTPEDLKDFFSQVGKV----VRADIITSRGHHRGMG 149

Query: 80  YVNFNDHDAAKTAIEKLNFTPI-------------------------KGKLCRIMWSQRD 114
            V F   +    AI K +   +                          G    +   ++ 
Sbjct: 150 TVEFTSGEEVDEAIRKFDGAYLMNRQIFVRQDNPPPESSSTHSSGSNSGHTTNVTKPKKA 209

Query: 115 PSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXX 174
              +KKG   + I NL   I  + L   F  FG++L + V  D TG S G G V F    
Sbjct: 210 VKPQKKGY-ELMILNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKNQE 268

Query: 175 XXXXXXXXLNGMLLNGQEIYV 195
                    NG  + G+ + V
Sbjct: 269 DMVKAYEHFNGFEIEGKVLEV 289

 Score = 36.6 bits (83), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 53/101 (52%), Gaps = 1/101 (0%)

Query: 291 AQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKV 350
           A+ K +    L ++ ++T  EK+ +    ++F+ NL      + L++ F+  G +  A +
Sbjct: 79  ARTKGDFGPRLARELDSTYEEKVNRNYTNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADI 138

Query: 351 MTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           +T+  G  +G G V F++ EE  +AI + +   +  + ++V
Sbjct: 139 ITSR-GHHRGMGTVEFTSGEEVDEAIRKFDGAYLMNRQIFV 178

>YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           and a glutamine-rich region [2019 bp, 672 aa]
          Length = 672

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 36  SLYVGDLDPSVSEAHLYDIF-SPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
           SL+VGDL P+ +EA L  +F +   +V ++RV  D +T +S  + +V F D D  + A+ 
Sbjct: 193 SLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERRRALI 252

Query: 95  KLNFTPIKGKLCRIMWS 111
           +++    +G+  R+ ++
Sbjct: 253 EMSGKWFQGRALRVAYA 269

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 56/140 (40%), Gaps = 21/140 (15%)

Query: 77  GYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRK-------KGAG------ 123
           GY +V F     AK A+  LN TP+         SQ +P+ ++        GA       
Sbjct: 129 GYCFVEFETQKDAKFALS-LNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIP 187

Query: 124 -----NIFIKNLHPDIDNKALYDTFSV-FGNILSSKVATDE-TGKSKGFGYVHFXXXXXX 176
                ++F+ +L P      L   F   F ++ + +V TD  TG S+ FG+V F      
Sbjct: 188 STPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDER 247

Query: 177 XXXXXXLNGMLLNGQEIYVG 196
                 ++G    G+ + V 
Sbjct: 248 RRALIEMSGKWFQGRALRVA 267

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 36/81 (44%), Gaps = 6/81 (7%)

Query: 30  SETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAA 89
           ++  + +++VG L P  +E  L  +F P G + ++R+             +V F     A
Sbjct: 355 TDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGK------NCGFVKFEKRIDA 408

Query: 90  KTAIEKLNFTPIKGKLCRIMW 110
           + +I+ L    + G   R+ W
Sbjct: 409 EASIQGLQGFIVGGSPIRLSW 429

>CAGL0D05236g 499006..500337 weakly similar to sp|P43607
           Saccharomyces cerevisiae YFR032c, hypothetical start
          Length = 443

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 63/111 (56%), Gaps = 9/111 (8%)

Query: 215 FTNVYIKNINTETTDKEFEELVAKFGKTDSVV----LERTPEGENKGFG--FVNFVNHED 268
            + +YI N++  +++++  E +  F  +  ++    + R    E + FG  +V+F + E+
Sbjct: 3   VSRIYIANVSYSSSEEDLREFLKDFNFSSVLIPCHTVRRFRRNEARSFGIAYVDFTSSEE 62

Query: 269 AVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQY--EATRMEKMAKYQ 317
           AV+ VEELN  EF G+ L V R    Y+  + +K+++  +  +++K AKY+
Sbjct: 63  AVRAVEELNGKEFGGRVLRV-RTHNPYQPPKPIKERFGTKLQQLKKFAKYE 112

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 5/79 (6%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAIT-----KTSLGYAYVNFNDHDAA 89
           + +Y+ ++  S SE  L +        S +  C            S G AYV+F   + A
Sbjct: 4   SRIYIANVSYSSSEEDLREFLKDFNFSSVLIPCHTVRRFRRNEARSFGIAYVDFTSSEEA 63

Query: 90  KTAIEKLNFTPIKGKLCRI 108
             A+E+LN     G++ R+
Sbjct: 64  VRAVEELNGKEFGGRVLRV 82

>YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in
           splicing and spliceosome assembly, has a role in sodium
           tolerance [447 bp, 148 aa]
          Length = 148

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           +A +Y+G+L+  ++E  +  +FS  G    + + RD  T  S G+AY+ + D  +   A+
Sbjct: 30  NAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAV 89

Query: 94  EKLNFTPIKGKLCRI 108
           + LN   I G+  +I
Sbjct: 90  DNLNGFKIGGRALKI 104

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 64/128 (50%), Gaps = 13/128 (10%)

Query: 188 LNGQEIYVG---PHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDS 244
           +N +E+  G   PH      +S   E K N   +YI N+N E T+ +   + +++G    
Sbjct: 7   INDKELQSGILSPH------QSWHNEYKDN-AYIYIGNLNRELTEGDILTVFSEYGVPVD 59

Query: 245 VVLERTPE-GENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKK 303
           V+L R    GE++GF ++ + +    +  V+ LN  +  G+ L ++     Y  ++ L+K
Sbjct: 60  VILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHT--FYRPKRSLQK 117

Query: 304 QYEATRME 311
            YEA + E
Sbjct: 118 YYEAVKEE 125

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXL 183
           I+I NL+ ++    +   FS +G  +   ++ DE TG+S+GF Y+ +            L
Sbjct: 33  IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNL 92

Query: 184 NGMLLNGQEIYVGPHLSKKER 204
           NG  + G+ + +     + +R
Sbjct: 93  NGFKIGGRALKIDHTFYRPKR 113

>Scas_376.1
          Length = 404

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 83/159 (52%), Gaps = 8/159 (5%)

Query: 254 ENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKM 313
           +NKGF +++F  +E  ++ + +L+ ++  G+ + + +  K YE + +   + +   + K 
Sbjct: 180 KNKGFCYMDFKTNE-QMESIIKLSESQLNGRNMLI-KDSKSYEGRPD---KNDLVSLSKN 234

Query: 314 AKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEA 372
              +   LF+ NL     D+ L++ F   G I   ++ T  ++GK KGF F+ F + E A
Sbjct: 235 PPSRI--LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGA 292

Query: 373 TKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR 411
           T A+ +K  + +A +P+ +   + +  R+ +    ++ R
Sbjct: 293 TNALKDKTCRKIAARPIRMEYGEDRSKRQVKRRDPVEPR 331

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 50/116 (43%), Gaps = 17/116 (14%)

Query: 1   MADITEKTAEQL--ENLSLQDKQEGTNEENQSETVSAS-------LYVGDLDPSVSEAHL 51
           M  I + +  QL   N+ ++D +      ++++ VS S       L+VG+L    ++  L
Sbjct: 195 MESIIKLSESQLNGRNMLIKDSKSYEGRPDKNDLVSLSKNPPSRILFVGNLSFDTTDELL 254

Query: 52  YDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCR 107
              F   G +  IR+     +    G+A+++F   + A  A        +K K CR
Sbjct: 255 KKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNA--------LKDKTCR 302

>Scas_316.1
          Length = 483

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 73/158 (46%), Gaps = 15/158 (9%)

Query: 256 KGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQ--ELKKQYEATRMEKM 313
           +GFGFV+F   +D  + +++    + KG  L V+ A+++    +  E  K  + TR + +
Sbjct: 5   RGFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTDTI 64

Query: 314 AKYQG------------INLFIKNLDDSIDD-KKLEEEFAPYGTITSAKVMTTENGKSKG 360
           A+ +               L I+N+  S  D  +L++ F+ +GT+  A +    +GK  G
Sbjct: 65  ARDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKLCG 124

Query: 361 FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD 398
           F FV        T A+       + G+ + V  A +K+
Sbjct: 125 FAFVTMKKLSNCTIALENTKDLKIDGRSVAVDFAVQKN 162

 Score = 35.8 bits (81), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%)

Query: 355 NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD 398
           N K +GFGFV F+  ++  +A+ +  +  + G  L V IA+R+D
Sbjct: 1   NKKFRGFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRD 44

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 29/150 (19%), Positives = 53/150 (35%), Gaps = 31/150 (20%)

Query: 77  GYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGN------------ 124
           G+ +V+F   D  K A+++     +KG L R+  ++R     K G G+            
Sbjct: 6   GFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTDTIA 65

Query: 125 ------------------IFIKNLHPDI-DNKALYDTFSVFGNILSSKVATDETGKSKGF 165
                             + I+N+     D   L   FS FG ++ + +     GK  GF
Sbjct: 66  RDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKLCGF 125

Query: 166 GYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
            +V                 + ++G+ + V
Sbjct: 126 AFVTMKKLSNCTIALENTKDLKIDGRSVAV 155

>Kwal_33.14463
          Length = 393

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 70/153 (45%), Gaps = 13/153 (8%)

Query: 254 ENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKM 313
           +NKGF  +NF   E  +  V  L+ +   G+ L +  +            + +   +  M
Sbjct: 177 KNKGFAHMNFKTQE-QMNAVVALSESHLNGRNLLIKDSS-------SFDGRPDKNDLISM 228

Query: 314 AKYQGIN-LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEE 371
           +K      LF+ NL     D+ L++ F   G I   ++ T  + GK KGF FV F   E 
Sbjct: 229 SKNPPSRILFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEG 288

Query: 372 ATKAITEKNQQIVAGKPLYVAIAQ---RKDVRR 401
            T A+ +K  + +AG+PL +   +   ++ VRR
Sbjct: 289 PTNALKDKTCRKIAGRPLRMEFGEDRSKRQVRR 321

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVAT-DETGKSKGFGYVHF 170
           +F+ NL  D  ++ L   F   G+I+  ++AT  +TGK KGF +V F
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDF 283

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 47/106 (44%), Gaps = 7/106 (6%)

Query: 14  NLSLQDKQEGTNEENQSETVSAS-------LYVGDLDPSVSEAHLYDIFSPIGAVSSIRV 66
           NL ++D        ++++ +S S       L+VG+L    ++  L   F   G +  IR+
Sbjct: 207 NLLIKDSSSFDGRPDKNDLISMSKNPPSRILFVGNLSFDTTDELLKKHFQHCGDIVKIRM 266

Query: 67  CRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQ 112
                T    G+A+V+F D +    A++      I G+  R+ + +
Sbjct: 267 ATFQDTGKCKGFAFVDFKDEEGPTNALKDKTCRKIAGRPLRMEFGE 312

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 65/146 (44%), Gaps = 12/146 (8%)

Query: 161 KSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERESKFE--EMKANFTN- 217
           K+KGF +++F            L+   LNG+ + +    S   R  K +   M  N  + 
Sbjct: 177 KNKGFAHMNFKTQEQMNAVVA-LSESHLNGRNLLIKDSSSFDGRPDKNDLISMSKNPPSR 235

Query: 218 -VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE----GENKGFGFVNFVNHEDAVKC 272
            +++ N++ +TTD   E L   F     +V  R       G+ KGF FV+F + E     
Sbjct: 236 ILFVGNLSFDTTD---ELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNA 292

Query: 273 VEELNNTEFKGQPLYVNRAQKKYERQ 298
           +++    +  G+PL +   + + +RQ
Sbjct: 293 LKDKTCRKIAGRPLRMEFGEDRSKRQ 318

>KLLA0C05522g 494240..495862 some similarities with sp|P32831
           Saccharomyces cerevisiae YBR212w NGR1
           glucose-repressible RNA-binding protein, hypothetical
           start
          Length = 540

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 36  SLYVGDLDPSVSEAHLYDIF-SPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
           SL+VGDL P  +EA L  +F +   +V ++RV  D IT  S  + +V F +    + A+ 
Sbjct: 160 SLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALI 219

Query: 95  KLNFTPIKGKLCRIMWSQ-RDPSLRKKGAGNIFIKNLHPDI 134
           ++N    +G+  R+ ++  R+   ++  +GN+  + LH +I
Sbjct: 220 EMNGVQFQGRQLRVAYATPRNNVAQQHLSGNLG-QQLHSNI 259

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 84/221 (38%), Gaps = 55/221 (24%)

Query: 30  SETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRD------AITKTSL------- 76
           S  +  +L++GDLDP   E  +  I+  +G    +++ +        I  TS+       
Sbjct: 15  SNELPRTLWMGDLDPGFDELIIASIWQSLGKSVKVKLIKSKTNALVPINSTSIPNNASSN 74

Query: 77  --------------------GYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQR--D 114
                               GY +V F   + A+ A+  LN TPI    C    S+R  D
Sbjct: 75  ALEINGVSFIDPNKTNLHHAGYCFVEFESFEDAQQAL-TLNATPIPNISCNTTASKRTND 133

Query: 115 PSLRK------KGAG-----------NIFIKNLHPDIDNKALYDTFSV-FGNILSSKVAT 156
              RK       GA            ++F+ +L P      L   F   + ++ + +V T
Sbjct: 134 DGKRKFRLNWANGATLHSTILPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMT 193

Query: 157 DE-TGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVG 196
           D  TG S+ FG+V F            +NG+   G+++ V 
Sbjct: 194 DPITGASRCFGFVRFANETERRNALIEMNGVQFQGRQLRVA 234

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 16/84 (19%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRV-----CRDAITKTSLGYAYVNFNDHDA 88
           S +++VG L+P+++E  L+++F P G ++ +++     C            +V +N+   
Sbjct: 444 STTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQC-----------GFVKYNERLE 492

Query: 89  AKTAIEKLNFTPIKGKLCRIMWSQ 112
           A+ AI  L    I G   R+ W +
Sbjct: 493 AEAAINGLQGFIIMGSPIRLSWGR 516

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 314 AKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEAT 373
           A      +F+  L+ +I++ +L E F P+GTIT  K+        K  GFV ++   EA 
Sbjct: 440 AGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKI-----PPGKQCGFVKYNERLEAE 494

Query: 374 KAITEKNQQIVAGKPLYVA 392
            AI      I+ G P+ ++
Sbjct: 495 AAINGLQGFIIMGSPIRLS 513

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 218 VYIKNINTETTDKEFEELV-AKFGKTDSVVLERTP-EGENKGFGFVNFVNHEDAVKCVEE 275
           +++ +++   T+ +   L   K+    +V +   P  G ++ FGFV F N  +    + E
Sbjct: 161 LFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALIE 220

Query: 276 LNNTEFKGQPLYVNRAQKKYERQQE 300
           +N  +F+G+ L V  A  +    Q+
Sbjct: 221 MNGVQFQGRQLRVAYATPRNNVAQQ 245

>YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein
           important for the synthesis of 25S pre-rRNA [1380 bp,
           459 aa]
          Length = 459

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           S++VG+LD    E  L+  F P G +  +R+ RD+ T    G+AYV F D  +   A+  
Sbjct: 280 SIFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKAL-L 338

Query: 96  LNFTPIKG 103
           LN  P+K 
Sbjct: 339 LNEKPMKS 346

>KLLA0F07799g complement(734889..736463) similar to sp|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, start by
           similarity
          Length = 524

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           S++VG+LD    E  L+  F P G +  +R+ RD+ T    G+AYV F D  +   A+  
Sbjct: 360 SVFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLL 419

Query: 96  LNFTPIKGKLCRIMWSQRDPSLRK 119
                 +GK  R +   R  ++RK
Sbjct: 420 HEKKIHEGKKARKLRISRCKNMRK 443

 Score = 36.6 bits (83), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 53/101 (52%), Gaps = 2/101 (1%)

Query: 320 NLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITE 378
           ++F+ NLD    ++ L + F P G I   +++  ++    KGF +V F   +  +KA+  
Sbjct: 360 SVFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLL 419

Query: 379 KNQQIVAGKPLY-VAIAQRKDVRRSQLAQQIQARNQMRFQQ 418
             ++I  GK    + I++ K++R++Q  Q     N++  QQ
Sbjct: 420 HEKKIHEGKKARKLRISRCKNMRKAQGNQSSLQNNKLNDQQ 460

>CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I, hypothetical start
          Length = 280

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           S  +Y+G +    +E  + D+ S +G V S+++  D+ T  S GYA+V + D +++ +A+
Sbjct: 15  SRVVYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAV 74

Query: 94  EKLNFTPIKGKLCRIMWSQRDPSLRKKGAGN 124
             LN   +  +L +  +S  +  +  +G GN
Sbjct: 75  RNLNGYQLGSRLLKCGYS-SNSDITDQGVGN 104

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXL 183
           +++ ++  D   + + D  S  G ++S K+  D +TGKSKG+ +V +            L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 184 NGMLLNGQEIYVG 196
           NG  L  + +  G
Sbjct: 78  NGYQLGSRLLKCG 90

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 343 GTITSAKVM-TTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDV 399
           G + S K+M  ++ GKSKG+ FV +   E +  A+   N   +  + L    +   D+
Sbjct: 40  GPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNLNGYQLGSRLLKCGYSSNSDI 97

>Sklu_2353.5 YIL061C, Contig c2353 10817-11575
          Length = 252

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           ++++G L   V+E  L   FS  G +  +RV RD  T  S GYA++ F D   ++ A ++
Sbjct: 58  TVFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAACKE 117

Query: 96  L 96
           +
Sbjct: 118 I 118

 Score = 28.9 bits (63), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 54/113 (47%), Gaps = 10/113 (8%)

Query: 215 FTNVYIKNINTETTDKEFEELVAKFGKTDSV-VLERTPEGENKGFGFVNFVNHEDAVKCV 273
           F  V+I  +  E T+ E ++  ++FG+ + V V+      +++G+ F+ F +   +    
Sbjct: 56  FRTVFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAAC 115

Query: 274 EEL---NNTEFKGQPLYVN----RAQKKYE--RQQELKKQYEATRMEKMAKYQ 317
           +E+      + +G+ + V+    R  K ++  R          T+ EKMAK+Q
Sbjct: 116 KEIGVHRGLDIQGRSVIVDIERGRTVKYFKPRRLGGGLGGRGYTKREKMAKFQ 168

>YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component
          of pre-mRNA cleavage and polyadenylation factor I
          (CFI), involved in poly(A) site choice, interacts with
          Rna14p, Pap1p, and Pcf11p, contains one RNA recognition
          (RRM) domain [891 bp, 296 aa]
          Length = 296

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 44/79 (55%)

Query: 19 DKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGY 78
          ++Q G N   Q+   S  +Y+G +    +E  + D+ S +G V ++++  D  T  S GY
Sbjct: 2  NRQSGVNAGVQNNPPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGY 61

Query: 79 AYVNFNDHDAAKTAIEKLN 97
          A++ F D +++ +A+  LN
Sbjct: 62 AFIEFRDLESSASAVRNLN 80

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXL 183
           +++ ++  D   + + D  S  G +++ K+  D +TG+SKG+ ++ F            L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 184 NGMLLNGQEIYVG 196
           NG  L  + +  G
Sbjct: 80  NGYQLGSRFLKCG 92

>CAGL0J01914g complement(189309..189818) similar to sp|P40565
           Saccharomyces cerevisiae YIR005w IST3, hypothetical
           start
          Length = 169

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 3/83 (3%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
           A +++G L+  ++E  L  IFS  G    + + RD  T  S G+A++ + D  +   A++
Sbjct: 34  AYIFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVD 93

Query: 95  KLNFTPIKG---KLCRIMWSQRD 114
            LN   + G   K+  I ++ RD
Sbjct: 94  NLNGITVAGRQIKVDHIFFTPRD 116

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEG-ENKGFGFVNFVNHEDAVKCVEEL 276
           ++I  +N + T+ +   + +++G    V+L R  E  E+KGF F+ + +    +  V+ L
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 277 NNTEFKGQPLYVNR 290
           N     G+ + V+ 
Sbjct: 96  NGITVAGRQIKVDH 109

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 47/107 (43%), Gaps = 8/107 (7%)

Query: 92  AIEKLNFTPIKGKLCR--IMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNI 149
           AI+++N   ++  + +    W Q       K    IFI  L+  +    L   FS +G  
Sbjct: 6   AIQRINEKELEAGILKPEHSWHQE-----YKDQAYIFIGGLNRQLTEGDLLTIFSQYGVP 60

Query: 150 LSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
           +   +  D ET +SKGF ++ +            LNG+ + G++I V
Sbjct: 61  VDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGRQIKV 107

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGT-ITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEK 379
           +FI  L+  + +  L   F+ YG  +    V   E  +SKGF F+ +        A+   
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 380 NQQIVAGKPLYV 391
           N   VAG+ + V
Sbjct: 96  NGITVAGRQIKV 107

>Kwal_26.7179
          Length = 456

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI-- 93
           S++VG+LD   +E +L+  F   G +  +R+ RD+ T    G+AYV F D      A+  
Sbjct: 294 SVFVGNLDFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKALLL 353

Query: 94  --EKLNFTPIKGKLCRI 108
             +KLN T  K ++ R 
Sbjct: 354 DGQKLNGTGRKLRVTRC 370

 Score = 35.8 bits (81), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 9/116 (7%)

Query: 79  AYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKA 138
           AYV + D  A K A E+LN T  +    R+  S   P+ +     ++F+ NL  +   + 
Sbjct: 251 AYVVYADKAAVKIACEQLNGTLFQNHHLRVD-SVTHPT-QHDNKRSVFVGNLDFEETEEN 308

Query: 139 LYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEI 193
           L+  F   G+I   ++  D +T   KGF YV F               +LL+GQ++
Sbjct: 309 LWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVN------KALLLDGQKL 358

>AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH]
           complement(345624..346280) [657 bp, 218 aa]
          Length = 218

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%)

Query: 20  KQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYA 79
           K  G  EE +    SA++YVG+L    SE  LY++FS  G++  I +  D    T  G+ 
Sbjct: 31  KTPGGLEELRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFC 90

Query: 80  YVNFNDHDAAKTAIEKLNFTPI 101
           ++ +     A  A++ L+ T +
Sbjct: 91  FIIYQTPQEALAALKYLSKTKL 112

>Sklu_2182.3 YDR432W, Contig c2182 3920-5035
          Length = 371

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 73/178 (41%), Gaps = 15/178 (8%)

Query: 18  QDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLG 77
            D   G    N+ E  +  L+V      V E+ L +IFSP G +  +++          G
Sbjct: 58  HDDHYGALTPNEGELSTTRLFVRPFPFDVQESELNEIFSPFGPMKEVKILN--------G 109

Query: 78  YAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNK 137
           +A+V F + ++A  AI+++N      +   +++S+  P   +     + ++NL   +  +
Sbjct: 110 FAFVEFEESESAAKAIDEVNGKTFANQPLEVVYSKLPPQRFR-----MILRNLPEGVAWQ 164

Query: 138 ALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
            L D      N L +  ++  T +  G G + F            LN +   G  I V
Sbjct: 165 ELKDL--ARENNLETTFSSVNTREFDGTGALEFPTEEILEEALEKLNNIEFRGAVISV 220

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKN 380
           LF++     + + +L E F+P+G +   K++        GF FV F   E A KAI E N
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKILN-------GFAFVEFEESESAAKAIDEVN 129

Query: 381 QQIVAGKPLYVAIAQ 395
            +  A +PL V  ++
Sbjct: 130 GKTFANQPLEVVYSK 144

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 7/73 (9%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275
           T ++++    +  + E  E+ + FG    V +         GF FV F   E A K ++E
Sbjct: 75  TRLFVRPFPFDVQESELNEIFSPFGPMKEVKIL-------NGFAFVEFEESESAAKAIDE 127

Query: 276 LNNTEFKGQPLYV 288
           +N   F  QPL V
Sbjct: 128 VNGKTFANQPLEV 140

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 64/168 (38%), Gaps = 24/168 (14%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +F++    D+    L + FS FG +   K+         GF +V F            +N
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKILN-------GFAFVEFEESESAAKAIDEVN 129

Query: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAK--FGKT 242
           G     Q +           E  + ++      + ++N+      +E ++L  +     T
Sbjct: 130 GKTFANQPL-----------EVVYSKLPPQRFRMILRNLPEGVAWQELKDLARENNLETT 178

Query: 243 DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNR 290
            S V  R    E  G G + F   E   + +E+LNN EF+G  + V R
Sbjct: 179 FSSVNTR----EFDGTGALEFPTEEILEEALEKLNNIEFRGAVISVER 222

>Scas_701.3
          Length = 321

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           ++++G L    +E  L  +F   G +  IR+ RD +T  S GYA++ F D  ++K A ++
Sbjct: 107 TIFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKE 166

Query: 96  LNF---TPIKGKLC 106
           +       IKG+ C
Sbjct: 167 IGVHRGIDIKGRTC 180

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 215 FTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTP-EGENKGFGFVNFVN 265
           +  ++I  +  +TT+ E ++L  KFG+ + + + R     ++KG+ F+ F++
Sbjct: 105 YRTIFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLD 156

>KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 391

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 75/158 (47%), Gaps = 8/158 (5%)

Query: 255 NKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMA 314
           NKGF +++F   E  ++ V  L+ +   G+ L +  A   YE + + K    A      +
Sbjct: 170 NKGFAYIDF-KTEKQMEAVVGLSESALNGRNLLIKNAGS-YEGRPD-KNDLVAASKNPPS 226

Query: 315 KYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTEN-GKSKGFGFVCFSTPEEAT 373
           +     LF+ NL     +  L + F   G I   ++ T E+ GK KGF F+ F     AT
Sbjct: 227 RI----LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGAT 282

Query: 374 KAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR 411
            A+ +K+ + +A +P+ +   + +  R+ +   ++ AR
Sbjct: 283 NALKDKSCRKIASRPIRMEYGEDRSKRQVRRRPELDAR 320

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 8/76 (10%)

Query: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           L+VG+L    +E  L   F   G +  IR+     T    G+A+++F D   A  A    
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNA---- 284

Query: 97  NFTPIKGKLCRIMWSQ 112
               +K K CR + S+
Sbjct: 285 ----LKDKSCRKIASR 296

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVAT-DETGKSKGFGYVHF 170
           +F+ NL  D     L   F   G I+  ++AT ++TGK KGF ++ F
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDF 275

>YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1
           snRNA-associated protein with RNA recognition (RRM)
           domain, homologous to human 70 kDa U1 snRNP protein [903
           bp, 300 aa]
          Length = 300

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 3/99 (3%)

Query: 11  QLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDA 70
           QL +  LQ+     +   +      ++++G L   + E  L   F   G +  IR+ +D 
Sbjct: 83  QLLDRRLQNWNPNVDPHIKDTDPYRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDK 142

Query: 71  ITKTSLGYAYVNFNDHDAAKTAIEKLNF---TPIKGKLC 106
           IT+ S GYA++ F D  ++K A +++       IK ++C
Sbjct: 143 ITQKSKGYAFIVFKDPISSKMAFKEIGVHRGIQIKDRIC 181

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHF 170
           IFI  L  D+D   L   F  FG I   ++  D+ T KSKG+ ++ F
Sbjct: 109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVF 155

>CAGL0F01023g complement(108155..109345) similar to tr|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, hypothetical
           start
          Length = 396

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           S++VG+LD    E  L+  F   G++  +R+ RD  T    G+AYV FN+  +   A+  
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKALL- 287

Query: 96  LNFTPI 101
           LN  P+
Sbjct: 288 LNEKPM 293

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHF 170
           ++F+ NL  + D ++L+  F   G+I   ++  D +T   KGF YV F
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQF 276

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 46/86 (53%), Gaps = 10/86 (11%)

Query: 320 NLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTT-ENGKSKGFGFVCFSTPEEATKAITE 378
           ++F+ NLD   D++ L + F   G+I   +++   +    KGF +V F+  +  +KA+  
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKAL-- 286

Query: 379 KNQQIVAGKPLYVAIAQRKDVRRSQL 404
               ++  KP+   I+Q + +++ +L
Sbjct: 287 ----LLNEKPM---ISQNEHLKKRKL 305

>CAGL0H04763g 454589..455740 highly similar to sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3, hypothetical
           start
          Length = 383

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKN 380
           LF++     + + +L E F P+G +   K++        GF FV F   E A+KAI E N
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKILN-------GFAFVEFEEAESASKAIEEVN 159

Query: 381 QQIVAGKPLYVAIAQ 395
            +  A +PL V  ++
Sbjct: 160 GKTFANQPLEVMFSK 174

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 71/172 (41%), Gaps = 15/172 (8%)

Query: 24  TNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNF 83
           T  + + E  +  L+V      V E+ L +IF P GA+  +++          G+A+V F
Sbjct: 94  TFHQQEGELSNTRLFVRPFPLDVQESELNEIFGPFGAMKEVKILN--------GFAFVEF 145

Query: 84  NDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTF 143
            + ++A  AIE++N      +   +M+S+  P  R +    I +KNL      + L D  
Sbjct: 146 EEAESASKAIEEVNGKTFANQPLEVMFSKM-PVKRFR----ITLKNLPEGCSWQELKDL- 199

Query: 144 SVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
               N L +  ++  +    G G + F            LN +   G  I V
Sbjct: 200 -ARENNLETTFSSVNSRDFDGTGALEFPTEEIMNDALEKLNNIEFRGSVISV 250

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 7/73 (9%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275
           T ++++    +  + E  E+   FG    V +         GF FV F   E A K +EE
Sbjct: 105 TRLFVRPFPLDVQESELNEIFGPFGAMKEVKIL-------NGFAFVEFEEAESASKAIEE 157

Query: 276 LNNTEFKGQPLYV 288
           +N   F  QPL V
Sbjct: 158 VNGKTFANQPLEV 170

 Score = 35.8 bits (81), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 62/166 (37%), Gaps = 24/166 (14%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +F++    D+    L + F  FG +   K+         GF +V F            +N
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKILN-------GFAFVEFEEAESASKAIEEVN 159

Query: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAK--FGKT 242
           G     Q +           E  F +M      + +KN+    + +E ++L  +     T
Sbjct: 160 GKTFANQPL-----------EVMFSKMPVKRFRITLKNLPEGCSWQELKDLARENNLETT 208

Query: 243 DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYV 288
            S V  R    +  G G + F   E     +E+LNN EF+G  + V
Sbjct: 209 FSSVNSR----DFDGTGALEFPTEEIMNDALEKLNNIEFRGSVISV 250

>YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein
           that may be involved in coping with heat stresses,
           contains one RNA recognition (RRM) domain [663 bp, 220
           aa]
          Length = 220

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%), Gaps = 21/124 (16%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE-GENKGFGFVNFVNHEDAVKCVEEL 276
           +Y+  +     +KE  +  A+FG    V L R  + G ++ +GF+ FVN EDA+   E +
Sbjct: 93  IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESM 152

Query: 277 NNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKY-------QGINLFIKNLDDS 329
           NN    G  L V    K               ++EK+ KY       +GI   +K L D+
Sbjct: 153 NNYLLMGHLLQVRVLPK-------------GAKIEKLYKYKKRVLVEKGITKPVKQLKDN 199

Query: 330 IDDK 333
           +  K
Sbjct: 200 MKQK 203

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 313 MAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVM-TTENGKSKGFGFVCFSTPEE 371
           + +Y GI +++  L     +K+L + FA +G +   ++    + G S+ +GF+ F   E+
Sbjct: 86  LEEYSGI-IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKED 144

Query: 372 ATKAITEKNQQIVAGKPLYVAI 393
           A  A    N  ++ G  L V +
Sbjct: 145 AMIAQESMNNYLLMGHLLQVRV 166

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 122 AGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXX 180
           +G I++  L      K L   F+ FG++   ++A ++ TG S+ +G++ F          
Sbjct: 90  SGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQ 149

Query: 181 XXLNGMLLNGQ--EIYVGPHLSKKERESKF 208
             +N  LL G   ++ V P  +K E+  K+
Sbjct: 150 ESMNNYLLMGHLLQVRVLPKGAKIEKLYKY 179

>Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement
          Length = 207

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%)

Query: 26  EENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFND 85
           E+ +    SA++YVG+L    SE  +Y++FS  G +  I +  D    T  G+ +V +N 
Sbjct: 37  EDLRKSMSSATIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNT 96

Query: 86  HDAAKTAIEKLNFTPIKGKLCRI 108
              A +A++ L+ T +  +   I
Sbjct: 97  PKEALSAVKYLSDTKLDDRHISI 119

>Kwal_23.5864
          Length = 278

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 4/92 (4%)

Query: 9   AEQLENLSLQDKQEGTNEENQSETVSA----SLYVGDLDPSVSEAHLYDIFSPIGAVSSI 64
           A Q+E  +L++K    +    +  V +    +++VG L  +V+E  L   F   G +  +
Sbjct: 71  ARQIEADALKEKLSHWHPNEDANIVGSDPYRTVFVGRLPYTVTEVELQKEFVRFGEIEKV 130

Query: 65  RVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           RV RD  +  S GY ++ F +   A+TA  ++
Sbjct: 131 RVVRDKTSNKSRGYGFIMFKEELFARTACREI 162

 Score = 35.8 bits (81), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 4/85 (4%)

Query: 320 NLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENG-KSKGFGFVCFST---PEEATKA 375
            +F+  L  ++ + +L++EF  +G I   +V+  +   KS+G+GF+ F        A + 
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACRE 161

Query: 376 ITEKNQQIVAGKPLYVAIAQRKDVR 400
           I       + G+P+ V I + + V+
Sbjct: 162 IGVHRGVEIGGRPVIVDIERGRTVK 186

>ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH]
           complement(569855..569857,569915..570874) [963 bp, 320
           aa]
          Length = 320

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           +++VG L   V E  L   F   G +  +R+ RD IT    GYA+V F D + +K A  +
Sbjct: 108 TIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

Query: 96  L 96
           +
Sbjct: 168 I 168

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 44/87 (50%), Gaps = 5/87 (5%)

Query: 297 RQQELKKQYEATRMEKMAKYQGIN----LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMT 352
           ++QEL+++      E     QG +    +F+  L   +D+ +L++ F  +G I   +++ 
Sbjct: 81  KEQELEEELAKWAPENDTNIQGTDPFRTIFVGRLHYDVDELELQKHFIKFGEIERVRIVR 140

Query: 353 TE-NGKSKGFGFVCFSTPEEATKAITE 378
            +   K +G+ FV F  PE + KA  E
Sbjct: 141 DKITNKPRGYAFVLFRDPECSKKAYRE 167

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 4/76 (5%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXX 182
            IF+  LH D+D   L   F  FG I   ++  D+ T K +G+ +V F            
Sbjct: 108 TIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

Query: 183 L---NGMLLNGQEIYV 195
           +    G+++ G+   V
Sbjct: 168 IGVHRGLMIRGRSAIV 183

>Scas_621.16
          Length = 314

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 58/119 (48%), Gaps = 4/119 (3%)

Query: 29  QSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDA 88
           Q  + S  +Y+G +    +E  + D+ + +G V ++++  D  T  S GYA++ F D + 
Sbjct: 38  QHNSPSRIVYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLET 97

Query: 89  AKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFG 147
           + +AI  LN   +  +  +  +S  +  +    +GN+   N+   +DN   Y+  S  G
Sbjct: 98  SASAIRNLNGYQLGSRFLKCGYSSNN-DISASSSGNVHEGNI---LDNDGSYENNSKMG 152

>Scas_643.16
          Length = 448

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           S++VG+LD    E +L++ F   G +  +R+ RD  T    G+AYV F + ++   A+
Sbjct: 276 SIFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKAL 333

>ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH]
           complement(854587..855867) [1281 bp, 426 aa]
          Length = 426

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFND 85
           S++VG+LD   SE  L+  F   G +  +R+ RD  T    G+AYV F D
Sbjct: 260 SVFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFAD 309

>Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement
          Length = 257

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 42/74 (56%)

Query: 24 TNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNF 83
          +N   Q+   S  +Y+G +    +E  + D+ S +G V+++++  D  T  S GYA+V +
Sbjct: 2  SNRSVQNNPPSRVVYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEY 61

Query: 84 NDHDAAKTAIEKLN 97
           D +A+ +A+  LN
Sbjct: 62 KDLEASNSAVRNLN 75

>CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces
           cerevisiae YPL178w SAE1, start by similarity
          Length = 236

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 23  GTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVN 82
           G N+  QS   S+++YVG+L    SE  +Y++FS  G +  I +  D    T  G+ ++ 
Sbjct: 35  GLNDLRQS-LKSSTIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFII 93

Query: 83  FNDHDAAKTAIEKLNFTPIKGKLCRI 108
           +N    A  A++ L  T +  K   I
Sbjct: 94  YNTPQEALNAVKYLGDTKLDDKSITI 119

>KLLA0B10472g complement(914512..915108) similar to sgd|S0006099
           Saccharomyces cerevisiae YPL178w SAE1 small subunit of
           the nuclear cap-binding protein complex CBC, start by
           similarity
          Length = 198

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 48/100 (48%), Gaps = 1/100 (1%)

Query: 2   ADITEKTAEQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAV 61
            D  +K +  L   + +D   G  +  +S   S ++YVG+L    SE  +Y++FS  G +
Sbjct: 15  CDRLDKPSRYLIRKARRDPDSGLQQLRKS-MKSCTVYVGNLSFYTSEEQIYELFSKCGTI 73

Query: 62  SSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPI 101
             I +  D    T  G+ ++ F+  + A  +I+ L  T +
Sbjct: 74  KKIIMGLDRFKFTPCGFCFIIFDKMEDALNSIKYLGDTKL 113

>AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073)
           [933 bp, 310 aa]
          Length = 310

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%)

Query: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           L+V  L+P    A L  +F+  G V+S+ + RD  +  SLGY +V F    A + A  K+
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 97  NFTPIKGKLCRIMWSQ 112
           +   I  +   + +SQ
Sbjct: 292 DGALIDDRRVHVDFSQ 307

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXL 183
           +F+  L+P      L   F+ FG++ S ++  D ++G+S G+G+V F            +
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 184 NGMLLNGQEIYV 195
           +G L++ + ++V
Sbjct: 292 DGALIDDRRVHV 303

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTT-ENGKSKGFGFVCFSTPEEATKAITEK 379
           LF+  L+       L   FA +G + S +++   ++G+S G+GFV F+T      A T+ 
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 380 NQQIVAGKPLYVAIAQ 395
           +  ++  + ++V  +Q
Sbjct: 292 DGALIDDRRVHVDFSQ 307

>Kwal_47.18572
          Length = 363

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 7/80 (8%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKN 380
           LF++     + D +L E F P+G +   K++        GF FV F   + A +AI E N
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKIL-------NGFAFVEFEEADSAARAIEEVN 136

Query: 381 QQIVAGKPLYVAIAQRKDVR 400
            +  A +PL V  ++ +  R
Sbjct: 137 GKTFANQPLEVVYSKVQPPR 156

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 67/163 (41%), Gaps = 15/163 (9%)

Query: 31  ETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAK 90
           E  +  L+V      V ++ L +IF P G +  +++          G+A+V F + D+A 
Sbjct: 78  ELSTTRLFVRPFPFDVQDSELNEIFGPFGPMKEVKILN--------GFAFVEFEEADSAA 129

Query: 91  TAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNIL 150
            AIE++N      +   +++S+  P   +     + ++NL   +  + L D      N L
Sbjct: 130 RAIEEVNGKTFANQPLEVVYSKVQPPRYR-----MILRNLPDGVAWQELKDL--ARENNL 182

Query: 151 SSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEI 193
            +  ++  T +  G G + F            LN +   G  I
Sbjct: 183 ETTFSSVNTREFDGTGALEFPSEEILEDALQKLNNIEFRGSVI 225

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 7/73 (9%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275
           T ++++    +  D E  E+   FG    V +         GF FV F   + A + +EE
Sbjct: 82  TRLFVRPFPFDVQDSELNEIFGPFGPMKEVKI-------LNGFAFVEFEEADSAARAIEE 134

Query: 276 LNNTEFKGQPLYV 288
           +N   F  QPL V
Sbjct: 135 VNGKTFANQPLEV 147

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 64/168 (38%), Gaps = 24/168 (14%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +F++    D+ +  L + F  FG +   K+         GF +V F            +N
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKIL-------NGFAFVEFEEADSAARAIEEVN 136

Query: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAK--FGKT 242
           G     Q + V            + +++     + ++N+      +E ++L  +     T
Sbjct: 137 GKTFANQPLEV-----------VYSKVQPPRYRMILRNLPDGVAWQELKDLARENNLETT 185

Query: 243 DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNR 290
            S V  R    E  G G + F + E     +++LNN EF+G  +   R
Sbjct: 186 FSSVNTR----EFDGTGALEFPSEEILEDALQKLNNIEFRGSVITAER 229

>YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein with
           possible role in protein translation, has one RNA
           recognition (RRM) domain [753 bp, 250 aa]
          Length = 250

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 28  NQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHD 87
           +Q E  S S++VG++ P V+   + D F   G +  I +  D  T T  GY Y+ F    
Sbjct: 57  HQLEADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPA 116

Query: 88  AAKTAIEKLNFTPIKGK 104
             + A++ LN   +KGK
Sbjct: 117 YREKALQ-LNGGELKGK 132

 Score = 37.4 bits (85), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 2/73 (2%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXL 183
           IF+ N+ PD+  + + D F   G I    +  D  TG  KG+GY+ F            L
Sbjct: 66  IFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEF-ESPAYREKALQL 124

Query: 184 NGMLLNGQEIYVG 196
           NG  L G++I V 
Sbjct: 125 NGGELKGKKIAVS 137

 Score = 32.3 bits (72), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTEN-GKSKGFGFVCFSTPEEATKAI 376
           +F+ N+   +  +++E+ F   G I    ++   N G  KG+G++ F +P    KA+
Sbjct: 66  IFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKAL 122

>Scas_720.2
          Length = 245

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%)

Query: 26  EENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFND 85
           EE +    SA++YVG+L    SE  +Y++FS  G +  I +  D    T  G+ +V +++
Sbjct: 38  EELRQSLQSATIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSN 97

Query: 86  HDAAKTAIEKLNFTPIKGKLCRI 108
              A  A++ L+ T +  K   I
Sbjct: 98  AQEALNALKYLSDTKLDDKHITI 120

>Kwal_27.11096
          Length = 201

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%)

Query: 26  EENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFND 85
           E+ +    SA++YVG+L    SE  +Y++FS  G +  I +  D    T  G+ +V +N 
Sbjct: 37  EDLRRSMRSATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNT 96

Query: 86  HDAAKTAIEKLNFTPIKGK 104
            + A  A++ L+ T +  +
Sbjct: 97  PEEALNAVKYLSDTKLDDR 115

>Kwal_26.7522
          Length = 262

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 42/74 (56%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           S ++Y+G +    +E  + D+ S +G V ++++  D  T  S GYA+V + D +A+ +A+
Sbjct: 11  SRTVYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAV 70

Query: 94  EKLNFTPIKGKLCR 107
             LN   +  +L +
Sbjct: 71  RNLNGYQLGNRLLK 84

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXL 183
           +++ ++  D   + + D  S  G +++ K+  D +TGKSKG+ +V +            L
Sbjct: 14  VYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAVRNL 73

Query: 184 NG 185
           NG
Sbjct: 74  NG 75

>Scas_709.2*
          Length = 171

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 35 ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
          A +Y+G LD  ++E  +  +FS  G    + +  D  T  S G+A++ + D  +   AI+
Sbjct: 34 AYIYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLAID 93

Query: 95 KLN 97
           LN
Sbjct: 94 NLN 96

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/75 (21%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 218 VYIKNINTETTDKEFEELVAKFG-KTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEEL 276
           +YI  ++ E T+ +   + +++G   D +++     GE+KGF F+ + +    V  ++ L
Sbjct: 36  IYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNL 95

Query: 277 NNTEFKGQPLYVNRA 291
           N  +     + V+  
Sbjct: 96  NGVKVGSNTIQVDHT 110

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 57/128 (44%), Gaps = 9/128 (7%)

Query: 108 IMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFG 166
           I+ +++    + K    I+I  L  ++    +   FS +G  +   +  D +TG+SKGF 
Sbjct: 19  ILTTEQSWHYQYKDQAYIYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFA 78

Query: 167 YVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERESKFE-------EMKANFTNVY 219
           ++ +            LNG+ +    I V  H   + R+ +++       E++ +F    
Sbjct: 79  FLKYEDQRSTVLAIDNLNGVKVGSNTIQV-DHTFYEPRDEQWDYRETMKNELEKDFVVRG 137

Query: 220 IKNINTET 227
           I N+ +ET
Sbjct: 138 IPNLPSET 145

>KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces
          cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
          processing factor CF I singleton, hypothetical start
          Length = 258

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%)

Query: 34 SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
          S ++Y+G +    +E  + D+   IG V+++++  D  T  S GYA++ F D   + +A+
Sbjct: 7  SRTVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAV 66

Query: 94 EKLN 97
            LN
Sbjct: 67 RNLN 70

 Score = 32.3 bits (72), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 32/74 (43%), Gaps = 1/74 (1%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXX 182
            +++ ++  D   + + D     G + + K+  D  TGKSKG+ ++ F            
Sbjct: 9   TVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAVRN 68

Query: 183 LNGMLLNGQEIYVG 196
           LNG  L  + +  G
Sbjct: 69  LNGYTLGSRSLKCG 82

>CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces
           cerevisiae YIL061c SNP1 U1 small nuclear
           ribonucleoprotein, hypothetical start
          Length = 299

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95
           +++VG L     E  L  +F+  G +  +RV RD   K S GYA+V F + D+A+     
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNK-SRGYAFVLFKETDSARVCTRD 174

Query: 96  LNF---TPIKGKLC 106
           +       I G+ C
Sbjct: 175 IGVHRGIQINGRRC 188

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%)

Query: 320 NLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEA 372
            +F+  L    D+ +L++ FA YG I   +V+  +  KS+G+ FV F   + A
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSA 168

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 3/75 (4%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXL 183
            +F+  L  D D   L   F+ +G I+  +V  D+  KS+G+ +V F            +
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSARVCTRDI 175

Query: 184 ---NGMLLNGQEIYV 195
               G+ +NG+   V
Sbjct: 176 GVHRGIQINGRRCIV 190

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 13/62 (20%), Positives = 34/62 (54%)

Query: 215 FTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVE 274
           +  V++  +  +T + + +++ AK+G+   V + R  + +++G+ FV F   + A  C  
Sbjct: 114 YKTVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSARVCTR 173

Query: 275 EL 276
           ++
Sbjct: 174 DI 175

>AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH]
          (736609..737409) [801 bp, 266 aa]
          Length = 266

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%)

Query: 34 SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
          S ++Y+G +    +E  + D+ S +G V+ +++  D  T  S GYA++ F D   + +A+
Sbjct: 10 SRTVYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAV 69

Query: 94 EKLN 97
            LN
Sbjct: 70 RNLN 73

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 37/85 (43%), Gaps = 5/85 (5%)

Query: 117 LRKKGAG----NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFX 171
           + K G G     +++ ++  D   + + D  S  G +   K+  D +TGKSKG+ ++ F 
Sbjct: 1   MNKSGNGRPSRTVYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFK 60

Query: 172 XXXXXXXXXXXLNGMLLNGQEIYVG 196
                      LNG  L  + +  G
Sbjct: 61  DLATSSSAVRNLNGYALGNRTLKCG 85

>YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of
           nuclear cap-binding protein complex [627 bp, 208 aa]
          Length = 208

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%)

Query: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           S+++YVG+L    SE  +Y++FS  G +  I +  D    T  G+ ++ ++  D A  A+
Sbjct: 45  SSTIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNAL 104

Query: 94  EKLNFTPIKGKLCRI 108
           + L+ T +  K   I
Sbjct: 105 KYLSDTKLDEKTITI 119

>KLLA0B00979g 77439..78467 some similarities with sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3 nucleolar protein
           singleton, hypothetical start
          Length = 342

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 68/170 (40%), Gaps = 17/170 (10%)

Query: 27  ENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDH 86
           ++  E     L+V    P V++A + +IF P GA+  I++          G+A+V F + 
Sbjct: 44  DDDEELSDTRLFVKPFPPDVTDAEMKEIFEPFGALKEIKILN--------GFAFVEFEEA 95

Query: 87  DAAKTAIEKLNFTPIKGKLCRIMWSQR-DPSLRKKGAGNIFIKNLHPDIDNKALYDTFSV 145
           ++A  AI+ +           +++S++  P  R      + I+NL      + L D    
Sbjct: 96  ESASQAIQNVAGKMFADYPLEVVFSKKLKPRFR------VIIRNLPEGCAWQELKDL--A 147

Query: 146 FGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
             N L +  ++  T    G G + F            LN +   G  + V
Sbjct: 148 RDNQLETTFSSVNTRDFDGTGALEFPTEEILQEAIEKLNNIEFRGSVLAV 197

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 7/88 (7%)

Query: 309 RMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFST 368
           R++   +     LF+K     + D +++E F P+G +   K++        GF FV F  
Sbjct: 42  RVDDDEELSDTRLFVKPFPPDVTDAEMKEIFEPFGALKEIKILN-------GFAFVEFEE 94

Query: 369 PEEATKAITEKNQQIVAGKPLYVAIAQR 396
            E A++AI     ++ A  PL V  +++
Sbjct: 95  AESASQAIQNVAGKMFADYPLEVVFSKK 122

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 67/168 (39%), Gaps = 24/168 (14%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +F+K   PD+ +  + + F  FG +   K+         GF +V F            + 
Sbjct: 54  LFVKPFPPDVTDAEMKEIFEPFGALKEIKILN-------GFAFVEFEEAESASQAIQNVA 106

Query: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVA--KFGKT 242
           G +     + V    SKK        +K  F  V I+N+      +E ++L    +   T
Sbjct: 107 GKMFADYPLEV--VFSKK--------LKPRF-RVIIRNLPEGCAWQELKDLARDNQLETT 155

Query: 243 DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNR 290
            S V  R    +  G G + F   E   + +E+LNN EF+G  L V +
Sbjct: 156 FSSVNTR----DFDGTGALEFPTEEILQEAIEKLNNIEFRGSVLAVEK 199

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 7/78 (8%)

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275
           T +++K    + TD E +E+   FG    + +         GF FV F   E A + ++ 
Sbjct: 52  TRLFVKPFPPDVTDAEMKEIFEPFGALKEIKI-------LNGFAFVEFEEAESASQAIQN 104

Query: 276 LNNTEFKGQPLYVNRAQK 293
           +    F   PL V  ++K
Sbjct: 105 VAGKMFADYPLEVVFSKK 122

>Scas_717.41
          Length = 379

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 8/84 (9%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKN 380
           LF++     + + +L E F P+G +   K++        GF FV F   + A KAI E N
Sbjct: 85  LFVRPFPFDVQEAELNEIFTPFGPMKEVKILN-------GFAFVEFEEADSAAKAIEEVN 137

Query: 381 QQIVAGKPLYVAIAQRKDVRRSQL 404
            +  A +PL V +  +  V+R +L
Sbjct: 138 GKTFANQPLEV-VYSKLPVKRYRL 160

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 8/86 (9%)

Query: 27  ENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDH 86
           + + E  +  L+V      V EA L +IF+P G +  +++          G+A+V F + 
Sbjct: 75  DQEGELSTTRLFVRPFPFDVQEAELNEIFTPFGPMKEVKILN--------GFAFVEFEEA 126

Query: 87  DAAKTAIEKLNFTPIKGKLCRIMWSQ 112
           D+A  AIE++N      +   +++S+
Sbjct: 127 DSAAKAIEEVNGKTFANQPLEVVYSK 152

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 209 EEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHED 268
           +E + + T ++++    +  + E  E+   FG    V +         GF FV F   + 
Sbjct: 76  QEGELSTTRLFVRPFPFDVQEAELNEIFTPFGPMKEVKI-------LNGFAFVEFEEADS 128

Query: 269 AVKCVEELNNTEFKGQPLYV 288
           A K +EE+N   F  QPL V
Sbjct: 129 AAKAIEEVNGKTFANQPLEV 148

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 65/168 (38%), Gaps = 24/168 (14%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +F++    D+    L + F+ FG +   K+         GF +V F            +N
Sbjct: 85  LFVRPFPFDVQEAELNEIFTPFGPMKEVKILN-------GFAFVEFEEADSAAKAIEEVN 137

Query: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFG--KT 242
           G     Q + V            + ++      + ++N+    + +E ++L  +     T
Sbjct: 138 GKTFANQPLEV-----------VYSKLPVKRYRLTLRNLPEGCSWQELKDLAREHSLETT 186

Query: 243 DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNR 290
            S V  R    +  G G + F N E     +E+LNN EF+G  + V R
Sbjct: 187 FSSVNTR----DFDGTGALEFANEETLDTALEKLNNIEFRGSVITVER 230

>KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor
           singleton, start by similarity
          Length = 432

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 94/210 (44%), Gaps = 16/210 (7%)

Query: 10  EQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPI--GAVSSIRVC 67
           + L  +S   K+ G ++    +   ++++V +  P    + L ++ S      + SIR+ 
Sbjct: 88  QALTAVSRTLKKIGFHQITVEQLTDSTIWVTNFPPGYDASKLRNLLSQYIDSPILSIRLP 147

Query: 68  RDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKG-KLCRIMWSQRDPSLRKKGAGN-- 124
             A   +   +AYV+    + AK A  +LN   I   KL   + +  + + R   A +  
Sbjct: 148 SLAFN-SRRRFAYVDLVSPEVAKKATNRLNGIEINNYKLVAKISNVNERTERTDNAISDG 206

Query: 125 --IFIKNLHPDIDNKALYDTFSVFGNILSSKVAT-DET--GKSKGFGYVHFXXXXXXXXX 179
             I +KNL  DI    L   F+ FG+   +++ T DET  G+   + ++ F         
Sbjct: 207 REIIVKNLPDDITIDDLIKMFNEFGDTEKARIVTGDETNPGRHSRYAFITF-KNKASADN 265

Query: 180 XXXLNGMLLNGQEIYVGPHLSKKERESKFE 209
              LNG ++NG+ +    H+SK  R++  E
Sbjct: 266 ALSLNGAVMNGKPL----HVSKVMRKAYLE 291

>Sklu_2060.3 YIR009W, Contig c2060 4599-4931
          Length = 110

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 48/103 (46%), Gaps = 10/103 (9%)

Query: 20  KQEGTNEENQSETVSA-SLYVGDLD----PSVSEAHLYDIFSPIGAVSSIRVCRDAITKT 74
           K +G + E Q ET    +LYV +L+    P+    +LY +FS  G V  +     ++T  
Sbjct: 12  KLQGESHEGQPETSPKNTLYVNNLNDQIRPNTLRENLYLLFSTYGEVIQV-----SMTSK 66

Query: 75  SLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSL 117
             G A+V     + A  A+  L   P  GK  RI +S+ D  L
Sbjct: 67  ERGQAFVLLRTMNEANLAMISLQDEPFFGKPLRIRFSRTDSQL 109

>KLLA0E19118g 1694566..1696524 some similarities with sp|Q08925
           Saccharomyces cerevisiae YPL184c, hypothetical start
          Length = 652

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 86/195 (44%), Gaps = 44/195 (22%)

Query: 4   ITEKTAEQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSS 63
           I + TAE    LSLQ  Q   N  + +   S ++Y+G++  +++   L D +   G V  
Sbjct: 203 IAQFTAEANLPLSLQSGQL-NNPRDFTTAPSRTVYLGNIPATITYKALLD-YVRTGVVEE 260

Query: 64  IRVCRDAITKTSLGYAYVNFNDHDAA-----KTAIEKLNFTPIKGKLCRIMWSQR---DP 115
           +++  + +       A+V+F D + A        +++LN   I G+  +I W +    DP
Sbjct: 261 VKILSEKMC------AFVSFVDENDALLFHSDAILKRLN---IDGRDIKIGWGKPQPIDP 311

Query: 116 SLRKKGAG-----NIFIKNLHPDIDN---------------KALYDTFSVFGNILSSKVA 155
            +R   A      N++I  L+ + D+               + LYD  S FG I S K+ 
Sbjct: 312 IVRAGIANDGATRNVYIGKLNTNKDSCEKWGADPKEILVTKEKLYDDLSQFGEIESIKLV 371

Query: 156 TDETGKSKGFGYVHF 170
            D     +G  +VHF
Sbjct: 372 ED-----RGIAFVHF 381

>Kwal_55.20903
          Length = 147

 Score = 39.7 bits (91), Expect = 0.001,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 28  NQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHD 87
           +QSET S S+++ D+   +S   L D F  +G++  I +      K+  GYAYV F    
Sbjct: 52  DQSETDSRSIFLRDIPSDISLPSLEDHFRDMGSICRITMISKQ-RKSGTGYAYVEFATKA 110

Query: 88  AAKTAIEKLNFTPIKGKLCRIMWSQRD-PSLRKK 120
           +A+ A+E L+ + ++G   R+   + + P +R K
Sbjct: 111 SAERALE-LDGSILRGHKLRVARKRTNVPRMRVK 143

 Score = 36.2 bits (82), Expect = 0.022,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 55/119 (46%), Gaps = 10/119 (8%)

Query: 294 KYERQQELKKQYEATRMEKMAKYQGIN--------LFIKNLDDSIDDKKLEEEFAPYGTI 345
           K      LK    ++  E  AK + I+        +F++++   I    LE+ F   G+I
Sbjct: 26  KIRHSPALKSSNRSSHQESAAKGENIDQSETDSRSIFLRDIPSDISLPSLEDHFRDMGSI 85

Query: 346 TSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQL 404
               +++ +     G+ +V F+T   A +A+ E +  I+ G  L VA  +R +V R ++
Sbjct: 86  CRITMISKQRKSGTGYAYVEFATKASAERAL-ELDGSILRGHKLRVA-RKRTNVPRMRV 142

 Score = 30.0 bits (66), Expect = 3.1,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXL 183
           +IF++++  DI   +L D F   G+I    + + +     G+ YV F            L
Sbjct: 60  SIFLRDIPSDISLPSLEDHFRDMGSICRITMISKQRKSGTGYAYVEF-ATKASAERALEL 118

Query: 184 NGMLLNGQEIYVG 196
           +G +L G ++ V 
Sbjct: 119 DGSILRGHKLRVA 131

>ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH]
           complement(734486..735007) [522 bp, 173 aa]
          Length = 173

 Score = 40.0 bits (92), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 50/99 (50%), Gaps = 4/99 (4%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE-GENKGFGFVNFVNHEDAVKCVEEL 276
           ++   +N E T+ +   + ++FG    + L R  E GE++GFGF+ + +    V  V+ L
Sbjct: 36  IHFSGLNVELTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNL 95

Query: 277 NNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAK 315
           N     G+ L V+     YE + E  + Y  T  E++A+
Sbjct: 96  NGVNLCGRVLKVDHC--FYEPRDE-DEAYVKTVREELAR 131

 Score = 31.6 bits (70), Expect = 1.1,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 120 KGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXX 178
           K    I    L+ ++    +   FS FG     K+  D ETG+S+GFG++ +        
Sbjct: 31  KDQAYIHFSGLNVELTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVL 90

Query: 179 XXXXLNGMLLNGQEIYV 195
               LNG+ L G+ + V
Sbjct: 91  AVDNLNGVNLCGRVLKV 107

>YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved in
           18S and 25S rRNA processing, export of RNA from the
           nucleus, import of proteins into the nucleus, associated
           with U1 snRNP, has 2 RNA recognition (RRM) domains [1245
           bp, 414 aa]
          Length = 414

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 7/75 (9%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKN 380
           LF++     + + +L E F P+G +   K++        GF FV F   E A KAI E +
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKILN-------GFAFVEFEEAESAAKAIEEVH 179

Query: 381 QQIVAGKPLYVAIAQ 395
            +  A +PL V  ++
Sbjct: 180 GKSFANQPLEVVYSK 194

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 7/93 (7%)

Query: 196 GPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGEN 255
           G H+  +      +E + + T ++++    +  + E  E+   FG    V +        
Sbjct: 105 GEHMHGRPPMHHRQEGELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKI-------L 157

Query: 256 KGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYV 288
            GF FV F   E A K +EE++   F  QPL V
Sbjct: 158 NGFAFVEFEEAESAAKAIEEVHGKSFANQPLEV 190

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 73/179 (40%), Gaps = 22/179 (12%)

Query: 17  LQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSL 76
           +  +QEG       E  +  L+V      V E+ L +IF P G +  +++          
Sbjct: 114 MHHRQEG-------ELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILN-------- 158

Query: 77  GYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDN 136
           G+A+V F + ++A  AIE+++      +   +++S+  P+ R +    I +KNL      
Sbjct: 159 GFAFVEFEEAESAAKAIEEVHGKSFANQPLEVVYSKL-PAKRYR----ITMKNLPEGCSW 213

Query: 137 KALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEIYV 195
           + L D      N L +  ++  T    G G + F            LN +   G  I V
Sbjct: 214 QDLKDL--ARENSLETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITV 270

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 66/168 (39%), Gaps = 24/168 (14%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLN 184
           +F++    D+    L + F  FG +   K+         GF +V F            ++
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKILN-------GFAFVEFEEAESAAKAIEEVH 179

Query: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAK--FGKT 242
           G     Q + V            + ++ A    + +KN+    + ++ ++L  +     T
Sbjct: 180 GKSFANQPLEV-----------VYSKLPAKRYRITMKNLPEGCSWQDLKDLARENSLETT 228

Query: 243 DSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNR 290
            S V  R    +  G G + F + E  V+ +E LNN EF+G  + V R
Sbjct: 229 FSSVNTR----DFDGTGALEFPSEEILVEALERLNNIEFRGSVITVER 272

>Scas_530.4
          Length = 684

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/333 (19%), Positives = 119/333 (35%), Gaps = 63/333 (18%)

Query: 114 DPSLRKKGAGNIFI----KNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVH 169
           +P+ R + +  +F+     NLH D    ++ D F  FG I+  KV  D+  +   + +V 
Sbjct: 132 EPTFRGRPSSCVFVASLASNLHDDELCLSVTDYFKKFGEIIRVKVLRDQANRP--YAFVQ 189

Query: 170 FXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTD 229
           +             +G +LNG+ +             + E  + N T     N   E   
Sbjct: 190 YTNDNDANVALKEAHGSILNGRRL-------------RCERARVNRTLFITHNSPIELF- 235

Query: 230 KEFEELVAKFGKTDSVVLERTPEG---------ENKGFGFVNFVNHEDAVKCVEEL-NNT 279
            E   +  KFG+ D +V +R              N    F  F   +DA++    L  ++
Sbjct: 236 -EVHAICRKFGELDQLVPKRDDNPFMRRCSYPISNSSSWFAQFTFRDDAIRAFANLKTDS 294

Query: 280 EFKGQ-------PLYVNRAQKKYERQQE----LKKQYEATRMEKMAKYQGIN-------- 320
            +  Q       P + N   K     +E       Q +    +        N        
Sbjct: 295 NWAVQWAQNIRVPKFFNLLNKDSPMDKENITNFNSQEDGADTDPTHDNNLNNDNMQPVTI 354

Query: 321 ----LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAI 376
               +F+  L +   ++ L+  F+ +G I    ++   +     F F+ + T   A  A+
Sbjct: 355 DKKSIFVGQLPEETTEEVLKIHFSKHGKILDLNLI---HKPKNVFAFIQYETENAAAIAL 411

Query: 377 TEKNQQIVAGKPLYV------AIAQRKDVRRSQ 403
             +N  I   K ++V       I  R++ +RSQ
Sbjct: 412 ETENHSIFISKTIHVQYKEIGGIHGRRNSKRSQ 444

>Scas_565.8
          Length = 322

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 6/73 (8%)

Query: 222 NINTETTDKEFEELVAKFGK------TDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275
           N+   T+D E EEL+  FGK      T+S+   R  +  + G+ +V F   + A     E
Sbjct: 23  NVRFNTSDAELEELLKPFGKVSVLTPTESLFGFRGTKVVSIGYAYVIFETPQLAATAFNE 82

Query: 276 LNNTEFKGQPLYV 288
           L+ TEFKG+ LY+
Sbjct: 83  LHKTEFKGRTLYI 95

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 31  ETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAI----TKT-SLGYAYVNFND 85
           E  +  L   ++  + S+A L ++  P G VS +           TK  S+GYAYV F  
Sbjct: 13  EITTHKLVFTNVRFNTSDAELEELLKPFGKVSVLTPTESLFGFRGTKVVSIGYAYVIFET 72

Query: 86  HDAAKTAIEKLNFTPIKGKLCRI 108
              A TA  +L+ T  KG+   I
Sbjct: 73  PQLAATAFNELHKTEFKGRTLYI 95

>CAGL0J02200g complement(215042..215476) similar to sp|P40561
           Saccharomyces cerevisiae YIR001c SGN1, hypothetical
           start
          Length = 144

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 10/104 (9%)

Query: 1   MADITEKTAEQLENLSL-------QDKQEGTNEEN---QSETVSASLYVGDLDPSVSEAH 50
           MA   +K +E  ENL++       Q     T E+    Q E  + S+Y+G++    +   
Sbjct: 1   MAISPQKISEIFENLNVSSNNVTTQSNSRLTREQKHALQLEADACSIYIGNISLDTTPEE 60

Query: 51  LYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
           + + F   G +  I +  D  T  S+GYAYV F+  D+   A++
Sbjct: 61  IDEHFKSCGVIKRITMLYDKNTGPSIGYAYVEFDSIDSRDKALD 104

>AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH]
           complement(18862..19482) [621 bp, 206 aa]
          Length = 206

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE-GENKGFGFVNFVNHEDAVKCVEEL 276
           +YI  +     ++E     A+FG    V L R  + G ++ + F+ F N +DAV   E +
Sbjct: 80  IYISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANPDDAVVAQETM 139

Query: 277 NNTEFKGQPLYVN 289
           +N    G  L V+
Sbjct: 140 HNYLLMGHLLQVS 152

>Scas_570.14
          Length = 113

 Score = 36.6 bits (83), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 321 LFIKNLDDSIDDKKLEEE----FAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAI 376
           L++ NLD+ I+ K+L       F+ YG +    +      K +G  F+   T +EA  A+
Sbjct: 32  LYVNNLDEKINTKRLRTNLFLLFSIYGEVLKVAISA---KKQRGQAFITMRTVDEANLAL 88

Query: 377 TEKNQQIVAGKPLYVAIAQ 395
              N +    KPL++  ++
Sbjct: 89  ISLNNEPFFDKPLHIQFSK 107

>Scas_241.1
          Length = 186

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 35  ASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIE 94
            ++++G L   VSE  L   F P G +  +++       T  G  +V + D  +A+ AI 
Sbjct: 26  TTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKI------PTGKGCGFVQYVDRLSAELAIS 79

Query: 95  KLNFTPIKGKLCRIMWSQ 112
           K+   P+     R+ W +
Sbjct: 80  KMQGFPLANSRIRLSWGR 97

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 12/91 (13%)

Query: 288 VNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITS 347
           +N +Q  Y  QQ+         +  +       +FI  L   + +  L + F P+G I  
Sbjct: 2   LNSSQFMYPVQQQ-------PTLNHLTDPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIY 54

Query: 348 AKVMTTENGKSKGFGFVCFSTPEEATKAITE 378
            K+ T      KG GFV +     A  AI++
Sbjct: 55  VKIPT-----GKGCGFVQYVDRLSAELAISK 80

>Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement
          Length = 284

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 7/86 (8%)

Query: 15  LSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKT 74
           LS +D+Q       Q E  S S++VG++ PS +   L   F   G +  + +  +  T  
Sbjct: 68  LSREDRQA-----RQIELDSRSIFVGNISPSTTPESLEAHFEDAGVIKRVTILYNKHTGA 122

Query: 75  SLGYAYVNFNDHDAAK--TAIEKLNF 98
             GYAY+ F   D+ +  +A ++ +F
Sbjct: 123 PKGYAYIEFESKDSVEKGSAFDQSDF 148

>Kwal_33.13496
          Length = 330

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATD-ETGKSKGFGYVHFXXXXXXXXXXXXL 183
           +FI  L+P    K L   FS FG I   ++  D ETG S  +G++ F            +
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 184 NGMLLNGQEIYV 195
            G+L++ + I+V
Sbjct: 309 EGVLIDDRRIHV 320

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 34/76 (44%)

Query: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96
           L++  L+P      L  IFS  G +  + + RD  T  SL Y ++ F +  + + A  K+
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 97  NFTPIKGKLCRIMWSQ 112
               I  +   + + Q
Sbjct: 309 EGVLIDDRRIHVDFCQ 324

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 1/76 (1%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVM-TTENGKSKGFGFVCFSTPEEATKAITEK 379
           LFI  L+     K L   F+ +GTI   +++   E G S  +GF+ F+       A ++ 
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 380 NQQIVAGKPLYVAIAQ 395
              ++  + ++V   Q
Sbjct: 309 EGVLIDDRRIHVDFCQ 324

>YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein
           with weak similarity to S. pombe poly(A)-binding protein
           (SP:P31209), has one RNA recognition (RRM) domain [870
           bp, 289 aa]
          Length = 289

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 64/140 (45%), Gaps = 15/140 (10%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENK----------GFGFVNFVNHE 267
           VYI N+    ++++    +  +G +  ++  +T    +K          G  F  F N+ 
Sbjct: 20  VYISNLPFTASERDLHAFLNNYGASSVLIPTQTVRRFSKRHNSNPRKPLGIAFAQFANNT 79

Query: 268 DAVKCVEELNNTEFKGQPLYVNRAQKKYERQQ----ELKKQYEATRMEKMAKYQGINLFI 323
            A+K +++LN T F+ Q L++ +    YE       ++KK  E  +++K  +     ++ 
Sbjct: 80  LALKAIQDLNGTVFQNQKLFL-KLHVPYEADSTPDTDVKKPKEKNKVKKTPETAADTVYC 138

Query: 324 KNLDDSIDDKKLEEEFAPYG 343
            +L D I D ++ E F  Y 
Sbjct: 139 HDLPDDITDSEIRELFQLYS 158

>KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4
           Ashbya gossypii Yib1, hypothetical start
          Length = 345

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%)

Query: 27  ENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDH 86
           E Q E  S S++VG++    +   L + F   G V  + +  + +T    GYAY+ F   
Sbjct: 95  EKQIELDSRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEFESS 154

Query: 87  DAAKTAIE 94
           D+   A+E
Sbjct: 155 DSIPKALE 162

 Score = 35.8 bits (81), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 47/96 (48%), Gaps = 2/96 (2%)

Query: 298 QQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTE-NG 356
           +++   Q  A R+EK  +    ++F+ N+      + LEE F   G +    ++  +  G
Sbjct: 82  KKDHHHQSRAERLEKQIELDSRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTG 141

Query: 357 KSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 392
             KG+ ++ F + +   KA+  K+ ++  G+ + VA
Sbjct: 142 APKGYAYIEFESSDSIPKALELKDSEL-HGETINVA 176

>KLLA0D13420g complement(1157491..1157991) some similarities with
           sp|P40565 Saccharomyces cerevisiae YIR005w IST3
           singleton, hypothetical start
          Length = 166

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 47/107 (43%), Gaps = 2/107 (1%)

Query: 106 CRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDET-GKSKG 164
           C I+  +       K    I    +H ++    +   FS +G  +  K+  D+T GKSKG
Sbjct: 17  CGILKPESSWHHEYKDQAYINFGGMHLELTEADILTIFSQYGCPVDIKLVRDQTTGKSKG 76

Query: 165 FGYVHFXXXXXXXXXXXXLNGMLLNGQEIYVGPHLSK-KERESKFEE 210
           FG++ +            LNG  + G+ I V     + +  E+++EE
Sbjct: 77  FGFLKYEDQRSTILAVDNLNGAKVCGRLIRVDHAFYRPRSDEAEYEE 123

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 49/96 (51%), Gaps = 10/96 (10%)

Query: 223 INTETTDKEFEELVAKFGKTDSVVLERT-PEGENKGFGFVNFVNHEDAVKCVEELNNTEF 281
           ++ E T+ +   + +++G    + L R    G++KGFGF+ + +    +  V+ LN  + 
Sbjct: 41  MHLELTEADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKV 100

Query: 282 KGQPLYVNRA-------QKKYER--QQELKKQYEAT 308
            G+ + V+ A       + +YE   +QEL+K +  T
Sbjct: 101 CGRLIRVDHAFYRPRSDEAEYEEAVRQELEKDFAKT 136

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 1/54 (1%)

Query: 339 FAPYGTITSAKVMTTEN-GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           F+ YG     K++  +  GKSKGFGF+ +        A+   N   V G+ + V
Sbjct: 54  FSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRV 107

>Kwal_26.8458
          Length = 219

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE-GENKGFGFVNFVNHEDAVKCVEEL 276
           +Y+  +     ++E  +  ++FG    V L R  + G ++ +GFV FVN ED+    E +
Sbjct: 92  IYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQETM 151

Query: 277 NNTEFKGQPLYV 288
           +N    G  L V
Sbjct: 152 HNYLLMGHLLQV 163

 Score = 32.0 bits (71), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 122 AGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXX 180
           +G I++  L      + L   FS FG++   ++A ++ TG S+ +G+V F          
Sbjct: 89  SGIIYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQ 148

Query: 181 XXLNGMLLNGQEIYV 195
             ++  LL G  + V
Sbjct: 149 ETMHNYLLMGHLLQV 163

>Scas_714.59
          Length = 233

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 319 INLFIKNLDDSIDDKKLEEEFA-PYGTITSAKVMTT-ENGKSKGFGFVCFSTPEEATKAI 376
             L I  L+++ D+  L EE   P+  I    V+   E G+SKG  FV FS+ + A KA+
Sbjct: 150 CTLKIMQLNENADENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAEKAL 209

 Score = 32.0 bits (71), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 35  ASLYVGDLDPSVSEAHLYD-IFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
            +L +  L+ +  E +L + +  P   +    V R+  T  S G A+V F+    A+ A+
Sbjct: 150 CTLKIMQLNENADENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAEKAL 209

Query: 94  EKLNFTPIKGKLCRIMWSQRDPSL 117
             L+       + R+ WS+  P +
Sbjct: 210 HFLDGRGFMNLILRVEWSKPKPKV 233

>KLLA0F23650g 2210563..2211501 some similarities with sp|P53927
           Saccharomyces cerevisiae YNL110c singleton, hypothetical
           start
          Length = 312

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE-GENKGFGFVNFVNHEDAVKCVEEL 276
           +YI  +     ++E  +  ++FG    V L R  + G ++ + F+ ++N +DAV   E +
Sbjct: 185 LYISRLPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFLEYINKDDAVVAQESM 244

Query: 277 NNTEFKGQPLYV 288
           NN    G  L V
Sbjct: 245 NNYLLMGHLLKV 256

>YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein with
           weak similarity to RNA-binding proteins, contains one
           RNA recognition (RRM) domain [2007 bp, 668 aa]
          Length = 668

 Score = 37.0 bits (84), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 354 ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           +NG  +G  F  F+TPEE T+ IT  N + ++G+ L V
Sbjct: 121 DNGIFRGLAFANFTTPEETTQVITSLNGKEISGRKLKV 158

>Kwal_27.10364
          Length = 443

 Score = 37.0 bits (84), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 87/195 (44%), Gaps = 26/195 (13%)

Query: 231 EFEELVAKFGKTDSVVLERTPE---GENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLY 287
           E ++L ++FG T  V+  R P      ++ F +V+  + E+A   V+ L+        L 
Sbjct: 132 ELQKLFSQFGGT--VLSIRFPSLRYDSHRRFAYVDMASSEEAKLIVDRLHGFVVDNHELI 189

Query: 288 VNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDD-SIDDKKLEEEFAPYGTIT 346
           +     K     + +K+ ++  +E+        +++KNLD   + ++ + + F+ YG I 
Sbjct: 190 I-----KLSNPLKAEKRTDSDVLERR------QVYLKNLDYFRVSEEIISKSFSKYGHIE 238

Query: 347 SAKVMTTE----NGKSK----GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD 398
              +   E    +G  K    GFGFV FS    A  ++     ++  G+ + V +A RK 
Sbjct: 239 RISLPHKEEPGLSGAEKRLNDGFGFVTFSESTSAASSLQLDGSEL-EGRKISVTLADRKA 297

Query: 399 VRRSQLAQQIQARNQ 413
               Q  +++  R +
Sbjct: 298 YIERQAVKRLLHRKR 312

>KLLA0B11594g complement(1018044..1018388) some similarities with
           sp|P40567 Saccharomyces cerevisiae YIR009w MSL1 U2
           snRNA-associated protein with singleton, hypothetical
           start
          Length = 114

 Score = 34.3 bits (77), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 8/84 (9%)

Query: 321 LFIKNLDDSIDDKKLEEE----FAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAI 376
           +++KNL+D I  + + E     FA YG +    +  +   K +G  F+ F + +EA  A+
Sbjct: 34  VYVKNLNDQIKIQTVRESLYMLFATYGEV----IKVSMTPKQRGQAFITFKSVDEANLAL 89

Query: 377 TEKNQQIVAGKPLYVAIAQRKDVR 400
                ++   KPL +  +++   +
Sbjct: 90  LSLKDELFFNKPLVLQFSKQTTTK 113

>KLLA0B14432g 1267356..1267877 weakly similar to sp|P36036
           Saccharomyces cerevisiae YKL214c singleton, start by
           similarity
          Length = 173

 Score = 35.4 bits (80), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 3/81 (3%)

Query: 208 FEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHE 267
           F + +   T + I+NI  ET+D E E+ + + G+ +S+ +    E        V F + +
Sbjct: 43  FNDRRKRITLLRIRNIPLETSDYEIEDWINEIGEVESIRINDRKENR---VATVGFKDVQ 99

Query: 268 DAVKCVEELNNTEFKGQPLYV 288
                VE+LN  E  G  L V
Sbjct: 100 LLGTAVEKLNGKEVHGSQLEV 120

>Kwal_55.20414
          Length = 284

 Score = 35.8 bits (81), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 19/92 (20%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

Query: 203 ERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEG------ENK 256
           E  ++  E  +    +Y+ N++  TT++E  E + ++     ++  +T  G         
Sbjct: 4   EDTTQVSEASSQIKRIYVSNLDFSTTEEELSEFLKEYNVVSVLIPSQTIRGFRNSTVRPL 63

Query: 257 GFGFVNFVNHEDAVKCVEELNNTEFKGQPLYV 288
           G G+ +F + +DA    + LN  + K + L +
Sbjct: 64  GIGYADFQSAQDAQNAAQNLNGKQLKDRKLKI 95

 Score = 33.1 bits (74), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 7/93 (7%)

Query: 22  EGTNEENQSETVSASLYVGDLDPSVSEAHL------YDIFSPIGAVSSIRVCRDAITKTS 75
           E T + +++ +    +YV +LD S +E  L      Y++ S +    +IR  R++  +  
Sbjct: 4   EDTTQVSEASSQIKRIYVSNLDFSTTEEELSEFLKEYNVVSVLIPSQTIRGFRNSTVR-P 62

Query: 76  LGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRI 108
           LG  Y +F     A+ A + LN   +K +  +I
Sbjct: 63  LGIGYADFQSAQDAQNAAQNLNGKQLKDRKLKI 95

>KLLA0E01936g 183638..185092 similar to sp|Q08287 Saccharomyces
           cerevisiae YOL144w NOP8 nucleolar protein required for
           60S ribosome biogenesis singleton, start by similarity
          Length = 484

 Score = 36.2 bits (82), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 51/117 (43%), Gaps = 16/117 (13%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAV---KCVE 274
           VY+ ++ T   D  F EL A+F K   VV E     ++  FG++N +  EDA    K   
Sbjct: 6   VYVGSV-TSNQDDCFAELYARFLKFGKVVDESKSFEQHDAFGYLN-MEFEDASQFEKMKS 63

Query: 275 ELNNTEFKGQPLYVNRAQKKY-----------ERQQELKKQYEATRMEKMAKYQGIN 320
             N  +FKG  L V  A+  +           ER+ + +KQ      E   K + IN
Sbjct: 64  SFNRVKFKGNTLRVAEAKPDWKTRWEIDHKDEEREHKKRKQMAKQEWEHYKKLENIN 120

>KLLA0E00484g complement(45755..46483) similar to sp|P10080
           Saccharomyces cerevisiae YHL034c SBP1 single-strand
           nucleic acid binding protein singleton, start by
           similarity
          Length = 242

 Score = 35.4 bits (80), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 83/212 (39%), Gaps = 47/212 (22%)

Query: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKS--KGFGYVHFXXXXXXXXXXX 181
           +IF+ NL P+   + L     VFG  +  ++ T ++ ++  + F +V F           
Sbjct: 18  SIFVGNLSPETSPEDLQ---KVFGESVKVEIPTLQSDRTYPRIFAFVTFDDKVDVEDLRS 74

Query: 182 XLNGMLLNGQEIYVGPHLSKKERESK--------------------------FEEMKANF 215
             +  ++  + IYV   L+ +E++ K                           E+M+ + 
Sbjct: 75  KFDKTVIKDKSIYVTKVLTPEEQQLKKQKRRANQRGKAVPAPPKKNKEAQVPLEQMERSK 134

Query: 216 TNVYIKNINTETTDKEFEELVAKFGKTD-SVVL--ERTPEGE----------NKGFGFVN 262
             +Y+ NI   TT  E   + + FG T+ SV+L   R  +            N+G  FV+
Sbjct: 135 DTLYVNNIPYHTTKAE---IASFFGTTEESVILPMRRMKDTTTKRVFFSRKFNRGIAFVS 191

Query: 263 FVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK 294
           F    D      E N   F+ + L V+ A  K
Sbjct: 192 FPEGTDIEAKAAEFNGKNFEDRELTVDVAANK 223

>YDR429C (TIF35) [1252] chr4 complement(1324465..1325289)
           Translation initiation factor eIF3, p33 subunit,
           contains an RRM (RNA recognition motif) domain [825 bp,
           274 aa]
          Length = 274

 Score = 35.4 bits (80), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 319 INLFIKNLDDSIDDKKLEEEFA-PYGTITSAKVM-TTENGKSKGFGFVCFSTPEEATKAI 376
             L I  ++++ D+  L EE   P+  I    V+   E GKS+G  FV FS+ E A +A+
Sbjct: 191 CTLKIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQAL 250

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 55  FSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQ 112
           F+PI  VS   V R+  T  S G A+V F+  + A+ A+  L+       + R+ WS+
Sbjct: 215 FAPIPRVS---VVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNLILRVEWSK 269

>AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,
           218 aa]
          Length = 218

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 29/65 (44%)

Query: 217 NVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEEL 276
            V++     ET  ++        GK   + +      +++ F FV F  HE+ V+ VEEL
Sbjct: 6   TVHVSGFPAETRARDMAPDFEAVGKIVRIDIPPMRPFQDRPFAFVKFETHEECVRAVEEL 65

Query: 277 NNTEF 281
           +   F
Sbjct: 66  DGRPF 70

>Kwal_55.20718
          Length = 594

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKN 380
           +F+  LD    ++KL + F+ +G+IT   ++T  N     F F+ F+T E A  A+  +N
Sbjct: 202 IFVGQLDPMATEEKLLKRFSRHGSITDINLITKPNNV---FAFIKFTTEEAAAAALEMEN 258

Query: 381 QQIVAGKPLYVAIAQRKDVRRSQLAQQ 407
             I   K ++V   +   ++R +   Q
Sbjct: 259 HAIFLSKTMHVQYREIGGIKRFRRGNQ 285

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 4/48 (8%)

Query: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNF 83
           S++VG LDP  +E  L   FS  G+++ I +    ITK +  +A++ F
Sbjct: 201 SIFVGQLDPMATEEKLLKRFSRHGSITDINL----ITKPNNVFAFIKF 244

>Kwal_30.12890
          Length = 280

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%)

Query: 52  YDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWS 111
           Y++  P G +  + V R+  T  S G AYV F   + A+TA+  LN       +    WS
Sbjct: 215 YELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLNGRGFMNLILNADWS 274

Query: 112 Q 112
           +
Sbjct: 275 K 275

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 323 IKNLDDSIDDKKLEEEFA-PYGTITSAKVMTT-ENGKSKGFGFVCFSTPEEATKAI 376
           I  L+++ D+  L  E   P+G I    V+   E G+S+G  +V F T E A  A+
Sbjct: 201 IMQLNENADENTLRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETAL 256

>Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement
          Length = 221

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE-GENKGFGFVNFVNHEDAVKCVEEL 276
           +Y+  +     ++E  +  ++FG    V L R  + G ++ + F+ FVN +DA+   + +
Sbjct: 94  IYVSRLPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIEFVNKDDALVAQDTM 153

Query: 277 NNTEFKGQPLYV 288
           NN    G  L V
Sbjct: 154 NNYLILGHLLKV 165

>Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement
          Length = 309

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 37  LYVGDLDPSVSEAHL------YDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAK 90
           +Y+ +L    +E  L      Y++ S +    +IR  R++  +  LG AY +F   D AK
Sbjct: 24  VYISNLSFDTTEDELTGYLLEYNVLSVLIPSQTIRGFRNSRVR-PLGIAYADFESADKAK 82

Query: 91  TAIEKLNFTPIKGKLCRI 108
            AIE LN      +  R+
Sbjct: 83  EAIEALNGKVFNNRTLRL 100

>Scas_666.11
          Length = 224

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE-GENKGFGFVNFVNHEDAVKCVEEL 276
           +Y+  +     ++E  +  ++FG    V L R  + G ++ +GF+ F N +DA    + +
Sbjct: 96  LYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQDAM 155

Query: 277 NNTEFKGQPLYV 288
           NN    G  L V
Sbjct: 156 NNYLVMGHLLQV 167

 Score = 32.0 bits (71), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 51/109 (46%), Gaps = 5/109 (4%)

Query: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDE-TGKSKGFGYVHFXXXXXXXXXXXXL 183
           +++  L      + L   FS FG++   ++A ++ TG S+ +G++ F            +
Sbjct: 96  LYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQDAM 155

Query: 184 NGMLLNGQ--EIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDK 230
           N  L+ G   ++ + P  +K E+  K++  K  FT + IK    E  ++
Sbjct: 156 NNYLVMGHLLQVRLLPKGAKIEKLYKYK--KRAFTQMKIKKTAKELKER 202

>CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces
           cerevisiae YBL051c, hypothetical start
          Length = 639

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 354 ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           +NG  +G  F  FSTPE+ ++ I++ N + + G+ L V
Sbjct: 92  DNGIFRGLAFANFSTPEDTSRVISDLNGKEINGRKLKV 129

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 17/33 (51%)

Query: 256 KGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYV 288
           +G  F NF   ED  + + +LN  E  G+ L V
Sbjct: 97  RGLAFANFSTPEDTSRVISDLNGKEINGRKLKV 129

>ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH]
           (708437..709411) [975 bp, 324 aa]
          Length = 324

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%)

Query: 29  QSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDA 88
           Q E  S S++V  + P  +   L + F  +G +S I +  +  T    GYAY+ F    +
Sbjct: 77  QVELDSRSVFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTGEPKGYAYIQFESISS 136

Query: 89  AKTAIE 94
            + A++
Sbjct: 137 VEKALQ 142

>Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement
          Length = 281

 Score = 33.1 bits (74), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 321 LFIKNLDDSIDDKKLEEEFA-PYGTITSAKVM-TTENGKSKGFGFVCFSTPEEATKAI 376
           L I  L++  D+  + +E   P+G I    V+  TE G+S+G  ++ F T E A  A+
Sbjct: 200 LKITQLNEHADESTIRQELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETAL 257

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 7/83 (8%)

Query: 34  SASLYVGDLDPSVSEAHLY-DIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTA 92
           + +L +  L+    E+ +  ++  P G +  + V R+  T  S G +Y+ F   + A+TA
Sbjct: 197 AKTLKITQLNEHADESTIRQELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETA 256

Query: 93  IEKLNFTPIKGKLCRIM---WSQ 112
              LNF   +G +  I+   WS+
Sbjct: 257 ---LNFLDGRGFMNLILHAEWSK 276

>Scas_611.5*
          Length = 787

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 64/151 (42%), Gaps = 19/151 (12%)

Query: 8   TAEQLENLSLQDKQEGTNEENQSETVSASLYVGDLD-PSVSEAHLYDIFSPIGAVSSIRV 66
           T E+ E  S+  + E    E  +    + L++G+L   +VS+  L+ IFSP G +  I +
Sbjct: 286 TPEERERYSVYLRGENKITEMHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI 345

Query: 67  CRDAITKTSLGYAYVNFNDHDAAKTAIE----KLNFTPIKGKLCRIMWSQRDPSLRKKGA 122
                      + ++ +N+  + K AIE    ++NF   K  +  +  S   P       
Sbjct: 346 KN--------AFGFIQYNNPQSVKDAIELESDEINFD--KKLILEVSSSNSRPQFDHGDH 395

Query: 123 G----NIFIKNLHPDIDNKALYDTFSVFGNI 149
           G      FI +     DN    DT +++ +I
Sbjct: 396 GTNSSTTFISSAKRPFDNDEEDDTANMYNDI 426

>KLLA0D16049g complement(1352380..1353657) some similarities with
           sp|P43607 Saccharomyces cerevisiae YFR032c singleton,
           hypothetical start
          Length = 425

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 6/70 (8%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEG-ENK-----GFGFVNFVNHEDAVK 271
           VYI N++ E ++ +  E +  +     ++  +T  G +NK     G  +  F N EDA K
Sbjct: 7   VYISNLSFEASENQLYEYLQDYNVISVLIPSQTVRGLKNKAVRPFGIAYAEFSNEEDANK 66

Query: 272 CVEELNNTEF 281
            ++ELN   F
Sbjct: 67  VIQELNGKLF 76

>ADL064W [1677] [Homologous to ScYER068W (MOT2) - SH]
           complement(567690..569630) [1941 bp, 646 aa]
          Length = 646

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 11/88 (12%)

Query: 218 VYIKNINTETTDKEFEELV------AKFGKTDSVVLERTPEGEN---KGFG-FVNFVNHE 267
           VY+  +N     +E   L+       ++GK + +V+ R   G N    G+G +V F   E
Sbjct: 139 VYVIGLNPPVPYEEVGALLRSDKYFGQYGKINKIVVNRK-TGHNDHQTGYGIYVTFSRKE 197

Query: 268 DAVKCVEELNNTEFKGQPLYVNRAQKKY 295
           DA +C++ ++ T   G+ +       KY
Sbjct: 198 DAARCIQAVDGTFMDGRQVKAAYGTTKY 225

>YER068W (MOT2) [1499] chr5 (293048..294811) Zinc finger
           transcriptional repressor, involved in G protein
           mediated pheromone signal transduction and member of the
           CCR4-Not complex [1764 bp, 587 aa]
          Length = 587

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 35/132 (26%)

Query: 199 LSKKERESKF--EEMKAN-FTN--------------VYIKNINTETTDKEF------EEL 235
           L++KE+E K   +E K N +TN              VY+  IN     +E       E+ 
Sbjct: 103 LARKEKERKHREKERKENEYTNRKHLSGTRVIQKNLVYVVGINPPVPYEEVAPTLKSEKY 162

Query: 236 VAKFGKTDSVVLER-TPEGENK----------GFG-FVNFVNHEDAVKCVEELNNTEFKG 283
             ++GK + +V+ R TP   N           G+G ++ F + +DA +C+ +++ T   G
Sbjct: 163 FGQYGKINKIVVNRKTPHSNNTTSEHYHHHSPGYGVYITFGSKDDAARCIAQVDGTYMDG 222

Query: 284 QPLYVNRAQKKY 295
           + +       KY
Sbjct: 223 RLIKAAYGTTKY 234

>Sklu_2434.14 YOR361C, Contig c2434 32150-34360
          Length = 736

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 51  LYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLN 97
           L  +FS  G V  + +  D   KT+ GY +V F+   AAK AI  LN
Sbjct: 60  LTKLFSQAGTVVDMNLPLDEEKKTTKGYLFVEFDSAVAAKKAIALLN 106

>CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces
           cerevisiae YPL190c NAB3 polyadenylated RNA-binding
           protein, hypothetical start
          Length = 775

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 321 LFIKNLD-DSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEK 379
           LFI NL   ++  + L   F+P+G I    +          FGF+ +  P+    AI  +
Sbjct: 332 LFIGNLPLKNVSKQDLFRLFSPFGHILQINI-------KNAFGFIQYDNPKSVRAAIECE 384

Query: 380 NQQIVAGKPLYVAIA 394
           +Q+I  GK L + ++
Sbjct: 385 SQEINFGKKLILEVS 399

>ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH]
           complement(1034093..1034902) [810 bp, 269 aa]
          Length = 269

 Score = 32.3 bits (72), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%)

Query: 54  IFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQ 112
           + SP   V  + V R+  T  S G AYV F     A+TA+  L+       + ++ WS+
Sbjct: 208 LLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAETALRLLHGRGFMNLILQVDWSK 266

>AAR022W [208] [Homologous to ScYIR009W (MSL1) - SH]
           complement(381754..382098) [345 bp, 114 aa]
          Length = 114

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 8/80 (10%)

Query: 320 NLFIKNLDDSIDDKKLEEE----FAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKA 375
            L+I NL+D +    L       F+ +G +    +    + K +G  FV  ST +EA  A
Sbjct: 33  TLYISNLNDQVKISTLRTNLYLLFSTFGEVLRIAM----SPKLRGQAFVVLSTVDEANLA 88

Query: 376 ITEKNQQIVAGKPLYVAIAQ 395
           +     +   GKPL +  ++
Sbjct: 89  MISLKDESFFGKPLRIQFSK 108

>YML072C (TCB3) [3897] chr13 complement(124730..129367) Protein
           containing two C2 domains, which may be involved in
           calcium-dependent phospholipid binding, has low
           similarity to uncharacterized C. albicans Orf6.5286p
           [4638 bp, 1545 aa]
          Length = 1545

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 1/26 (3%)

Query: 453 GPNPQMANMGAMPKNGMPPHQFRNGP 478
           GPNPQ  ++GA+P  G+ P +FR+ P
Sbjct: 106 GPNPQ-GSIGAVPLEGLRPKEFRSAP 130

>Sklu_2412.4 YMR124W, Contig c2412 7729-10719
          Length = 996

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 23/50 (46%), Gaps = 9/50 (18%)

Query: 455 NPQMANMGAMPKNGM--------PPHQFRNGPVYGVPPQG-GFARNGPAA 495
           NP   N G MP  G         PP +FR  P  G PP+  GF + GP A
Sbjct: 251 NPSFPNGGQMPHYGPRANSLMSGPPQRFRQPPQGGYPPRPMGFGQEGPRA 300

>CAGL0H04675g complement(447256..448080) highly similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35, start by
           similarity
          Length = 274

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 34  SASLYVGDLDPSVSEAHLY-DIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTA 92
           S +L +  L+ +  E  L  ++  P   +  + V R+  T  S G A+V F + D A+ A
Sbjct: 188 SCTLKILQLNENADENTLRNELLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAEKA 247

Query: 93  IEKLNFTPIKGKLCRIMWSQ 112
           +  L+       + R+ WS+
Sbjct: 248 LHFLDGRGFMNLILRVDWSK 267

>Scas_589.4
          Length = 530

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 8/91 (8%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAV----KCV 273
           V++ N+     D   E+L  +FG T    ++   E  N GF ++N    ED +    K  
Sbjct: 29  VFVGNLQN-NLDASLEDLYKRFG-TFGQCVDPVFEKHN-GFAYINMT-FEDGLAGFKKLK 84

Query: 274 EELNNTEFKGQPLYVNRAQKKYERQQELKKQ 304
             LNN +FKG  L +++A+  ++   +L+++
Sbjct: 85  NSLNNVKFKGNLLVIDQAKPDWQESWKLRQE 115

>CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor,
           hypothetical start
          Length = 381

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 54/259 (20%), Positives = 96/259 (37%), Gaps = 51/259 (19%)

Query: 79  AYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNI----------FIK 128
           A V F D D A++A+ +                    +LR  G+  I          ++ 
Sbjct: 66  ARVEFADEDGARSALTR--------------------TLRNMGSNTIEVNELKDSTVWMT 105

Query: 129 NLHPDIDNKALYDTFSVFGNI-LSSKVATDETGKSKGFGYVHFXXXXXXXXXXXXLNGML 187
           N  P    + + + F     + L+ ++ +     ++ F YV              LNG  
Sbjct: 106 NYPPTFQQRDIRNIFKDHKIVALNVRLPSLRFNSNRRFAYVDLPNMESLDKAIQLLNGKD 165

Query: 188 LNGQEIYV---GPHLSKKERESKFEEMKANFTNVYIKNI-NTETTDKEFEELVAKFGKTD 243
           +NG ++ V    P    K  ++   E +     + I+N+  T        ++  K+G  D
Sbjct: 166 INGYKLVVKKSNPENRDKRSDAPVLERRE----IIIRNLPKTMLVKDTLLDIFKKYGAID 221

Query: 244 SVVLERTPEGE-------NKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK-Y 295
            +   R P+ +       N G  FV + N EDA K   E+NN       + VN +    Y
Sbjct: 222 DL---RIPKKQLEMLSDLNHGCAFVVYTNPEDA-KSALEMNNHVIDDIKISVNLSDSHAY 277

Query: 296 ERQQELKKQYEATRMEKMA 314
             ++E+ +   +   EK A
Sbjct: 278 LERKEVNRIINSKHTEKYA 296

>Kwal_26.6824
          Length = 739

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 51  LYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLN 97
           L  +FS  G V  I +  D   K + GY +V F+   +A+ AI+ LN
Sbjct: 60  LTKLFSQAGKVVDINLPLDEAKKCTKGYLFVEFDSAVSARKAIKLLN 106

>YNL286W (CUS2) [4325] chr14 (95221..96078) Suppressor of U2 snRNA
           mutations and homolog of human Tat-SF1 protein, contains
           two RNA recognition motif (RRM) domains [858 bp, 285 aa]
          Length = 285

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 11/90 (12%)

Query: 199 LSKKERESKFEEMKANFTNVYIKNINTETTD--KEFEELVAKFGKTDSVVLERTPEGENK 256
           L+K +R   F    AN  N+Y    N +  D  ++  E   + G+ DS+ +  +P   NK
Sbjct: 178 LAKADRTVIF----ANVFNIYKSYTNDDINDIQEDLLEGCEEIGQVDSISV--SP---NK 228

Query: 257 GFGFVNFVNHEDAVKCVEELNNTEFKGQPL 286
           G   V F N++ A++C + +    F GQ L
Sbjct: 229 GEATVVFKNNKVALQCCKIMTGRYFDGQKL 258

>CAGL0C03355g 337923..338852 similar to sp|P53743 Saccharomyces
           cerevisiae YNR054c, hypothetical start
          Length = 309

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 32/73 (43%), Gaps = 13/73 (17%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGF-------------GFVNFV 264
           VY+  I       +  +++++FG+ D + L+R  E ++K               G+  F+
Sbjct: 116 VYLSRIPPYMKPAKMRQILSRFGEIDRLFLKREDEAKHKQRTRGGGNKKIMYEEGWAEFI 175

Query: 265 NHEDAVKCVEELN 277
              DA  C E LN
Sbjct: 176 RKRDAKLCAETLN 188

>Sklu_2353.4 YER068W, Contig c2353 8340-10190
          Length = 616

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 42/96 (43%), Gaps = 18/96 (18%)

Query: 218 VYIKNINTETTDKEFEELV------AKFGKTDSVVLER-TPEGENK----------GFG- 259
           VY+  +N     +E   L+       ++GK + +V+ R TP  ++           G+G 
Sbjct: 135 VYVVGLNPPVPYEEVSNLLRSDKYFGQYGKINKIVVNRKTPHSDHHHSNSNTNHHTGYGI 194

Query: 260 FVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKY 295
           +V F   +DA +C+  ++ T   G+ +       KY
Sbjct: 195 YVTFSKKDDAARCIAAVDGTYMDGRLVKAAYGTTKY 230

>CAGL0J03102g 294126..295988 similar to sp|P34909 Saccharomyces
           cerevisiae YER068w MOT2 transcriptional repressor, start
           by similarity
          Length = 620

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 20/95 (21%), Positives = 43/95 (45%), Gaps = 17/95 (17%)

Query: 218 VYIKNINTETTDKEF------EELVAKFGKTDSVVLER-TPEGENK---------GFG-F 260
           VY+  +N     +E       ++   ++GK + +V+ R  P G +          G+G +
Sbjct: 139 VYVIGVNPPVPPEEVAATLKSDKYFGQYGKINKIVVNRKAPHGGSNNDHYHHHAPGYGVY 198

Query: 261 VNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKY 295
           + F + +DA +C+ +++ T   G+ +       KY
Sbjct: 199 ITFSSKDDAARCIAQVDGTYMDGRLIKAAYGTTKY 233

>Kwal_23.6516
          Length = 314

 Score = 29.6 bits (65), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 13/80 (16%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGF-------------GFVNFV 264
           VY+  I       +  +++++FG+ D + L+R  E ++K               G+  FV
Sbjct: 112 VYMSKIPPYMKPAKLRQVLSRFGELDRLFLKREDEQKHKNRVRGGGNKKPMFEEGWAEFV 171

Query: 265 NHEDAVKCVEELNNTEFKGQ 284
             +DA  C E LN     G+
Sbjct: 172 RKKDAKLCAETLNGNTIGGK 191

>ABR121C [713] [Homologous to ScYNR054C - SH] (616903..617847) [945
           bp, 314 aa]
          Length = 314

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 13/73 (17%)

Query: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE---------GENKGF----GFVNFV 264
           VY+  I       +  +++++FG  D + L+R  E         G NK      G+  F+
Sbjct: 118 VYLSKIPPYMKPAKMRQILSRFGDLDRLFLKREDEHSHRQRVKGGGNKKVMFREGWAEFI 177

Query: 265 NHEDAVKCVEELN 277
             +DA  C E LN
Sbjct: 178 RKKDAKLCAETLN 190

>Scas_598.6
          Length = 790

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 3/51 (5%)

Query: 445 PPRG-VPFNGPNPQMANMGAMPKNGMPPHQFRN-GPVYGVPPQGGFARNGP 493
           PPR  VP     PQ+  +   P N    HQ     PV G+PP+   ARN P
Sbjct: 302 PPRSKVPVGPGKPQLPRLNTTPLNNTQQHQRSPYSPVNGIPPRNA-ARNTP 351

>Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement
          Length = 761

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 13/69 (18%)

Query: 35  ASLYVGDLD-PSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93
           + L++G+L   +V++  L+ IFSP G +  I +           + ++ ++D  + K AI
Sbjct: 341 SRLFIGNLPLKNVTKEDLFRIFSPYGHIFQINIKN--------AFGFIQYDDPQSVKDAI 392

Query: 94  E----KLNF 98
           E    +LNF
Sbjct: 393 ECESQELNF 401

>Scas_674.25*
          Length = 883

 Score = 29.6 bits (65), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 60/129 (46%), Gaps = 15/129 (11%)

Query: 217 NVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGF-GFVNFVNHEDAVKCVEE 275
           N+Y  +I    TD EF + +AK  +  SVV         K F G +N++NH DA    ++
Sbjct: 755 NIY-GSIPLRKTDPEFSKSLAKIDEGTSVV--------KKYFHGLLNYINHNDASLLNDD 805

Query: 276 LNNTEF-----KGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSI 330
             +  F         L +   +  + ++  LK+++ +   +K+   +     IKNL +S+
Sbjct: 806 DGDLAFFINQMPDTELNMTFPEWIHYKKDLLKREFASDMKKKLVLARNKFDVIKNLVESL 865

Query: 331 DDKKLEEEF 339
           +D +  +E 
Sbjct: 866 EDNEDNDEL 874

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,854,027
Number of extensions: 865181
Number of successful extensions: 3869
Number of sequences better than 10.0: 259
Number of HSP's gapped: 3401
Number of HSP's successfully gapped: 647
Length of query: 570
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 463
Effective length of database: 12,891,983
Effective search space: 5968988129
Effective search space used: 5968988129
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)