Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L11770g1476133263710.0
YER164W (CHD1)1468134147640.0
Scas_576.61457133345620.0
AGR123C1422132843450.0
Kwal_56.234421435133242600.0
KLLA0C17578g1525139042220.0
Scas_665.17106058211721e-139
YOR304W (ISW2)112057711701e-138
Kwal_34.15925102558211491e-136
CAGL0I09614g103957311371e-134
AFR537W102553811211e-132
KLLA0F24838g106254211191e-132
Scas_652.17102559010941e-129
AFL040W108658710971e-128
CAGL0C01683g111559210971e-128
Scas_597.8106559510801e-126
Kwal_14.1600110251810761e-125
YBR245C (ISW1)112951910741e-125
KLLA0F06710g109659910661e-124
Kwal_23.4777130156310761e-124
AER375C128851710721e-123
KLLA0F04521g134456010711e-123
Scas_662.7134251610691e-122
YIL126W (STH1)135951710401e-118
Kwal_26.9164145455810411e-118
KLLA0B08327g153456110341e-117
AFR562C144456610201e-115
CAGL0G08756g135451410161e-115
Scas_594.7170361810251e-115
CAGL0M04807g173056110211e-114
YOR290C (SNF2)170352710131e-113
KLLA0E04048g8265588497e-97
CAGL0J02662g8445488463e-96
Kwal_47.180778095508284e-94
Scas_520.58635518174e-92
ADL098C8045478117e-92
KLLA0F07513g10485366892e-74
ACR286C10195436785e-73
CAGL0I01694g10715266602e-70
KLLA0E22726g10335486546e-70
YJR035W (RAD26)10855296522e-69
CAGL0H05533g19045336583e-69
Scas_549.410795596485e-69
Sklu_2125.310525256468e-69
AEL256C18665326531e-68
YAL019W (FUN30)11315746452e-68
AEL065C10255696385e-68
CAGL0H06193g11265446399e-68
YPL082C (MOT1)18675316469e-68
Scas_664.918595316371e-66
KLLA0E23804g18735316361e-66
Scas_548.410545386183e-65
ADR309W14863375813e-60
CAGL0M01188g14503425752e-59
Scas_646.3*14563765707e-59
KLLA0A03069g8954785617e-59
Kwal_34.160827264825475e-58
AGR379W14143335626e-58
Scas_669.2013973345601e-57
KLLA0F21758g15723265582e-57
Kwal_55.2014314943275555e-57
YDR334W15143285546e-57
CAGL0E05038g14843295502e-56
AEL297W8954865412e-56
Scas_668.188755125402e-56
Kwal_27.1138813343495482e-56
YGL150C (INO80)14893305394e-55
YGL163C (RAD54)8984935271e-54
Kwal_14.15378424835242e-54
CAGL0I04224g9424815244e-54
KLLA0E08965g14893475271e-53
YFR038W8532845171e-53
AGL212W9034744985e-51
KLLA0F11814g9314874969e-51
YBR073W (RDH54)9244784923e-50
Kwal_27.105139004824861e-49
Scas_718.409264954843e-49
CAGL0M01958g9205014711e-47
Kwal_26.712310813284401e-43
Sklu_1582.22831613742e-39
CAGL0K07766g8302122352e-19
KLLA0C05368g16051472343e-19
ADL345C7462222201e-17
KLLA0B09240g8001992173e-17
YBR114W (RAD16)7902392164e-17
Scas_591.107722342111e-16
AAR147W15801332112e-16
CAGL0G09493g14083572093e-16
Kwal_14.186813571252076e-16
Kwal_23.36607682062031e-15
Scas_721.10011371361979e-15
Scas_674.12d13231281932e-14
CAGL0A03432g11511381923e-14
YLR032W (RAD5)11691381923e-14
AFR220W10851291897e-14
Kwal_47.177719721381862e-13
YOR191W (RIS1)16191341843e-13
KLLA0F17479g11141341791e-12
Sklu_2412.711271381645e-11
CAGL0B05049g14701301565e-10
YLR247C15561631522e-09
Scas_573.915021211395e-08
AAL030C15391301297e-07
Kwal_14.128715181631271e-06
KLLA0F12166g15281291225e-06
Sklu_2234.210061081144e-05
Sklu_2432.91475102980.003
CAGL0L03047g715112830.17
Scas_588.3502142780.69
Kwal_56.24760433124741.9
Scas_415.243354714.5
CAGL0J10912g493139705.2
CAGL0E05698g59945705.3
AFR474W30778695.4
ADL273C623131698.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L11770g
         (1453 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L11770g 1254125..1258555 highly similar to sp|P32657 Saccha...  2458   0.0  
YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in ...  1839   0.0  
Scas_576.6                                                           1761   0.0  
AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..98...  1678   0.0  
Kwal_56.23442                                                        1645   0.0  
KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces...  1630   0.0  
Scas_665.17                                                           456   e-139
YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required fo...   455   e-138
Kwal_34.15925                                                         447   e-136
CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharo...   442   e-134
AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH] complement(...   436   e-132
KLLA0F24838g complement(2309842..2313030) similar to sgd|S000583...   435   e-132
Scas_652.17                                                           426   e-129
AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH] complement(...   427   e-128
CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharo...   427   e-128
Scas_597.8                                                            420   e-126
Kwal_14.1600                                                          419   e-125
YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative AT...   418   e-125
KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces c...   415   e-124
Kwal_23.4777                                                          419   e-124
AER375C [2876] [Homologous to ScYIL126W (STH1) - SH] (1332505..1...   417   e-123
KLLA0F04521g complement(435649..439683) similar to sp|P32597 Sac...   417   e-123
Scas_662.7                                                            416   e-122
YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundan...   405   e-118
Kwal_26.9164                                                          405   e-118
KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces c...   402   e-117
AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH] (1439983..1...   397   e-115
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...   395   e-115
Scas_594.7                                                            399   e-115
CAGL0M04807g complement(514847..520039) similar to sp|P22082 Sac...   397   e-114
YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component...   394   e-113
KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces c...   331   7e-97
CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces c...   330   3e-96
Kwal_47.18077                                                         323   4e-94
Scas_520.5                                                            319   4e-92
ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH] (508448..51...   317   7e-92
KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces c...   270   2e-74
ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH] (877337..8...   265   5e-73
CAGL0I01694g complement(141422..144637) similar to sp|P40352 Sac...   258   2e-70
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...   256   6e-70
YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase ...   255   2e-69
CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharo...   258   3e-69
Scas_549.4                                                            254   5e-69
Sklu_2125.3 YJR035W, Contig c2125 6474-9632                           253   8e-69
AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..16...   256   1e-68
YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p f...   253   2e-68
AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH] (511520..5...   250   5e-68
CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces c...   250   9e-68
YPL082C (MOT1) [5362] chr16 complement(398475..404078) Transcrip...   253   9e-68
Scas_664.9                                                            249   1e-66
KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces...   249   1e-66
Scas_548.4                                                            242   3e-65
ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH] complement(...   228   3e-60
CAGL0M01188g complement(132330..136682) similar to sp|Q05471 Sac...   226   2e-59
Scas_646.3*                                                           224   7e-59
KLLA0A03069g complement(271516..274203) similar to sp|P32863 Sac...   220   7e-59
Kwal_34.16082                                                         215   5e-58
AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH] complement...   221   6e-58
Scas_669.20                                                           220   1e-57
KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471 S...   219   2e-57
Kwal_55.20143                                                         218   5e-57
YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2...   218   6e-57
CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces c...   216   2e-56
AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH] complement...   213   2e-56
Scas_668.18                                                           212   2e-56
Kwal_27.11388                                                         215   2e-56
YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of...   212   4e-55
YGL163C (RAD54) [1826] chr7 complement(193711..196407) DNA-depen...   207   1e-54
Kwal_14.1537                                                          206   2e-54
CAGL0I04224g complement(369858..372686) highly similar to sp|P32...   206   4e-54
KLLA0E08965g complement(797861..802330) similar to sp|P53115 Sac...   207   1e-53
YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the Snf...   203   1e-53
AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH] complement...   196   5e-51
KLLA0F11814g complement(1089699..1092494) similar to sp|P38086 S...   195   9e-51
YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for...   194   3e-50
Kwal_27.10513                                                         191   1e-49
Scas_718.40                                                           191   3e-49
CAGL0M01958g complement(238113..240875) similar to sp|P38086 Sac...   186   1e-47
Kwal_26.7123                                                          174   1e-43
Sklu_1582.2 , Contig c1582 197-1048                                   148   2e-39
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    95   2e-19
KLLA0C05368g 481598..486415 some similarities with sgd|S0005717 ...    95   3e-19
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...    89   1e-17
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    88   3e-17
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    88   4e-17
Scas_591.10                                                            86   1e-16
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    86   2e-16
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    85   3e-16
Kwal_14.1868                                                           84   6e-16
Kwal_23.3660                                                           83   1e-15
Scas_721.100                                                           80   9e-15
Scas_674.12d                                                           79   2e-14
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    79   3e-14
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    79   3e-14
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    77   7e-14
Kwal_47.17771                                                          76   2e-13
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...    75   3e-13
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    74   1e-12
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          68   5e-11
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    65   5e-10
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    63   2e-09
Scas_573.9                                                             58   5e-08
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    54   7e-07
Kwal_14.1287                                                           54   1e-06
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    52   5e-06
Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement         49   4e-05
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              42   0.003
CAGL0L03047g 350035..352182 similar to sp|P36120 Saccharomyces c...    37   0.17 
Scas_588.3                                                             35   0.69 
Kwal_56.24760                                                          33   1.9  
Scas_415.2                                                             32   4.5  
CAGL0J10912g 1061476..1062957 highly similar to sp|P38712 Saccha...    32   5.2  
CAGL0E05698g complement(566932..568731) similar to tr|Q08961 Sac...    32   5.3  
AFR474W [3666] [Homologous to ScYGL033W (HOP2) - SH] complement(...    31   5.4  
ADL273C [1468] [Homologous to ScYOR204W (DED1) - SH; ScYPL119C (...    31   8.2  

>CAGL0L11770g 1254125..1258555 highly similar to sp|P32657
            Saccharomyces cerevisiae YER164w CHD1 transcriptional
            regulator, start by similarity
          Length = 1476

 Score = 2458 bits (6371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1202/1332 (90%), Positives = 1202/1332 (90%)

Query: 122  TAATRNVKREKQVAIPTRFSSRANKQVNYNIDYXXXXXXXXXXXXXXXXXXXXXXXXXXR 181
            TAATRNVKREKQVAIPTRFSSRANKQVNYNIDY                          R
Sbjct: 122  TAATRNVKREKQVAIPTRFSSRANKQVNYNIDYSDDDLLESEEEFDSDEDELLDEDQESR 181

Query: 182  ARSNTPPQEDVHGIDMVITHRIKEGSDKEHLAKIVPELNVCKENYEFQIKWTDQSHLHNT 241
            ARSNTPPQEDVHGIDMVITHRIKEGSDKEHLAKIVPELNVCKENYEFQIKWTDQSHLHNT
Sbjct: 182  ARSNTPPQEDVHGIDMVITHRIKEGSDKEHLAKIVPELNVCKENYEFQIKWTDQSHLHNT 241

Query: 242  WETYESLAGVKGIKRLDNYCKQYIIQEQQVRLDPYITPEDIEIMDMEHERRLDELQEFTN 301
            WETYESLAGVKGIKRLDNYCKQYIIQEQQVRLDPYITPEDIEIMDMEHERRLDELQEFTN
Sbjct: 242  WETYESLAGVKGIKRLDNYCKQYIIQEQQVRLDPYITPEDIEIMDMEHERRLDELQEFTN 301

Query: 302  PERIIDSQRVELEDGTSQLQYLVKWRHLNYDEATWEDAAEIVKIAPEPVKHFQSRQNSKI 361
            PERIIDSQRVELEDGTSQLQYLVKWRHLNYDEATWEDAAEIVKIAPEPVKHFQSRQNSKI
Sbjct: 302  PERIIDSQRVELEDGTSQLQYLVKWRHLNYDEATWEDAAEIVKIAPEPVKHFQSRQNSKI 361

Query: 362  LPQYSSNYTSERPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLG 421
            LPQYSSNYTSERPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLG
Sbjct: 362  LPQYSSNYTSERPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLG 421

Query: 422  KTVQTVAFISWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIE 481
            KTVQTVAFISWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIE
Sbjct: 422  KTVQTVAFISWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIE 481

Query: 482  REYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLY 541
            REYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLY
Sbjct: 482  REYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLY 541

Query: 542  ESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEQYIRDL 601
            ESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEQYIRDL
Sbjct: 542  ESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEQYIRDL 601

Query: 602  HKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRF 661
            HKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRF
Sbjct: 602  HKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRF 661

Query: 662  SMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXX 721
            SMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSG           
Sbjct: 662  SMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGKMVLLDKLLTR 721

Query: 722  XXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFV 781
               DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFV
Sbjct: 722  LKKDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFV 781

Query: 782  FLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVE 841
            FLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVE
Sbjct: 782  FLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVE 841

Query: 842  EEVLERARKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKL 901
            EEVLERARKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKL
Sbjct: 842  EEVLERARKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKL 901

Query: 902  EDLNLDDVLSHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPXXXXXXXXX 961
            EDLNLDDVLSHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIP         
Sbjct: 902  EDLNLDDVLSHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPEEELKKLQD 961

Query: 962  XXXRHKDEEYVKEQLEMMNRRNNALKKIKDSVNGEGSTVTXXXXXXXXXXXXAKTNDLNS 1021
               RHKDEEYVKEQLEMMNRRNNALKKIKDSVNGEGSTVT            AKTNDLNS
Sbjct: 962  EEQRHKDEEYVKEQLEMMNRRNNALKKIKDSVNGEGSTVTSDDEDGRSSRRRAKTNDLNS 1021

Query: 1022 IGDSEVRALYRAVLRFGDVTDKLDELIADGTLPVXXXXXXXXXXXXXXXXAKSIYEEEDT 1081
            IGDSEVRALYRAVLRFGDVTDKLDELIADGTLPV                AKSIYEEEDT
Sbjct: 1022 IGDSEVRALYRAVLRFGDVTDKLDELIADGTLPVKSIEKYKEILEELLDEAKSIYEEEDT 1081

Query: 1082 KRTQTLREFEAAAHEYKMKLKTGEIKAEEQEKDNPITRLTMKRREKKAILFTFHKVKSLN 1141
            KRTQTLREFEAAAHEYKMKLKTGEIKAEEQEKDNPITRLTMKRREKKAILFTFHKVKSLN
Sbjct: 1082 KRTQTLREFEAAAHEYKMKLKTGEIKAEEQEKDNPITRLTMKRREKKAILFTFHKVKSLN 1141

Query: 1142 AESIVNRCRDLEFVNNYFKTHFKNDPLEFKFDKAHPKPVTNWNCDWNQMDDEKLMVGIHK 1201
            AESIVNRCRDLEFVNNYFKTHFKNDPLEFKFDKAHPKPVTNWNCDWNQMDDEKLMVGIHK
Sbjct: 1142 AESIVNRCRDLEFVNNYFKTHFKNDPLEFKFDKAHPKPVTNWNCDWNQMDDEKLMVGIHK 1201

Query: 1202 YGYGAWAQIRDDPFLGLTNKIFLSDVSSAATDKVKEEVKQETPDATXXXXXXXXXXXXVP 1261
            YGYGAWAQIRDDPFLGLTNKIFLSDVSSAATDKVKEEVKQETPDAT            VP
Sbjct: 1202 YGYGAWAQIRDDPFLGLTNKIFLSDVSSAATDKVKEEVKQETPDATGGKRSKGRESKKVP 1261

Query: 1262 GALHLGRRVDYLIDFLQNDGKPTTGAXXXXXXXXXXRKTAAXXXXXXXXXXXTSSFSETS 1321
            GALHLGRRVDYLIDFLQNDGKPTTGA          RKTAA           TSSFSETS
Sbjct: 1262 GALHLGRRVDYLIDFLQNDGKPTTGASGSSSISESSRKTAANPRKRNRKPNNTSSFSETS 1321

Query: 1322 ASGTPELGKLDSPGQPTKRIKALPKGPASLVSRNKKTNSPQRDGNKENENGTSGAHAKEY 1381
            ASGTPELGKLDSPGQPTKRIKALPKGPASLVSRNKKTNSPQRDGNKENENGTSGAHAKEY
Sbjct: 1322 ASGTPELGKLDSPGQPTKRIKALPKGPASLVSRNKKTNSPQRDGNKENENGTSGAHAKEY 1381

Query: 1382 DSMDEEECRHTMTSMXXXXXXXXXXXXXXXXXEWAKILKSELTAIGDYIEAQAKKNKNPD 1441
            DSMDEEECRHTMTSM                 EWAKILKSELTAIGDYIEAQAKKNKNPD
Sbjct: 1382 DSMDEEECRHTMTSMRSSLKRLRRGGKGLDRREWAKILKSELTAIGDYIEAQAKKNKNPD 1441

Query: 1442 RHRKHLWSYSSN 1453
            RHRKHLWSYSSN
Sbjct: 1442 RHRKHLWSYSSN 1453

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 43/51 (84%)

Query: 1  MKEIDEEVLQNPELYGLRRSHRAVAHRPYVXXXXXXXXVPVKTRKRRSALV 51
          MKEIDEEVLQNPELYGLRRSHRAVAHRPYV        VPVKTRKRRSALV
Sbjct: 1  MKEIDEEVLQNPELYGLRRSHRAVAHRPYVDDEEDEDDVPVKTRKRRSALV 51

>YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in
            ATP-dependent nucleosome remodeling activity, member of
            the Chromodomain-Helicase-DNA-binding (CHD) family [4407
            bp, 1468 aa]
          Length = 1468

 Score = 1839 bits (4764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 909/1341 (67%), Positives = 1046/1341 (78%), Gaps = 38/1341 (2%)

Query: 134  VAIPTRFSSRANKQVNYNIDYXXXXXXXXXXXXXXXXXXXXXXXXXXRARSNTPPQEDVH 193
            V IPTRFS+R NK VNYNIDY                           A    P  ED H
Sbjct: 121  VKIPTRFSNRQNKTVNYNIDYSDDDLLESEDDYGSEEALSEENVHEASA---NPQPEDFH 177

Query: 194  GIDMVITHRIKEG-SDKEHLAKIVPELNVCKENYEFQIKWTDQSHLHNTWETYESLAGVK 252
            GID+VI HR+K    + + L K VP+LN CKENYEF IKWTD+SHLHNTWETYES+  V+
Sbjct: 178  GIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVR 237

Query: 253  GIKRLDNYCKQYIIQEQQVRLDPYITPEDIEIMDMEHERRLDELQEFTNPERIIDSQRVE 312
            G+KRLDNYCKQ+II++QQVRLDPY+T EDIEIMDME ERRLDE +EF  PERIIDSQR  
Sbjct: 238  GLKRLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRAS 297

Query: 313  LEDGTSQLQYLVKWRHLNYDEATWEDAAEIVKIAPEPVKHFQSRQNSKILPQYSSNYTSE 372
            LEDGTSQLQYLVKWR LNYDEATWE+A +IVK+APE VKHFQ+R+NSKILPQYSSNYTS+
Sbjct: 298  LEDGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQ 357

Query: 373  RPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISW 432
            RPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSK DNGILADEMGLGKTVQTVAFISW
Sbjct: 358  RPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISW 417

Query: 433  LIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKG 492
            LIFARRQNGPH++VVPLSTMPAW++TFEKWAPD++ ICYMGNQKSRD  REYEFY+NP+ 
Sbjct: 418  LIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRA 477

Query: 493  KGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANR 552
            KGKK +KFNVL+TTYEYILKDRAELGSIKWQF+AVDEAHRLKNAESSLYESLNSFKVANR
Sbjct: 478  KGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANR 537

Query: 553  LLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEQYIRDLHKRLQPFILRR 612
            +LITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQE+YI DLH+R+QPFILRR
Sbjct: 538  MLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRR 597

Query: 613  LKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMK 672
            LKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGG FS+LNIMN L K
Sbjct: 598  LKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKK 657

Query: 673  ASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIF 732
            ASNHPYLFD+AEE+VL+KFG G M+REN+LRGLIMSSG              DGHRVLIF
Sbjct: 658  ASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIF 717

Query: 733  SQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLG 792
            SQMVR+LDILGDYLSIKGINFQRLDGTVPS QRRI+IDHFN+P S+DFVFLLSTRAGGLG
Sbjct: 718  SQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLG 777

Query: 793  INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 852
            INLMTADTV+IFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM
Sbjct: 778  INLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 837

Query: 853  ILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKLEDLNLDDVLSH 912
            ILEYAIISLGVTDGNKYTKK EP+AGELS ILKFGAGNMF A DNQKKLEDLNLDDVL+H
Sbjct: 838  ILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNH 897

Query: 913  AEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPXXXXXXXXXXXXRHKDEEYV 972
            AEDHVTTPDLGESHLGGEEFLKQFEVTDYKAD+DWDDIIP            + KDEEYV
Sbjct: 898  AEDHVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDDIIPEEELKKLQDEEQKRKDEEYV 957

Query: 973  KEQLEMMNRRNNALKKIKDSVNGEGS---TVTXXXXXXXXXXXXAKTNDLNSIGDSEVRA 1029
            KEQLEMMNRR+NALKKIK+SVNG+G+   + +            A+ ND++SIG+SEVRA
Sbjct: 958  KEQLEMMNRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARANDMDSIGESEVRA 1017

Query: 1030 LYRAVLRFGDVTDKLDELIADGTLPVXXXXXXXXXXXXXXXXAKSIYEEEDTKRTQTLRE 1089
            LY+A+L+FG++ + LDELIADGTLPV                AK    EE+  R + L +
Sbjct: 1018 LYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEK 1077

Query: 1090 FEAAAHEYKMKLKTGEIKAEEQEKDNPITRLTMKRREKKAILFTFHKVKSLNAESIVNRC 1149
             E  A  Y+ KLK+GEIKAE Q KDNP+TRL++K+REKKA+LF F  VKSLNAES+++R 
Sbjct: 1078 LEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRV 1137

Query: 1150 RDLEFVNNYFKTHFKNDPLEFKFDKAHPKPVTNWNCDWNQMDDEKLMVGIHKYGYGAWAQ 1209
             DL+++ N   +++K+DPL+F      PKPV NW+ +W + +DEKL++G+ KYGYG+W Q
Sbjct: 1138 EDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQ 1197

Query: 1210 IRDDPFLGLTNKIFLSDVSSAATDKVKEEVKQETPDATXXXXXXXXXXXXVPGALHLGRR 1269
            IRDDPFLG+T+KIFL++V +    K        TP  +            VPGA+HLGRR
Sbjct: 1198 IRDDPFLGITDKIFLNEVHNPVAKKSASS-SDTTPTPSKKGKGITGSSKKVPGAIHLGRR 1256

Query: 1270 VDYLIDFLQ---NDGKPTTGAXXXXXXXXXXRKTAAXXXXXXXXXXXTSSFSETSASGTP 1326
            VDYL+ FL+   N   P+             +K                  +  S S TP
Sbjct: 1257 VDYLLSFLRGGLNTKSPSADIGSKKLPTGPSKKRQRKP-------------ANHSKSMTP 1303

Query: 1327 ELGKLD-SPGQPTKRIKALPKGPASLVSRNKKT-NSP--------QRD-GNKENENGTSG 1375
            E+   + + G P+KR+KALPKGPA+L++  + + NSP         RD G +++ N +SG
Sbjct: 1304 EITSSEPANGPPSKRMKALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNPSSG 1363

Query: 1376 -AHAKEYDSMDEEECRHTMTSMXXXXXXXXXXXXXXXXXEWAKILKSELTAIGDYIEAQ- 1433
             AH KEYDSMDEE+CRHTM+++                 EWAKILK+ELT IG++IE+Q 
Sbjct: 1364 SAHEKEYDSMDEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQK 1423

Query: 1434 -AKKNKNPDRHRKHLWSYSSN 1453
             + +  +P+++RKHLWSYS+N
Sbjct: 1424 GSSRKASPEKYRKHLWSYSAN 1444

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/26 (80%), Positives = 23/26 (88%)

Query: 2  KEIDEEVLQNPELYGLRRSHRAVAHR 27
          K+I  EVLQNPELYGLRRSHRA AH+
Sbjct: 4  KDISTEVLQNPELYGLRRSHRAAAHQ 29

>Scas_576.6
          Length = 1457

 Score = 1761 bits (4562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 884/1333 (66%), Positives = 1003/1333 (75%), Gaps = 36/1333 (2%)

Query: 135  AIPTRFSSRANKQVNYNIDYXXXXXXXXXXXXXXXXXXXXXXXXXXRA-----RSNTPPQ 189
             +P RFS R NK VNYN+DY                                  S TP  
Sbjct: 121  GVPVRFSERNNKTVNYNVDYSDDDLLVSEEDYDMNSDDEDEENDEEDTGNRLEYSATPQL 180

Query: 190  EDVHGIDMVITHRIKEGSDKEHLAKIVPELNVCKENYEFQIKWTDQSHLHNTWETYESLA 249
            EDVH IDMVITH++K+G D E + K V  L  CK+N +F IKWTDQSHLHNTWETYESL 
Sbjct: 181  EDVHSIDMVITHKLKDGVD-ESVWKKVMNLQECKDNIQFLIKWTDQSHLHNTWETYESLG 239

Query: 250  GVKGIKRLDNYCKQYIIQEQQVRLDPYITPEDIEIMDMEHERRLDELQEFTNPERIIDSQ 309
             +KG+KRLDNYCKQ+IIQ+QQVRLDPYITPED+E+MDME ERRLDE QEFT PERI+DSQ
Sbjct: 240  QIKGLKRLDNYCKQFIIQDQQVRLDPYITPEDLEVMDMEQERRLDEFQEFTIPERIVDSQ 299

Query: 310  RVELEDGTSQLQYLVKWRHLNYDEATWEDAAEIVKIAPEPVKHFQSRQNSKILPQYSSNY 369
            RV L+DGTS+LQYLVKW+ LNYDEATWE AA+IVK APE VKHFQ+R NSKILPQ S+NY
Sbjct: 300  RVTLDDGTSELQYLVKWKRLNYDEATWEAAADIVKDAPEQVKHFQNRINSKILPQNSTNY 359

Query: 370  T-SERPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVA 428
              S RP+FEKL  QP ++K GELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVA
Sbjct: 360  NNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVA 419

Query: 429  FISWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYS 488
            FISWLI+ARRQNGPH+VVVPLSTMPAW ETF+KWAPD++VICYMGNQ+SRD  RE+EFY+
Sbjct: 420  FISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYT 479

Query: 489  NPKGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFK 548
            NP  KGKK IKFNVL+TTYEYILKDR+ELGSIKWQFLAVDEAHRLKNAESSLYESLNSFK
Sbjct: 480  NPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFK 539

Query: 549  VANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEQYIRDLHKRLQPF 608
            V NRLLITGTPLQNNIKELAAL+NFLMPGRFTIDQEIDFENQDEEQE+YIRDLHKRLQPF
Sbjct: 540  VNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEIDFENQDEEQEEYIRDLHKRLQPF 599

Query: 609  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMN 668
            ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG+KGG FS+LNIM+
Sbjct: 600  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMS 659

Query: 669  TLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHR 728
             L KASNHPYLFD+AEE+VL+KFG G MSREN+LRGLIMSSG              DGHR
Sbjct: 660  ELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGKMVLLDQLLNKLKKDGHR 719

Query: 729  VLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRA 788
            VLIFSQMVR+LDILGDYLSIKGI FQRLDGTVPS QRRI+IDHFNAP S D VFLLSTRA
Sbjct: 720  VLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRA 779

Query: 789  GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA 848
            GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA
Sbjct: 780  GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA 839

Query: 849  RKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKLEDLNLDD 908
            RKKMILEYAIISLGVTDG+KYTKK EP+ GELSEILKFGAGNMFAAKDNQKKLEDLNLDD
Sbjct: 840  RKKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLNLDD 899

Query: 909  VLSHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPXXXXXXXXXXXXRHKD 968
            VL+HAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIP            + KD
Sbjct: 900  VLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPEEELKKLKDEEQKRKD 959

Query: 969  EEYVKEQLEMMNRRNNALKKIKDSVNGEGSTVTXXXXXXXXXXXXAKTNDLNSIGDSEVR 1028
            +EY+KEQL+MMNRR+NALKKIK SVNG+G+TV                NDL SIG+SE+R
Sbjct: 960  DEYIKEQLDMMNRRDNALKKIKHSVNGDGTTVDSDDESSSRTSKRRARNDLTSIGESEIR 1019

Query: 1029 ALYRAVLRFGDVTDKLDELIADGTLPVXXXXXXXXXXXXXXXXAKSIYEEEDTKRTQTLR 1088
            A+Y+AVL++GD+T+  +ELI+DG LPV                A+     E+ KR + + 
Sbjct: 1020 AIYKAVLKYGDLTNLFEELISDGNLPVKSIDKYQEVYAEMMEVARENLHSEEAKRKEIME 1079

Query: 1089 EFEAAAHEYKMKLKTGEIKAEEQEKDNPITRLTMKRREKKAILFTFHKVKSLNAESIVNR 1148
            + E  AHEY++KLK+GEIK ++Q KDNP   L MKR+EKKAILFTF+ VKSLNAES + R
Sbjct: 1080 KLEKKAHEYRLKLKSGEIKPDDQPKDNPNAELAMKRKEKKAILFTFYDVKSLNAESFIGR 1139

Query: 1149 CRDLEFVNNYFKTHFKNDPLEFKFDKAHPKPVTNWNCDWNQMDDEKLMVGIHKYGYGAWA 1208
               L+F+  Y   HFK+DPL+F      PK V NW+ +WN+ DDEKL+VG+ KYGYG+W 
Sbjct: 1140 AEALDFLRKYIHEHFKDDPLKFHIANRSPKAVQNWSSNWNKEDDEKLLVGVFKYGYGSWT 1199

Query: 1209 QIRDDPFLGLTNKIFLSDVSSAATDKVKEEVKQETPDATXXXXXXXXXXXXVPGALHLGR 1268
            QIRDDPFLGLTNKIFL+D SS   D V ++        T            VPGA+HLGR
Sbjct: 1200 QIRDDPFLGLTNKIFLNDSSS---DPVMKKETATNTTNTKKGKGVTGSSKKVPGAIHLGR 1256

Query: 1269 RVDYLIDFLQNDGKPTTGAXXXXXXXXXXRKTAAXXXXXXXXXXXTSSFSETSASGTPEL 1328
            RVDYLI  ++++ +  T +          RK                  +++S + TP  
Sbjct: 1257 RVDYLISVMRDESQENTPSATATPTSGLKRKRQTKLSKPPT--------AKSSVNSTPS- 1307

Query: 1329 GKLDSPGQPTKRIKALPKGPASLVSRNKK-TNSP-----QRDGNKENENGTSGAHAKEYD 1382
                     +KR K  PK    +   +K  +NSP     +R  +     G+     KEY+
Sbjct: 1308 ---------SKRTKLTPKTLKKVTKASKSVSNSPTPVNKKRTTSNMTPPGSENVIEKEYE 1358

Query: 1383 SMDEEECRHTMTSMXXXXXXXXXXXXXXXXXEWAKILKSELTAIGDYIEAQ--AKKNKNP 1440
            SMDE+ECRH M  +                 E+A +LKSELT IGD+IE+Q    K  +P
Sbjct: 1359 SMDEDECRHAMAPVRLSLKKLRNGNKGLDRKEFAHMLKSELTNIGDHIESQKGTSKKTDP 1418

Query: 1441 DRHRKHLWSYSSN 1453
               +KHLWSYSS+
Sbjct: 1419 VNFKKHLWSYSSH 1431

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 28/47 (59%)

Query: 1  MKEIDEEVLQNPELYGLRRSHRAVAHRPYVXXXXXXXXVPVKTRKRR 47
          +K++  E+LQNPELYGLRRSHRA  H  +         V   +R+ R
Sbjct: 4  VKDLPNEILQNPELYGLRRSHRAPTHNYFEDEEDDEDAVKTSSRRGR 50

>AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..985231)
            [4269 bp, 1422 aa]
          Length = 1422

 Score = 1678 bits (4345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 856/1328 (64%), Positives = 991/1328 (74%), Gaps = 41/1328 (3%)

Query: 131  EKQVAIPTRFSSRANKQVNYNIDYXXXXXXXXXXXXXXXXXXXXXXXXXXRARSNTPPQE 190
            E  + +PTRFSSR NK VNYNIDY                           A + TP   
Sbjct: 103  EDDIMLPTRFSSRNNKAVNYNIDYSDDDLLESAEEEYEGDEGDEGEEE---AYAQTPQIP 159

Query: 191  DVHGIDMVITHRIKEGSDKEHLAKIVPELNVCKENYEFQIKWTDQSHLHNTWETYESLAG 250
            D HGID V+THR+ EG   E +   VPE   CKE YEF IKW ++SH+HNTWET ESL  
Sbjct: 160  DEHGIDFVVTHRLHEGH-TEPVEWDVPE---CKECYEFLIKWNNESHIHNTWETAESLGN 215

Query: 251  VKGIKRLDNYCKQYIIQEQQVRLDPYITPEDIEIMDMEHERRLDELQEFTNPERIIDSQR 310
            V+G+K++DNY KQYI+ + ++R D Y T EDIE+MD+EHERR DE +EF   ERIIDS R
Sbjct: 216  VRGVKKVDNYIKQYILLDHELRTDKYTTREDIEVMDLEHERRCDEFEEFKKVERIIDSDR 275

Query: 311  VELEDGTSQLQYLVKWRHLNYDEATWEDAAEIVKIAPEPVKHFQSRQNSKILPQYSSNYT 370
            V L+DG+SQLQYLVKW+ LNYDEATWE+A+ IVK+APE VK FQSR +SKILPQ+SSNY 
Sbjct: 276  VTLDDGSSQLQYLVKWKRLNYDEATWENASVIVKMAPEEVKRFQSRSSSKILPQHSSNYG 335

Query: 371  SERPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFI 430
            S+RP FEKLSVQP FIKGGELRDFQLTGINWMAFLWSK+DNGILADEMGLGKTVQTV+FI
Sbjct: 336  SQRPGFEKLSVQPSFIKGGELRDFQLTGINWMAFLWSKSDNGILADEMGLGKTVQTVSFI 395

Query: 431  SWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNP 490
            SWLIFARRQNGPHLVVVPLSTMPAW ETFEKWAP+++ + YMGNQKSRD+ REYEFY+NP
Sbjct: 396  SWLIFARRQNGPHLVVVPLSTMPAWQETFEKWAPELNCVYYMGNQKSRDVIREYEFYTNP 455

Query: 491  KGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVA 550
              KGKK IKFNVL+TTYEYILKDR ELG+IKWQFLAVDEAHRLKNAESSLYESL+SFKVA
Sbjct: 456  HTKGKKNIKFNVLLTTYEYILKDRLELGAIKWQFLAVDEAHRLKNAESSLYESLSSFKVA 515

Query: 551  NRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEQYIRDLHKRLQPFIL 610
            NR+LITGTPLQNNIKELAALVNFLMPG+FTIDQEIDFENQDE+QE YIRDLHKRLQP+IL
Sbjct: 516  NRMLITGTPLQNNIKELAALVNFLMPGKFTIDQEIDFENQDEKQENYIRDLHKRLQPYIL 575

Query: 611  RRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTL 670
            RRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNY+ALTAG KG  FS+LNIMN L
Sbjct: 576  RRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYNALTAGTKGTHFSLLNIMNEL 635

Query: 671  MKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVL 730
             KASNHPYLF +AE +VL KFG GN SRENILRGLIMSSG              DGHRVL
Sbjct: 636  KKASNHPYLFGNAENRVLAKFGDGNRSRENILRGLIMSSGKMVLLDKLLTRLKKDGHRVL 695

Query: 731  IFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGG 790
            IFSQMVR+LDILGDYLSIKGINFQRLDGTVPS+QRRI+IDHFNAP S+DFVFLLSTRAGG
Sbjct: 696  IFSQMVRMLDILGDYLSIKGINFQRLDGTVPSSQRRISIDHFNAPDSNDFVFLLSTRAGG 755

Query: 791  LGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARK 850
            LGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR VSKDTVEEEVLERARK
Sbjct: 756  LGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARK 815

Query: 851  KMILEYAIISLGVTDGNKYTKKT--EPSAGELSEILKFGAGNMFAAKDNQKKLEDLNLDD 908
            KMILEYAIISLGVTDGNKYT K+  EPSAGELSEILKFGAGNMF A DNQKKLEDLNLDD
Sbjct: 816  KMILEYAIISLGVTDGNKYTSKSKAEPSAGELSEILKFGAGNMFKAHDNQKKLEDLNLDD 875

Query: 909  VLSHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPXXXXXXXXXXXXRHKD 968
            VL+HAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADV+WDDIIP            + KD
Sbjct: 876  VLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVEWDDIIPEDELRKLKDEEQKRKD 935

Query: 969  EEYVKEQLEMMNRRNNALKKIKDSVNGEGSTVTXXXXXXXXXXXXAKTNDLNSIGDSEVR 1028
            EEYV+EQL+MMNRRN AL KIK+SVNG+G+  +            AK+N+LNSIG+ E+R
Sbjct: 936  EEYVQEQLQMMNRRNVALNKIKNSVNGDGAQ-SLSDKEDSRSKKRAKSNNLNSIGEREIR 994

Query: 1029 ALYRAVLRFGDVTDKLDELIADGTLPVXXXXXXXXXXXXXXXXAKSIYEEEDTKRTQTLR 1088
            ALY+A+L++GD+T++L +LIADGTLPV                A+    +E++KR + + 
Sbjct: 995  ALYKAILKYGDLTERLGDLIADGTLPVKSLEKYGELYDELMSIARKQINDEESKRNEAIS 1054

Query: 1089 EFEAAAHEYKMKLKTGEIKAEEQEKDNPITRLTMKRREKKAILFTFHKVKSLNAESIVNR 1148
              E    EYK K+K+GEIK ++  KD PI RL  KRREK+A+LF F+++K LNAE+IVNR
Sbjct: 1055 RLERDVEEYKTKVKSGEIKPDDNAKDLPIARLAAKRREKRAVLFEFYEIKGLNAETIVNR 1114

Query: 1149 CRDLEFVNNYFKTHFKNDPLEFKFDKAHPKPVTNWNCDWNQMDDEKLMVGIHKYGYGAWA 1208
              DL F++N+ K ++ +DP++F+F    PKP+TNWNC W Q DDEKL+VG+ KYGYG+W+
Sbjct: 1115 TDDLRFLHNFLKNNYPSDPMKFRFLNRLPKPITNWNCTWTQEDDEKLLVGVDKYGYGSWS 1174

Query: 1209 QIRDDPFLGLTNKIFLSDVSSAATDKVKEEVKQETPDATXXXXXXXXXXXXVPGALHLGR 1268
            Q+RDDPFLGL++KIFL++  +   D    +                     VPG++HLGR
Sbjct: 1175 QVRDDPFLGLSDKIFLNEPGTQTNDSAAADADAAD-----KKTRLANAAKKVPGSVHLGR 1229

Query: 1269 RVDYLIDFLQNDGKPTTGAXXXXXXXXXXRKTAAXXXXXXXXXXXTSSFSETSASGTPEL 1328
            RVDYL+  L+ + K T               +AA               S +S S TP+ 
Sbjct: 1230 RVDYLLTVLREEAKGTD--------------SAAAPQAALAAKKRARKSSGSSKSATPDA 1275

Query: 1329 GKLDSPGQPTKRIKALPKG--PASLVSRNKKTNSPQRDGNKENENGTSGAHAKEYDSMDE 1386
               DSP    KR +ALP    P+S       +  PQ   N + +        +EY+SMDE
Sbjct: 1276 RPEDSPS--IKRTRALPAASRPSS------GSPGPQLKRNGKKQASPKAPMEREYESMDE 1327

Query: 1387 EECRHTMTSMXXXXXXXXXXXXXXXXXEWAKILKSELTAIGDYIEAQAKKNKNPDR--HR 1444
            +ECR TM S+                 EWA ILK EL A+G+YIE     + + DR   +
Sbjct: 1328 DECRRTMHSVRASLKRLKRGGAGLDRNEWAAILKRELLAVGNYIERHKGDSADRDRAQFK 1387

Query: 1445 KHLWSYSS 1452
            +HLWSYS+
Sbjct: 1388 RHLWSYSA 1395

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%)

Query: 2  KEIDEEVLQNPELYGLRRSHR 22
          K++ +EVL NPELYGLRRSHR
Sbjct: 3  KDLPDEVLANPELYGLRRSHR 23

>Kwal_56.23442
          Length = 1435

 Score = 1645 bits (4260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 836/1332 (62%), Positives = 985/1332 (73%), Gaps = 38/1332 (2%)

Query: 132  KQVAIPTRFSSRANKQVNYNIDYXXXXXXXXXXXXXXXXXXXXXXXXXXRARSNTPPQED 191
            +++ +PTRFSSR N+ VNYN+DY                             + TP  +D
Sbjct: 108  EEIELPTRFSSRNNRSVNYNVDYSDEDLLESETEQADADMEEYDY-------TPTPSSQD 160

Query: 192  VHGIDMVITHRIKEGSDKEHLAKIVPELNVCKENYEFQIKWTDQSHLHNTWETYESLAGV 251
              GID+VITHR+K  +++   +K +P++  CK NYEF IKW D+SHLHN+WETY  +  V
Sbjct: 161  GQGIDLVITHRLKPDTEE---SKDIPDVATCKTNYEFLIKWVDESHLHNSWETYADIGQV 217

Query: 252  KGIKRLDNYCKQYIIQEQQVRLDPYITPEDIEIMDMEHERRLDELQEFTNPERIIDSQRV 311
            +GIK++DNY KQ+II ++Q+R DPY T EDIE+MD+E ERRLDE +E+  PERIIDS RV
Sbjct: 218  RGIKKIDNYIKQFIILDKQIRSDPYTTAEDIEVMDLEKERRLDEFEEYKIPERIIDSDRV 277

Query: 312  ELEDGTSQLQYLVKWRHLNYDEATWEDAAEIVKIAPEPVKHFQSRQNSKILPQYSSNYTS 371
             LEDG+SQLQY VKWR LNYDEATWE A  IVK+APE VKHFQ+R NSKILPQYSS+Y S
Sbjct: 278  TLEDGSSQLQYQVKWRRLNYDEATWESAGTIVKLAPEQVKHFQNRINSKILPQYSSHYGS 337

Query: 372  ERPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFIS 431
            ERPRFEKL  QP FIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFIS
Sbjct: 338  ERPRFEKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFIS 397

Query: 432  WLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPK 491
            WLI+ARRQNGPHLVVVPLSTMPAW ETFEKWAPD++ I ++GNQKSRD  RE EF++NP+
Sbjct: 398  WLIYARRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQ 457

Query: 492  GKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 551
             K KK  KFNVL+TTYEYILKDRAELG+IKWQFLAVDEAHRLKNAESSLYESLNSFKVAN
Sbjct: 458  AKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 517

Query: 552  RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEQYIRDLHKRLQPFILR 611
            RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQD EQE YIRDLH RLQPFILR
Sbjct: 518  RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDAEQETYIRDLHSRLQPFILR 577

Query: 612  RLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLM 671
            RLKKDVEKSLPSKTERILRVELSDVQT+YYKNILTKNYSAL+AG+KG  FS+LNIMN L 
Sbjct: 578  RLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELK 637

Query: 672  KASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLI 731
            KASNHPYLFD AE++VL KFG G MSRENILRGLIMSSG              DGHRVLI
Sbjct: 638  KASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLI 697

Query: 732  FSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGL 791
            FSQMVR+LDILGDYL+IKGI +QRLDGTVPS QRRI+IDHFNAP S+DFVFLLSTRAGGL
Sbjct: 698  FSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGL 757

Query: 792  GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKK 851
            GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR VSKDTVEEEVLERARKK
Sbjct: 758  GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKK 817

Query: 852  MILEYAIISLGVTDGNKYT--KKTEPSAGELSEILKFGAGNMFAAKDNQKKLEDLNLDDV 909
            MILEYAIISLGVTDG+  T  KK++PSAGELSEILKFGAGNMF A DNQ+KLEDLNLDDV
Sbjct: 818  MILEYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDNQRKLEDLNLDDV 877

Query: 910  LSHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPXXXXXXXXXXXXRHKDE 969
            L+HAEDHVTTPDLGESHLGGEEFL+QFEVTDYKADV+WDDIIP            +  DE
Sbjct: 878  LNHAEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWDDIIPEEELKKLKDEEQKRMDE 937

Query: 970  EYVKEQLEMMNRRNNALKKIKDSVNGEG-STVTXXXXXXXXXXXXAKTNDLNSIGDSEVR 1028
            EYV+EQL++MNRRNNAL +IK SVNG G +               ++ ++L+S G+ EVR
Sbjct: 938  EYVQEQLQLMNRRNNALNRIKASVNGSGINNGDDNEDENTGSKRKSRMSNLDSFGEREVR 997

Query: 1029 ALYRAVLRFGDVTDKLDELIADGTLPVXXXXXXXXXXXXXXXXAKSIYEEEDTKRTQTLR 1088
            A+Y+ +LR+G++ DK +ELIADG+LPV                AKS  + E+ KR+    
Sbjct: 998  AIYKCILRYGNLDDKFEELIADGSLPVKTIDGYSGIYHEMIAEAKSCIKIEEEKRSAAFA 1057

Query: 1089 EFEAAAHEYKMKLKTGEIKAEEQEKDNPITRLTMKRREKKAILFTFHKVKSLNAESIVNR 1148
              E +A  Y+ KLK    + +E++K NPI +L  K++EKKA+LF F+ VKSLNAE+I+ R
Sbjct: 1058 SLEKSAQAYREKLKAHGQQLDEKDKSNPIAKLAAKKKEKKAVLFEFYDVKSLNAETILTR 1117

Query: 1149 CRDLEFVNNYFKTHFKNDPLEFKFDKAHPKPVTNWNCDWNQMDDEKLMVGIHKYGYGAWA 1208
              ++ F+  + + ++ +DPL+FKF    PKPVTNWNC W++ DDEKL+VG++KYGYGAWA
Sbjct: 1118 PDEMGFLTTFLRKNYPDDPLKFKFVNKIPKPVTNWNCSWSKEDDEKLLVGVNKYGYGAWA 1177

Query: 1209 QIRDDPFLGLTNKIFLSD--VSSAATDKVKEEVKQETPDATXXXXXXXXXXXXVPGALHL 1266
            QIRDDPFLGL++KIFL++   ++   D +     Q+T ++             VPG++HL
Sbjct: 1178 QIRDDPFLGLSDKIFLNEPQTNNGKADNI-SAADQKTKNSG------AGGSKKVPGSVHL 1230

Query: 1267 GRRVDYLIDFLQNDGKPTTGAXXXXXXXXXXRKTAAXXXXXXXXXXXTSSFSETSASGTP 1326
            GRR DYL   L+++ KP T +             +                + TS S TP
Sbjct: 1231 GRRTDYLFAVLKDEIKPHTSSGTNSGNSSPLPGASTGSKKRVRK-------APTSRSATP 1283

Query: 1327 ELGKLDSPGQPTKRIKALPKG---PASLVSRNKKTNSPQRDGNKENENGTSGAHAKEYDS 1383
            +    +    P KR+K +  G   P  LV+  +K  S  + G     N    A  KEYDS
Sbjct: 1284 DAKADEIRSGPAKRVKKMGMGRSSPPPLVATARKAKS-VKGGTAPRGN---SAPDKEYDS 1339

Query: 1384 MDEEECRHTMTSMXXXXXXXXXXXXXXXXXEWAKILKSELTAIGDYIEAQAKKNKN--PD 1441
            M+EEEC+  M  M                 EWA ILK EL  +GD+IE +   +K   P+
Sbjct: 1340 MEEEECKAAMQPMKNSLKRLSRGGKGLDRKEWATILKEELRTVGDHIETKKVSSKKYPPE 1399

Query: 1442 RHRKHLWSYSSN 1453
            + RKHLW++SS+
Sbjct: 1400 KFRKHLWAFSSH 1411

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 2  KEIDEEVLQNPELYGLRRSHRAVA 25
          K++  ++L NPELYGLRRS RA A
Sbjct: 4  KDVAMDMLDNPELYGLRRSGRAAA 27

>KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces
            cerevisiae YER164w CHD1 transcriptional regulator, start
            by similarity
          Length = 1525

 Score = 1630 bits (4222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 839/1390 (60%), Positives = 996/1390 (71%), Gaps = 74/1390 (5%)

Query: 131  EKQVAIPTRFSSRAN-KQVNY--NIDYXXXXXXXXXXXXXXXXXXXXXXXXXXRARSNTP 187
            E+ V +PTRFSSR N K +NY  N D                              S +P
Sbjct: 118  EENVVLPTRFSSRNNNKVINYTLNDDSNDEDLMESSEEQDEGHNLDSEDMDLQDGYSASP 177

Query: 188  -PQEDVHGIDMVITHRIKEGSDKEHLAKIVP-ELNVCKENYEFQIKWTDQSHLHNTWETY 245
             PQ++ H ID+V+ HR+KEG D     K    +++  + N+EF IKW DQSHLHN+WE+Y
Sbjct: 178  SPQQETHSIDIVVDHRLKEGVDNSGSTKNRRWDVDSIRANFEFLIKWADQSHLHNSWESY 237

Query: 246  ESLA--GVKGIKRLDNYCKQYIIQEQQVRLDPYITPEDIEIMDMEHERRLDELQEFTNPE 303
            E L   G KG+KR++NY KQ+II +Q+VR DPY T EDIE+MD+EHERR+DE +EF  PE
Sbjct: 238  EDLKENGTKGLKRIENYYKQFIILDQEVRADPYTTREDIEVMDLEHERRIDEFEEFKVPE 297

Query: 304  RIIDSQRVELEDGT--SQLQYLVKWRHLNYDEATWEDAAEIVKIAPEPVKHFQSRQNSKI 361
            RIIDS+R E EDG+  SQL+YLVKWR LNYDE TWE A+EIVK+APE VK FQ+R NSKI
Sbjct: 298  RIIDSERFENEDGSGSSQLKYLVKWRRLNYDECTWEVASEIVKMAPEQVKEFQNRTNSKI 357

Query: 362  LPQYSSNY-TSERPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGL 420
            +PQ SSNY  ++RP+FEKL  QP FIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGL
Sbjct: 358  MPQNSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGL 417

Query: 421  GKTVQTVAFISWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDI 480
            GKTVQTV+FISWLI+ARRQNGPHLVVVPLSTMPAW ETF+KWAP ++ + YMGNQ SRD+
Sbjct: 418  GKTVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDL 477

Query: 481  EREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSL 540
             ++YEFY+NP+ KGKK +KFNVL+TTYEYILKDR+ LGSIKWQFLAVDEAHRLKNAESSL
Sbjct: 478  IQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSL 537

Query: 541  YESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEQYIRD 600
            YESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDE+QE+YIRD
Sbjct: 538  YESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEQQEEYIRD 597

Query: 601  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGR 660
            LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALT+G KGG 
Sbjct: 598  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGH 657

Query: 661  FSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXX 720
             S+LN+MN L KASNHPYLFD+AEE+VL KFG G+ SRENILRGLIMSSG          
Sbjct: 658  VSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGKMVLLDKLLT 717

Query: 721  XXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDF 780
                DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPS QRRI+IDHFNA  S+DF
Sbjct: 718  RLKKDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDF 777

Query: 781  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 840
            VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR VSKDTV
Sbjct: 778  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV 837

Query: 841  EEEVLERARKKMILEYAIISLGVTDGNKY--TKKTEPSAGELSEILKFGAGNMFAAKDNQ 898
            EEEVLERARKKMILEYAIISLGVTDGNK   TKK EPSAGELSEILKFGAGNMF   DNQ
Sbjct: 838  EEEVLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQ 897

Query: 899  KKLEDLNLDDVLSHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPXXXXXX 958
            +KLEDLNLD+VL+HAEDH+TTP+LGES+LGGEEFL+QFEVTDYKADVDWDDIIP      
Sbjct: 898  QKLEDLNLDEVLNHAEDHITTPELGESNLGGEEFLRQFEVTDYKADVDWDDIIPEDELKK 957

Query: 959  XXXXXXRHKDEEYVKEQLEMMNRRNNALKKIKDSVNGEGSTVTXXXXXXXXXXXXAKTND 1018
                  R  DEEYV+EQL++MNR+  A+ KIK SVNGE                 +K N+
Sbjct: 958  LKDEEQRRIDEEYVREQLDIMNRKTAAIDKIKRSVNGETFGSDSEDEGNSKSRKRSKANN 1017

Query: 1019 LNSIGDSEVRALYRAVLRFGDVTDKLDELIADGTLPVXXXXXXXXXXXXXXXXAKSIYEE 1078
            L++ G+ E+RALY+ +LRFGD+ +K +ELIADG+LPV                A+++  +
Sbjct: 1018 LDAFGEREIRALYKCILRFGDIENKFEELIADGSLPVKSIDRYKELYHEMITEAETLMRD 1077

Query: 1079 EDTKRTQTLREFEAAAHEYKMKLKTGEIKAEEQE-KDNPITRLTMKRREKKAILFTFHKV 1137
            E+ KR +   + E  A EY+ K+K  EIK E+   K+ PIT L+ KRREK+AILF FH  
Sbjct: 1078 EEAKRHEIFSKLEKDAAEYRQKIKNLEIKPEDDAGKETPITLLSAKRREKRAILFEFHDT 1137

Query: 1138 KSLNAESIVNRCRDLEFVNNYFKTHFKNDPLEFKFDKAHPKPVTNWNCDWNQMDDEKLMV 1197
            K+LNA+++VNR  +L+F++N+ + ++K+DPL+FKF   +PKPV+ WNC W + DDEKL++
Sbjct: 1138 KALNADTLVNRRDNLKFLSNFVERNYKDDPLQFKFVNKNPKPVSAWNCVWGKEDDEKLLI 1197

Query: 1198 GIHKYGYGAWAQIRDDPFLGLTNKIFLSD--VSSAATDKV-------------------K 1236
            GI+KYGYGAW QIRDDPFLGLT K+FL++     AAT                       
Sbjct: 1198 GIYKYGYGAWMQIRDDPFLGLTEKLFLNNEVTQKAATPAAPSLTPSAPGASVAGSSTPGA 1257

Query: 1237 EEVKQETPDAT--------XXXXXXXXXXXXVPGALHLGRRVDYLIDFLQND-------- 1280
            + VK ETPD T                     PGA+HLGRRVDYL   L+++        
Sbjct: 1258 DAVKTETPDTTANTPIVTASSENTNKKTVKKAPGAVHLGRRVDYLFTVLRDEAKGPQTDP 1317

Query: 1281 ----GKPTTGAXXXXXXXXXXRKTAAXXXXXXXXXXXTSSFSETSASGTPELGKLDSP-- 1334
                G  +TG           +K+A             ++ + +  +     GK  +P  
Sbjct: 1318 SHPAGSSSTGTTTPQQNKRKPKKSATTAGNSNGNENAHTAGTPSDGNSVNLTGKDSTPDN 1377

Query: 1335 GQPTKRIKA-LPKGPASLVSRNKKTNSPQRDGNKENENGTSGAHA---------KEYDSM 1384
               TKR KA   + P+S      ++ +P     K+   G     A         KEYDSM
Sbjct: 1378 SSETKRGKAHHHQQPSS------RSGTPVVGSKKQQRKGKDIPLAPKADIRLPDKEYDSM 1431

Query: 1385 DEEECRHTMTSMXXXXXXXXXXXXXXXXXEWAKILKSELTAIGDYIEAQAKKNK--NPDR 1442
            DEEEC+ TMT++                 +WA +LK EL  +GDYIE+  K +   +P++
Sbjct: 1432 DEEECKKTMTNVRSSLKRLRSGGDGLERKQWANLLKKELKRVGDYIESHKKDSSKTSPEK 1491

Query: 1443 HRKHLWSYSS 1452
            +++HLWS+++
Sbjct: 1492 YKRHLWSFTA 1501

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 1/31 (3%)

Query: 1  MKEIDEEVLQNPELYGLRRSHR-AVAHRPYV 30
          ++++ +EVL NPELYGLRRSHR A+ H  Y 
Sbjct: 2  VQDLPDEVLANPELYGLRRSHRAAITHNTYA 32

>Scas_665.17
          Length = 1060

 Score =  456 bits (1172), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 246/582 (42%), Positives = 361/582 (62%), Gaps = 42/582 (7%)

Query: 379 LSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARR 438
           +S  P FIKGG+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT++F+ +L + ++
Sbjct: 125 VSESPAFIKGGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKK 184

Query: 439 QNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSR-----DIEREYEFYSNPKGK 493
            +GP L+VVP ST+  W   F KW P+++ I   G+++ R     DI  E          
Sbjct: 185 IDGPFLIVVPKSTLDNWRREFNKWTPEVNAIVLHGDKEERHKILYDIVLE---------- 234

Query: 494 GKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRL 553
                KF+VL+T+YE ++K++  L    WQ++ +DEAHR+KN +S L + +  F   NRL
Sbjct: 235 ----AKFDVLITSYEMVIKEKNVLKKFAWQYIVIDEAHRIKNEQSQLSQIIRLFYSKNRL 290

Query: 554 LITGTPLQNNIKELAALVNFLMPGRF----TIDQEIDFENQDEEQEQYIRDLHKRLQPFI 609
           LITGTPLQNN+ EL AL+NFL+P  F      D+  +  N +++QE  ++ LH  L PF+
Sbjct: 291 LITGTPLQNNLHELWALLNFLLPDVFGDSGIFDEWFEQNNSEQDQEIVVQQLHTVLNPFL 350

Query: 610 LRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TAGAKGGRFSMLNIM 667
           LRR+K DVEKSL  K E  + V ++++Q ++YK++L K+  A+    G + G+  +LNI+
Sbjct: 351 LRRIKADVEKSLLPKIETNVYVGMTEMQVKWYKSLLEKDIDAVNGAVGKREGKTRLLNIV 410

Query: 668 NTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGH 727
             L K  NHPYLF+ AE       G    + E+    L+ ++G               G 
Sbjct: 411 MQLRKCCNHPYLFEGAEP------GPPYTTDEH----LVFNAGKMIVLDKLLKRLKEKGS 460

Query: 728 RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTR 787
           RVLIFSQM R+LDIL DY   +G  + R+DG+     R  AID +N P SD FVFLL+TR
Sbjct: 461 RVLIFSQMSRLLDILEDYCFFRGYEYCRIDGSTAHEDRIEAIDEYNKPNSDKFVFLLTTR 520

Query: 788 AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLER 847
           AGGLGINL+TADTVI++DSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ER
Sbjct: 521 AGGLGINLVTADTVILYDSDWNPQADLQAMDRAHRIGQKKQVTVYRFVTENAIEEKVIER 580

Query: 848 ARKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKLEDLNLD 907
           A +K+ L+  +I  G     K T     +  +L E++++GA NMF  K+ Q+  +D ++D
Sbjct: 581 AAQKLRLDQLVIQQGT---GKKTASLGSNKDDLLEMIQYGAKNMFENKE-QQITKDADID 636

Query: 908 DVLSHAEDHVTTPDLGESHLG-GEEFLKQFEVTDYKADVDWD 948
           ++L   +  + T +L   +   G + L++F   D ++  +W+
Sbjct: 637 EILKKGQ--LKTKELNAKYQALGLDDLQKFNDVDNQSAYEWN 676

>YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required for
           Ume6p-dependent transcriptional repression of several
           meiotic genes, has chromatin remodeling activity, has
           strong similarity to Drosophila nucleosome remodeling
           factor ISWI (Imitator SWI) [3363 bp, 1120 aa]
          Length = 1120

 Score =  455 bits (1170), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 244/577 (42%), Positives = 360/577 (62%), Gaps = 32/577 (5%)

Query: 379 LSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARR 438
           +S  P F+K G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT++F+ +L + ++
Sbjct: 172 VSESPSFVKSGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQ 231

Query: 439 QNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSR-DIEREYEFYSNPKGKGKKQ 497
             GP L++VP ST+  W   F KW P+++V+   G++ +R DI R              +
Sbjct: 232 IEGPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIIL----------E 281

Query: 498 IKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITG 557
            +F+VL+T+YE +++++  L  + WQ++ +DEAHR+KN +S+L + +  F   NRLLITG
Sbjct: 282 ARFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITG 341

Query: 558 TPLQNNIKELAALVNFLMPGRF----TIDQEIDFENQDEEQEQYIRDLHKRLQPFILRRL 613
           TPLQNN+ EL AL+NFL+P  F      D+  +  N +++QE  I+ LH  L PF+LRR+
Sbjct: 342 TPLQNNLHELWALLNFLLPDIFGDSELFDEWFEQNNSEQDQEIVIQQLHSVLNPFLLRRV 401

Query: 614 KKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGRFSMLNIMNTLM 671
           K DVEKSL  K E  + V ++D+Q ++YK++L K+  A+    G + G+  +LNI+  L 
Sbjct: 402 KADVEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLR 461

Query: 672 KASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLI 731
           K  NHPYLF+ AE       G    + E+    LI +SG               G RVLI
Sbjct: 462 KCCNHPYLFEGAEP------GPPYTTDEH----LIFNSGKMIILDKLLKRLKEKGSRVLI 511

Query: 732 FSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGL 791
           FSQM R+LDIL DY   +   + R+DG+    +R  AID +N P S+ FVFLL+TRAGGL
Sbjct: 512 FSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGL 571

Query: 792 GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKK 851
           GINL+TADTVI+FDSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ERA +K
Sbjct: 572 GINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQK 631

Query: 852 MILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKLEDLNLDDVLS 911
           + L+  +I  G     K T     S  +L ++++FGA NMF  K ++  + D ++DD+L 
Sbjct: 632 LRLDQLVIQQGT---GKKTASLGNSKDDLLDMIQFGAKNMFEKKASKVTV-DADIDDILK 687

Query: 912 HAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWD 948
             E      +     LG ++ L++F   + ++  +W+
Sbjct: 688 KGEQKTQELNAKYQSLGLDD-LQKFNGIENQSAYEWN 723

>Kwal_34.15925
          Length = 1025

 Score =  447 bits (1149), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 247/582 (42%), Positives = 357/582 (61%), Gaps = 42/582 (7%)

Query: 379 LSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARR 438
           L+  P +IK G LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT+AF+ +L + + 
Sbjct: 117 LTESPSYIKSGVLRDYQVQGLNWLLSLHDNRLSGILADEMGLGKTLQTIAFLGYLRYLKD 176

Query: 439 QNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSR-----DIEREYEFYSNPKGK 493
            +GPH+V+VP ST+  W   F KW P+++ +   G+++ R     DI  E          
Sbjct: 177 IDGPHIVIVPKSTLNNWKREFSKWTPEVEAVVLSGDKEERQHLLKDIVLE---------- 226

Query: 494 GKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRL 553
                KF+VL+T+YE ++K+++ L    WQ++ VDEAHR+KN +S+L + +  F   +RL
Sbjct: 227 ----CKFDVLITSYEMVIKEKSTLKRFMWQYIIVDEAHRIKNEQSTLSQIIRLFHSKSRL 282

Query: 554 LITGTPLQNNIKELAALVNFLMPGRFTIDQEID--FENQDEEQEQ--YIRDLHKRLQPFI 609
           LITGTPLQNN+ EL AL+NFL+P  F      D  FE  D E++Q   ++ LH  L PF+
Sbjct: 283 LITGTPLQNNLHELWALLNFLLPDVFGDSDAFDRWFEQSDTEKDQDVVVQQLHTVLSPFL 342

Query: 610 LRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGRFSMLNIM 667
           LRRLK +VE SL  K E  L V ++D+Q ++YK++L K+  A+    G + G   +LNI+
Sbjct: 343 LRRLKSEVETSLLPKIETNLYVGMTDMQVQWYKSLLEKDLDAVNGAIGKREGNTRLLNIV 402

Query: 668 NTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGH 727
             L K  NHPYLF+ AE       G    + E+    LI ++G               G 
Sbjct: 403 MQLRKCCNHPYLFEGAEP------GPPYTTDEH----LIFNAGKMIVLDKLLKKKKEAGS 452

Query: 728 RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTR 787
           RVLIFSQM R+LDIL DY   +  ++ R+DG+    +R  AID FN PGS+ F+FLL+TR
Sbjct: 453 RVLIFSQMSRLLDILEDYCFFRDYDYCRIDGSTAHEERIEAIDQFNEPGSEKFIFLLTTR 512

Query: 788 AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLER 847
           AGGLGINL+TADTV+I+DSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ER
Sbjct: 513 AGGLGINLVTADTVVIYDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIER 572

Query: 848 ARKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKLE-DLNL 906
           A +K+ L+  +I  GV    K T     S GEL  ++++GA ++F   D  +K+  D ++
Sbjct: 573 AAQKLRLDQLVIQQGV---GKKTSAIGNSKGELLGMIQYGAKDVFG--DGARKITVDDDI 627

Query: 907 DDVLSHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWD 948
           D++L   E      +     LG ++ L++F     ++  +W+
Sbjct: 628 DEILKKGEQKTQQLNAKYEKLGLDD-LQKFNGLGDQSAYEWN 668

>CAGL0I09614g 917707..920826 highly similar to tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2 or sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1, hypothetical
           start
          Length = 1039

 Score =  442 bits (1137), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 239/573 (41%), Positives = 351/573 (61%), Gaps = 32/573 (5%)

Query: 383 PPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 442
           P +I+ G+LRD+Q+ G+NWM  L     +GILADEMGLGKT+QT++F+ +L + ++  GP
Sbjct: 125 PSYIQSGKLRDYQIQGLNWMISLHENKISGILADEMGLGKTLQTISFLGYLRYVKKIEGP 184

Query: 443 HLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSR-DIEREYEFYSNPKGKGKKQIKFN 501
            LV+VP ST+  W   F KW P++      G ++ R DI +              + +F+
Sbjct: 185 FLVIVPKSTLDNWRREFFKWTPNVSTTVLQGTKEQRQDILQNIVL----------EARFD 234

Query: 502 VLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 561
           VL+T+YE +++++  L  + W+++ +DEAHR+KN +S+L + +  F   NRLLITGTPLQ
Sbjct: 235 VLITSYEMVIREKGYLKRLAWEYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQ 294

Query: 562 NNIKELAALVNFLMPGRF----TIDQEIDFENQDEEQEQYIRDLHKRLQPFILRRLKKDV 617
           NN+ EL AL+NFL+P  F      D      N D++QE  ++ LH  L PF+LRR+K DV
Sbjct: 295 NNLHELWALLNFLLPDVFGDSEVFDDWFQQNNSDQDQEVVVQQLHAVLNPFLLRRIKADV 354

Query: 618 EKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGRFSMLNIMNTLMKASN 675
           EKSL  K E  + V ++D+Q ++YK++L K+  A+    G + G+  +LNI+  L K  N
Sbjct: 355 EKSLLPKIETNVYVGMTDMQVQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCN 414

Query: 676 HPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 735
           HPYLF+ AE       G    + E+    LI ++G               G RVLIFSQM
Sbjct: 415 HPYLFEGAEP------GPPYTTDEH----LIFNAGKMIVLDKLLKRLKEKGSRVLIFSQM 464

Query: 736 VRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINL 795
            R+LDIL DY   +  N+ R+DG+    +R  AID +N P S+ FVFLL+TRAGGLGINL
Sbjct: 465 SRLLDILEDYCYFRNYNYCRIDGSTSHEERIDAIDEYNKPNSEKFVFLLTTRAGGLGINL 524

Query: 796 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 855
           +TADTV++FDSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+VLERA +K+ L+
Sbjct: 525 VTADTVVLFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVLERAAQKLRLD 584

Query: 856 YAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKLEDLNLDDVLSHAED 915
             +I  G     K T     S  +L E++++GA N+F  K+      D ++D++L   E 
Sbjct: 585 QLVIQQG---SGKKTANLGNSKDDLIEMIQYGAKNVF-EKNGTTISVDADIDEILKKGEA 640

Query: 916 HVTTPDLGESHLGGEEFLKQFEVTDYKADVDWD 948
                +     LG ++ L++F   + ++  +W+
Sbjct: 641 KTHELNARYEALGLDD-LQRFNGMENQSAYEWN 672

>AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH]
           complement(1400495..1400512,1400676..1403735) [3078 bp,
           1025 aa]
          Length = 1025

 Score =  436 bits (1121), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/538 (43%), Positives = 339/538 (63%), Gaps = 29/538 (5%)

Query: 383 PPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 442
           P F+K G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT++F+ +L F +  +GP
Sbjct: 120 PSFVKAGKLRDYQIYGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRFIKDIDGP 179

Query: 443 HLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNV 502
            +VVVP ST+  W   F KW P+++ I   G++++R    E    +           F+V
Sbjct: 180 FIVVVPKSTLDNWKREFAKWTPEVNTIVLHGDRETRTQLIEERILT---------CDFDV 230

Query: 503 LMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 562
           L+T+YE ++K++A L    WQ++ +DEAHR+KN +S+L + +  F   +RLLITGTPLQN
Sbjct: 231 LITSYEMVIKEKAILKKFAWQYIVIDEAHRIKNEQSTLSQIIRLFYSKSRLLITGTPLQN 290

Query: 563 NIKELAALVNFLMPGRFTIDQEID--FENQDEEQEQYI--RDLHKRLQPFILRRLKKDVE 618
           N+ EL AL+NFL+P  F   +  D  F+  ++ Q+Q I  + LH  LQPF+LRR+K DVE
Sbjct: 291 NLHELWALLNFLLPDVFGESEVFDEWFQQNEKAQDQEIVVQQLHAVLQPFLLRRVKADVE 350

Query: 619 KSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TAGAKGGRFSMLNIMNTLMKASNH 676
           KSL  K E  + V ++ +Q ++Y+++L K+  A+    G + G+  +LNI+  L K  NH
Sbjct: 351 KSLLPKIETNVYVGMTAMQLQWYRSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNH 410

Query: 677 PYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMV 736
           PYLF+ AE       G    + E+    LI +SG              +G RVLIFSQM 
Sbjct: 411 PYLFEGAEP------GPPYTTDEH----LIYNSGKMIVLDKLLKRKKKEGSRVLIFSQMS 460

Query: 737 RILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLM 796
           R+LDIL DY   +   + R+DG     +R  AID FNA  S  F+FLL+TRAGGLGINL+
Sbjct: 461 RLLDILEDYCYFRDFEYCRIDGATSHEERIAAIDEFNAHDSKKFIFLLTTRAGGLGINLV 520

Query: 797 TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 856
           TADTV+++DSDWNPQADLQAM RAHRIGQK  V VYRLV+++ +EE+V+ERA +K+ L+ 
Sbjct: 521 TADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVHVYRLVTENAIEEKVIERAAQKLRLDQ 580

Query: 857 AIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKLEDLNLDDVLSHAE 914
            +I  G     + +     + GEL ++++FGA ++F  K  +  + D ++D +L   E
Sbjct: 581 LVIQQG---AGRKSANLGNTKGELIDMIQFGARDVFDKKLTEATVAD-DIDAILMKGE 634

>KLLA0F24838g complement(2309842..2313030) similar to sgd|S0005831
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1062

 Score =  435 bits (1119), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/542 (42%), Positives = 337/542 (62%), Gaps = 29/542 (5%)

Query: 379 LSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARR 438
           L+  P FIK G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+Q+++F+ +L + + 
Sbjct: 124 LTQSPSFIKEGKLRDYQVYGLNWLISLHESKLSGILADEMGLGKTLQSISFLGYLRYIKG 183

Query: 439 QNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQI 498
             GP++V+VP ST+  W   F KW P++  +   G++  R    E +  +          
Sbjct: 184 IEGPYIVIVPKSTLDNWQREFAKWTPEVKTVILQGDKDFRKELIETKILT---------C 234

Query: 499 KFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGT 558
            F+VL+T+YE +LK++  L    W+++ +DEAHR+KN +S+L + +  F   NRLLITGT
Sbjct: 235 NFDVLITSYEMVLKEKLTLKRFAWEYILIDEAHRIKNEQSALSQVIRLFYSKNRLLITGT 294

Query: 559 PLQNNIKELAALVNFLMPGRF----TIDQEIDFENQDEEQEQYIRDLHKRLQPFILRRLK 614
           PLQNN+ EL AL+NFL+P  F      D+      ++E+QE  ++ LH  LQPF+LRR+K
Sbjct: 295 PLQNNLHELWALLNFLLPDVFGDSEVFDEWFQQNGKEEDQEVVVQQLHSVLQPFLLRRVK 354

Query: 615 KDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TAGAKGGRFSMLNIMNTLMK 672
            +VEKSL  K E  L V ++D+Q E+YK++L K+  A+    G + G+  +LNI+  L K
Sbjct: 355 SEVEKSLLPKKEINLYVGMTDMQIEWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRK 414

Query: 673 ASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIF 732
             NHPYLF+ AE       G    + E+    L+ +SG               G RVLIF
Sbjct: 415 CCNHPYLFEGAEP------GPPYTTDEH----LVFNSGKMIVLDKLLKKKKEQGSRVLIF 464

Query: 733 SQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLG 792
           SQM R+LDIL DY   +G  + R+DG+   ++R  AID +N P S+ F+FLL+TRAGGLG
Sbjct: 465 SQMSRLLDILEDYCYFRGYEYCRIDGSTSHDERVEAIDEYNKPNSEKFIFLLTTRAGGLG 524

Query: 793 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 852
           INL+TADTV+++DSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ERA +K+
Sbjct: 525 INLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVFVYRFVTENAIEEKVIERAAQKL 584

Query: 853 ILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKLEDLNLDDVLSH 912
            L+  +I  G     K T     +  +L ++++FGA +M         + D ++D++L  
Sbjct: 585 RLDQLVIQQGT---GKKTSALTNNKDDLIDMIQFGARDMLQHGSGNITV-DEDIDEILKK 640

Query: 913 AE 914
            E
Sbjct: 641 GE 642

>Scas_652.17
          Length = 1025

 Score =  426 bits (1094), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 234/590 (39%), Positives = 351/590 (59%), Gaps = 47/590 (7%)

Query: 383 PPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 442
           P +I G  LR +Q+ G+NW+  L      GILADEMGLGKT+QT+AF+ +L +    NGP
Sbjct: 106 PKYIHGT-LRPYQIQGLNWLVSLHKNGLAGILADEMGLGKTLQTIAFLGYLKYMEGINGP 164

Query: 443 HLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNV 502
            LV+ P ST+  W+    KW PD+      G+++ R    + +  +           F++
Sbjct: 165 FLVIAPKSTLNNWLREINKWTPDVKAFVLQGDKQERASLIKEKLMT---------CDFDI 215

Query: 503 LMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 562
           ++ +YE I++++A      W+++ +DEAHR+KN ES L + L  F   NRLLITGTPLQN
Sbjct: 216 VVASYEIIIREKAAFKKFNWEYIIIDEAHRIKNEESLLSQVLREFTSRNRLLITGTPLQN 275

Query: 563 NIKELAALVNFLMPGRFTIDQEID----FENQDEEQEQYIRDLHKRLQPFILRRLKKDVE 618
           N+ EL AL+NFL+P  F+  Q+ D     E  +E+Q++ ++ LH  LQPF+LRR+K DVE
Sbjct: 276 NLHELWALLNFLLPDIFSSSQDFDDWFSSETTEEDQDKVVKQLHTVLQPFLLRRIKNDVE 335

Query: 619 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGRFSMLNIMNTLMKASNH 676
            SL  K E  L V +S++Q ++YK IL K+  A+     +K  +  +LNI+  L K  NH
Sbjct: 336 TSLLPKKELNLYVGMSNMQKKWYKKILEKDLDAVNGENSSKESKTRLLNIVMQLRKCCNH 395

Query: 677 PYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMV 736
           PYLFD AE       G    + E+    L+ +S               DG RVLIFSQM 
Sbjct: 396 PYLFDGAEP------GPPYTTDEH----LVYNSKKLQVLDKLLKKMKEDGSRVLIFSQMS 445

Query: 737 RILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLM 796
           R+LDIL DY   +G  + R+DG+     R  +ID +NAP SD F+FLL+TRAGGLGINL 
Sbjct: 446 RVLDILEDYCFFRGYKYCRIDGSTDHEDRIKSIDDYNAPDSDKFIFLLTTRAGGLGINLT 505

Query: 797 TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 856
           +AD V+++DSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L+ 
Sbjct: 506 SADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRFVTDNSVEEKILERATQKLRLDQ 565

Query: 857 AIISLGVTDGNKYTKKTEPSAGE-LSEILKFGAGNMFAAKDN-------------QKKLE 902
            +I       NK  K+++  A + L  +++ GA ++F + ++              +++E
Sbjct: 566 LVIQQNKASMNKNKKESKKDAKDALLSMIQHGAADIFQSGNSTTTESTPQPGEAKSEEVE 625

Query: 903 DLNLDDVLSHAEDHVTTPDLGESHLGGEEFLK-------QFEVTDYKADV 945
           D++L+ +L+ +E+  ++ +     LG ++  K       +++  D+K DV
Sbjct: 626 DVDLESILATSENKTSSLNAKYETLGLDDLQKFNQDSAYEWDGHDFKKDV 675

>AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH]
           complement(363162..366422) [3261 bp, 1086 aa]
          Length = 1086

 Score =  427 bits (1097), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 239/587 (40%), Positives = 344/587 (58%), Gaps = 47/587 (8%)

Query: 383 PPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 442
           P F+  G LR +Q+ G+NW+  L   N  GILADEMGLGKT+QT+ F+ +L +  ++ GP
Sbjct: 137 PGFV-DGRLRPYQVQGVNWLVSLHKNNLAGILADEMGLGKTLQTITFLGYLRYIEKKRGP 195

Query: 443 HLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRD-IEREYEFYSNPKGKGKKQIKFN 501
            LV+ P ST+  W     +W PD+D     G+++ R  + +E     N          F+
Sbjct: 196 FLVIAPKSTLNNWQREINRWTPDVDAFILQGDKEERARLCQERLLACN----------FD 245

Query: 502 VLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 561
           V + +YE I++++A    I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPLQ
Sbjct: 246 VAIASYEIIIREKASFKKIDWEYIVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQ 305

Query: 562 NNIKELAALVNFLMPGRFT----IDQEIDFENQDEEQEQYIRDLHKRLQPFILRRLKKDV 617
           NN+ EL AL+NFL+P  F+     D+    E  D+++++ ++ LH  LQPF+LRR+K DV
Sbjct: 306 NNLHELWALLNFLLPDIFSDSAAFDEWFSSEASDDDKDKIVKQLHTILQPFLLRRIKSDV 365

Query: 618 EKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGRFSMLNIMNTLMKASN 675
           E SL  K E  L V +S +Q ++YK IL K+  A+    G+K  +  +LNIM  L K  N
Sbjct: 366 ETSLLPKKELNLYVGMSSMQRKWYKQILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCN 425

Query: 676 HPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 735
           HPYLFD AE       G    + E+    L+ +S               DG RVLIFSQM
Sbjct: 426 HPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKLKEDGSRVLIFSQM 475

Query: 736 VRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINL 795
            R+LDIL DY   +G  + R+DG+     R  AID +NAP S  F+FLL+TRAGGLGINL
Sbjct: 476 SRLLDILEDYCYFRGYEYCRIDGSTAHEDRIEAIDEYNAPDSRKFIFLLTTRAGGLGINL 535

Query: 796 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 855
            TAD V+++DSDWNPQADLQAM RAHRIGQK  V V+RLV+ ++VEE++LERA +K+ L+
Sbjct: 536 TTADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLD 595

Query: 856 YAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQK--------------KL 901
             +I  G T  +K     +     LS +++ GA +MF + D                 K 
Sbjct: 596 QLVIQQGRTSISKKENAKDAKDALLS-MIQHGAVDMFRSTDTSNASSAKGTPQPETGDKD 654

Query: 902 EDLNLDDVLSHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWD 948
           ++++L+ +L+ +E+   + +   + LG    L Q +  +  +  +WD
Sbjct: 655 DEVDLESLLNKSENKTKSLNEKYAALG----LDQLQKFNQDSAYEWD 697

>CAGL0C01683g 178695..182042 highly similar to sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1 or tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1115

 Score =  427 bits (1097), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 239/592 (40%), Positives = 350/592 (59%), Gaps = 43/592 (7%)

Query: 383 PPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 442
           P +I  G+LRD+Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L + ++  GP
Sbjct: 168 PAYI-NGQLRDYQVQGLNWLVSLDKNRIAGILADEMGLGKTLQTISFLGYLRYIKKIPGP 226

Query: 443 HLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNV 502
            LV+ P ST+  W+    KW P+++     G+++ R    + +F +           F+V
Sbjct: 227 FLVIAPKSTLNNWLREINKWTPEVNAFILQGDKEERARLIQDKFMA---------CDFDV 277

Query: 503 LMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 562
           ++ +YE I++++A    + W+++ +DEAHR+KN ES L + L  F   NRLLITGTPLQN
Sbjct: 278 VIASYEIIIREKAAFRKMNWEYIMIDEAHRIKNEESMLSQVLREFHSKNRLLITGTPLQN 337

Query: 563 NIKELAALVNFLMPGRFTIDQEID----FENQDEEQEQYIRDLHKRLQPFILRRLKKDVE 618
           N+ EL AL+NFL+P  F+  Q+ D     E  +E+QE+ ++ LH  LQPF+LRR+K DVE
Sbjct: 338 NLHELWALLNFLLPDIFSDSQDFDEWFSKETDEEDQEKIVKQLHTVLQPFLLRRIKSDVE 397

Query: 619 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGRFSMLNIMNTLMKASNH 676
            SL  K E  + V +S +Q ++Y+ IL K+  A+ A  G+K  +  +LNI+  L K  NH
Sbjct: 398 TSLLPKKELNVYVGMSPMQKKWYRQILEKDIDAVNADSGSKESKTRLLNIVMQLRKCCNH 457

Query: 677 PYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMV 736
           PYLFD AE       G    + E+    L+ +S                G RVLIFSQM 
Sbjct: 458 PYLFDGAEP------GPPYTTDEH----LVYNSEKLKVLDKLLRKLKEAGSRVLIFSQMS 507

Query: 737 RILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLM 796
           R+LDIL DY   +   + R+DG+     R  AID +NAP S  F+FLL+TRAGGLGINL 
Sbjct: 508 RVLDILEDYCYFREYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFLFLLTTRAGGLGINLT 567

Query: 797 TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 856
           TAD V++FDSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L+ 
Sbjct: 568 TADVVVLFDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLRLDQ 627

Query: 857 AIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAA---------KDNQKKLEDLNLD 907
            +I        K   K +     LS +++ GA ++F +         + +  K ED++LD
Sbjct: 628 LVIQQNRPTNKKKENKNDSKDALLS-MIQHGAADVFKSNTTSERGTPQPDDDKGEDVDLD 686

Query: 908 DVLSHAEDHVTTPDLGESHLGGEEFLK-------QFEVTDYKADVDWDDIIP 952
           ++L+ +E    + +     LG ++  K       ++  TD+K  V  D I P
Sbjct: 687 ELLAQSESKTQSLNAKYESLGLDDLQKFNQDSAYEWNGTDFKKKVQKDIISP 738

>Scas_597.8
          Length = 1065

 Score =  420 bits (1080), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 235/595 (39%), Positives = 349/595 (58%), Gaps = 45/595 (7%)

Query: 383 PPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 442
           P FI  G LR++Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L +  +  GP
Sbjct: 125 PGFI-NGTLRNYQIQGLNWLVSLHKSKLAGILADEMGLGKTLQTISFLGYLRYVEKIPGP 183

Query: 443 HLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNV 502
            LV+ P ST+  W+    KW P+++     G+++ R    + +  +           F++
Sbjct: 184 FLVIAPKSTLNNWLREINKWTPEVNAFILQGDKEERAQLVKDKLLA---------CDFDI 234

Query: 503 LMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 562
           ++ +YE I+++++    I WQ++ +DEAHR+KN ES L + L  F  +NRLLITGTPLQN
Sbjct: 235 VVASYEIIIREKSAFRKIDWQYIIIDEAHRIKNEESLLSQVLREFTSSNRLLITGTPLQN 294

Query: 563 NIKELAALVNFLMPGRFTIDQEID----FENQDEEQEQYIRDLHKRLQPFILRRLKKDVE 618
           N+ EL AL+NFL+P  F+  Q+ D     E  +E+QE+ ++ LH  LQPF+LRRLK DVE
Sbjct: 295 NLHELWALLNFLLPDIFSDSQDFDDWFSSETTEEDQEKVVKQLHTVLQPFLLRRLKNDVE 354

Query: 619 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGA--KGGRFSMLNIMNTLMKASNH 676
            SL  K E  L V +S++Q ++YK IL K+  A+      K  +  +LNI+  L K  NH
Sbjct: 355 TSLLPKQELNLYVGMSNMQKKWYKQILEKDIDAVNGSNVNKESKTRLLNIVMQLRKCCNH 414

Query: 677 PYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMV 736
           PYLFD AE       G    + E+    L+ +S               +G RVLIFSQM 
Sbjct: 415 PYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKMKEEGSRVLIFSQMS 464

Query: 737 RILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLM 796
           R+LDIL DY   +G  + R+DG+     R  AID +N PGS  F+FLL+TRAGGLGINL 
Sbjct: 465 RVLDILEDYCFFRGYEYCRIDGSTDHEDRIRAIDEYNEPGSKKFIFLLTTRAGGLGINLT 524

Query: 797 TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 856
           +A+ V++FDSDWNPQADLQAM RAHRIGQK  V V+RLV+ ++VEE++LERA +K+ L+ 
Sbjct: 525 SANIVVLFDSDWNPQADLQAMDRAHRIGQKRQVKVFRLVTDNSVEEKILERATQKLRLDQ 584

Query: 857 AIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKK------------LEDL 904
            +I    +   K  +  + +   L  +++ GA ++F + D+  +             +D+
Sbjct: 585 LVIQQNRSTLKKKKENKKDNKEALLSMIQHGAADVFQSIDSSAENSNRNTPQPGDATDDI 644

Query: 905 NLDDVLSHAEDHVTTPDLGESHLGGEEFLK-------QFEVTDYKADVDWDDIIP 952
           +LD +L+ +ED   + +     LG ++  +       ++   D+K  V  D I P
Sbjct: 645 DLDSILALSEDKTKSLNAKYESLGLDDLQRFNQDSAYEWNGQDFKKKVQKDIISP 699

>Kwal_14.1600
          Length = 1102

 Score =  419 bits (1076), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 221/518 (42%), Positives = 312/518 (60%), Gaps = 26/518 (5%)

Query: 383 PPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 442
           PPFI G  LR +Q+ G+NW+  L   N  GILADEMGLGKT+QT++F+ +L +  ++ GP
Sbjct: 129 PPFINGC-LRPYQVQGVNWLVSLHRNNLAGILADEMGLGKTLQTISFLGYLRYVEKKPGP 187

Query: 443 HLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNV 502
            +V+ P ST+  W+    +W PD+      G+++ R         +           F++
Sbjct: 188 FVVIAPKSTLNNWLREINRWTPDVRAFILQGDKEER---------AKLVANKLMACDFDI 238

Query: 503 LMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 562
           ++ +YE I+K++A    I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPLQN
Sbjct: 239 VVASYEIIIKEKASFKKIAWEYIVIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQN 298

Query: 563 NIKELAALVNFLMPGRFTIDQEID----FENQDEEQEQYIRDLHKRLQPFILRRLKKDVE 618
           N+ EL AL+NFL+P  F+  Q  D     E+ ++++ + ++ LH  LQPF+LRRLK +VE
Sbjct: 299 NLHELWALLNFLLPDVFSDSQAFDDWFSSESSEDDKGKIVKQLHTVLQPFLLRRLKNEVE 358

Query: 619 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGRFSMLNIMNTLMKASNH 676
            SL  K E  L + +S +Q  +YK IL K+  A+    G K  +  +LN+M  L K  NH
Sbjct: 359 TSLLPKKELNLYIGMSSMQKRWYKQILEKDIDAVNGANGNKESKTRLLNVMMQLRKCCNH 418

Query: 677 PYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMV 736
           PYLFD AE       G    + E+    L+ +S               +G RVLIFSQM 
Sbjct: 419 PYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLRKFKEEGSRVLIFSQMS 468

Query: 737 RILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLM 796
           R+LDIL DY   +   + R+DG+     R  AID +NAP S  FVFLL+TRAGGLGINL 
Sbjct: 469 RVLDILEDYCFFRQYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFVFLLTTRAGGLGINLT 528

Query: 797 TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 856
           TAD V+++DSDWNPQADLQAM RAHRIGQK  V V+RLV+ ++VEE++LERA +K+ L+ 
Sbjct: 529 TADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRLVTDNSVEEKILERATQKLRLDQ 588

Query: 857 AIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAA 894
            +I       N+   K   S   L  +++ GA ++F+ 
Sbjct: 589 LVIQQSRNGVNQKEVKKGDSKDALLSMIQHGAADVFST 626

>YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative
           ATP-dependent chromatin remodeling factor, has strong
           similarity to Drosophila nucleosome remodeling factor
           ISWI [3390 bp, 1129 aa]
          Length = 1129

 Score =  418 bits (1074), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 222/519 (42%), Positives = 317/519 (61%), Gaps = 26/519 (5%)

Query: 382 QPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG 441
           + P    G+LR +Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L +  +  G
Sbjct: 187 ESPAYVNGQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPG 246

Query: 442 PHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFN 501
           P LV+ P ST+  W+    +W PD++     G+++ R         +    K      F+
Sbjct: 247 PFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEER---------AELIQKKLLGCDFD 297

Query: 502 VLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 561
           V++ +YE I+++++ L  I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPLQ
Sbjct: 298 VVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQ 357

Query: 562 NNIKELAALVNFLMPGRFTIDQEID----FENQDEEQEQYIRDLHKRLQPFILRRLKKDV 617
           NN+ EL AL+NFL+P  F+  Q+ D     E+ +E+Q++ ++ LH  LQPF+LRR+K DV
Sbjct: 358 NNLHELWALLNFLLPDIFSDAQDFDDWFSSESTEEDQDKIVKQLHTVLQPFLLRRIKSDV 417

Query: 618 EKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGRFSMLNIMNTLMKASN 675
           E SL  K E  L V +S +Q ++YK IL K+  A+    G+K  +  +LNIM  L K  N
Sbjct: 418 ETSLLPKKELNLYVGMSSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCN 477

Query: 676 HPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 735
           HPYLFD AE       G    + E+    L+ ++               +G RVLIFSQM
Sbjct: 478 HPYLFDGAEP------GPPYTTDEH----LVYNAAKLQVLDKLLKKLKEEGSRVLIFSQM 527

Query: 736 VRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINL 795
            R+LDIL DY   +   + R+DG+     R  AID +NAP S  FVFLL+TRAGGLGINL
Sbjct: 528 SRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINL 587

Query: 796 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 855
            +AD V+++DSDWNPQADLQAM RAHRIGQK  V V+RLV+ ++VEE++LERA +K+ L+
Sbjct: 588 TSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLD 647

Query: 856 YAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAA 894
             +I    T   K   K +     LS +++ GA ++F +
Sbjct: 648 QLVIQQNRTSLKKKENKADSKDALLS-MIQHGAADVFKS 685

>KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces
           cerevisiae YBR245c ISW1, start by similarity
          Length = 1096

 Score =  415 bits (1066), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 236/599 (39%), Positives = 347/599 (57%), Gaps = 48/599 (8%)

Query: 382 QPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG 441
           + P    G+LR +Q+ G+NW+  L      GILADEMGLGKT+QT+AF+ +L +  ++NG
Sbjct: 132 ESPAYVNGQLRPYQIQGLNWLVALHKNQLAGILADEMGLGKTLQTIAFLGYLRYIEKKNG 191

Query: 442 PHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFN 501
           P LV+ P ST+  W+    +W P++      G+++ R      +  +           F+
Sbjct: 192 PFLVIAPKSTLNNWLREINRWTPEVSAFILQGDKEERSKLCHDKLLA---------CDFD 242

Query: 502 VLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 561
           + + +YE I++++A    I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPLQ
Sbjct: 243 ICVASYEIIIREKASFKKIDWEYVVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQ 302

Query: 562 NNIKELAALVNFLMPGRF----TIDQEIDFENQDEEQEQYIRDLHKRLQPFILRRLKKDV 617
           NN+ EL AL+NFL+P  F    T D+    E+ +E++E+ ++ LH  L PF+LRR+K DV
Sbjct: 303 NNLHELWALLNFLLPDIFADSATFDEWFSSESSEEDKEKVVKQLHTVLSPFLLRRIKNDV 362

Query: 618 EKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGRFSMLNIMNTLMKASN 675
           E SL  K E  + V +S +Q ++YK IL K+  A+    G K  +  +LNI+  L K  N
Sbjct: 363 EGSLLPKKELNVYVGMSSMQKKWYKQILEKDIDAVNGSNGQKESKTRLLNIVMQLRKCCN 422

Query: 676 HPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 735
           HPYLFD AE       G    + E+    L+ +S                G RVLIFSQM
Sbjct: 423 HPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKFKEQGSRVLIFSQM 472

Query: 736 VRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINL 795
            R+LDIL DY   +   + R+DG+     R  AID +NAP S  F+FLL+TRAGGLGINL
Sbjct: 473 SRVLDILEDYCYFREYEYCRIDGSTAHEDRINAIDDYNAPDSKKFIFLLTTRAGGLGINL 532

Query: 796 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 855
            TAD V+++DSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L+
Sbjct: 533 TTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLKLD 592

Query: 856 YAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDN---------------QKK 900
             +I  G     K   K +   G LS +++ GA ++F + D+               + K
Sbjct: 593 QLVIQQGRVTNKKKENKNDSKEGLLS-MIQHGAVDVFKSNDSSAMTSQTGTPHPDDGKDK 651

Query: 901 LEDLNLDDVLSHAEDHVTTPDLGESHLGGEEFLK-------QFEVTDYKADVDWDDIIP 952
            ED++LD +L+ +ED   + +   + LG +E  +       +++  ++K  V+ D I P
Sbjct: 652 DEDVDLDALLAQSEDKTRSLNAKYATLGLDELQRFNQDSAYEWDGQNFKKKVEKDIINP 710

>Kwal_23.4777
          Length = 1301

 Score =  419 bits (1076), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 240/563 (42%), Positives = 335/563 (59%), Gaps = 52/563 (9%)

Query: 377 EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFA 436
           EK+  QP  + GG L+++Q+ G+ WM  L++ + NGILADEMGLGKT+Q+++ I++L   
Sbjct: 442 EKIEKQPSILVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLRET 501

Query: 437 RRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKK 496
           + + GP LV+VPLST+  W   FEKWAP +  I Y G               N +   + 
Sbjct: 502 KNEPGPFLVIVPLSTITNWTLEFEKWAPSLATIVYKGT-------------PNQRKSMQH 548

Query: 497 QIK---FNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSF-KVANR 552
           QI+   F VL+TTYEYI+KDR+ L    W  + +DE HR+KNA+S L  +L  + +  NR
Sbjct: 549 QIRIGNFEVLLTTYEYIIKDRSLLAKHDWSHMIIDEGHRMKNAQSKLSFTLTRYYRTRNR 608

Query: 553 LLITGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEEQEQ---------Y 597
           L++TGTPLQNN+ EL AL+NF++P  F   +  D      F N   +++           
Sbjct: 609 LILTGTPLQNNLPELWALLNFVLPKIFNSAKTFDEWFNTPFANTGGQEKLELTEEETLLV 668

Query: 598 IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKN---YSALTA 654
           IR LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + A T 
Sbjct: 669 IRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQHQLYQQMLKHNALFFGAGTE 728

Query: 655 GA-KGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXX 713
           GA KGG   + N +  L K  NHP++FD  E       G  N SR N    L   +G   
Sbjct: 729 GATKGGIKGLNNKIMQLRKICNHPFVFDEVE-------GIINPSRANSPL-LYRVAGKFE 780

Query: 714 XXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFN 773
                       GHRVL+F QM +++DI+ D+L ++G+ + RLDG   +  R   +  FN
Sbjct: 781 LLDRILLKFKVTGHRVLMFFQMTQVMDIMEDFLRMRGLKYLRLDGATKTEDRTGMLKLFN 840

Query: 774 APGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR 833
           AP S+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R
Sbjct: 841 APNSEYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILR 900

Query: 834 LVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFA 893
           L++ D+VEE +LERA +K+ ++  +I  G  D NK T      A E    L+    N  A
Sbjct: 901 LITTDSVEEVILERALQKLDIDGKVIQAGKFD-NKST------AEEQEAFLRRLLENENA 953

Query: 894 A-KDNQKKLEDLNLDDVLSHAED 915
             +D++ +L D  L+D+L+  ED
Sbjct: 954 KDEDDEAELNDEELNDILARGED 976

>AER375C [2876] [Homologous to ScYIL126W (STH1) - SH]
           (1332505..1336371) [3867 bp, 1288 aa]
          Length = 1288

 Score =  417 bits (1072), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 224/517 (43%), Positives = 316/517 (61%), Gaps = 45/517 (8%)

Query: 377 EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFA 436
           EK+  QP  + GG L+++Q+ G+ WM  L++ + NGILADEMGLGKT+Q+++ I++L   
Sbjct: 443 EKVEKQPSILVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEV 502

Query: 437 RRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKK 496
           ++ +GP LV+VPLST+  W   FEKWAP +  + Y G               N +   + 
Sbjct: 503 KKDSGPFLVIVPLSTITNWTLEFEKWAPSLTTVIYKGT-------------PNQRRSLQH 549

Query: 497 QIK---FNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSL-YESLNSFKVANR 552
           Q++   F+VL+TTYEYI+KDR+ L   +W  + +DE HR+KNA+S L Y   + +K  +R
Sbjct: 550 QVRIGDFDVLLTTYEYIIKDRSLLAKHEWSHMIIDEGHRMKNAQSKLSYTLTHYYKTRHR 609

Query: 553 LLITGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEEQEQ---------Y 597
           L++TGTPLQNN+ EL AL+NF++P  F   +  D      F N   +++           
Sbjct: 610 LILTGTPLQNNLPELWALLNFVLPKIFNSSKTFDEWFNTPFSNTGGQEKLELTEEEALLV 669

Query: 598 IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGA- 656
           IR LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + AG  
Sbjct: 670 IRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQHQLYQQMLKHNALFVGAGTE 729

Query: 657 ---KGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXX 713
              KGG   + N +  L K  NHP++FD  E       G  N +R N    L   SG   
Sbjct: 730 GATKGGIKGLNNKIMQLRKICNHPFVFDEVE-------GVVNPTRTNS-SLLYRVSGKFE 781

Query: 714 XXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFN 773
                       GHRVL+F QM +++DI+ D+L +K + + RLDG   + +R   ++ FN
Sbjct: 782 LLDRVLPKFKATGHRVLMFFQMTQVMDIMEDFLQMKNLKYMRLDGATKAEERTGMLNAFN 841

Query: 774 APGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR 833
           AP SD F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R
Sbjct: 842 APDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILR 901

Query: 834 LVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYT 870
           L++ D+VEE +LERA +K+ ++  +I  G  D NK T
Sbjct: 902 LITTDSVEEVILERAMQKLDIDGKVIQAGKFD-NKST 937

>KLLA0F04521g complement(435649..439683) similar to sp|P32597
            Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
            complex, start by similarity
          Length = 1344

 Score =  417 bits (1071), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 234/560 (41%), Positives = 327/560 (58%), Gaps = 46/560 (8%)

Query: 377  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFA 436
            E +  QP  + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+Q+++ IS+L   
Sbjct: 499  ETVDKQPSILVGGTLKEYQLKGLEWMVSLYNNHLNGILADEMGLGKTIQSISLISYLYEI 558

Query: 437  RRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKK 496
            + +  P LV+VPLST+  W   FEKWAP +  I Y GN   R   +      N       
Sbjct: 559  KNERQPFLVIVPLSTITNWTIEFEKWAPSLRTIVYKGNPNQRKALQHTIKMGN------- 611

Query: 497  QIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSL-YESLNSFKVANRLLI 555
               F+V++TTYEYI+KDR  L    W  + +DE HR+KNA+S L Y   + +K  NRL++
Sbjct: 612  ---FDVVLTTYEYIIKDRPLLAKHDWAHMIIDEGHRMKNAQSKLSYTLTHYYKTKNRLIL 668

Query: 556  TGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQDEEQEQYIRD 600
            TGTPLQNN+ EL AL+NF++P  F   +  D                E  +EE    IR 
Sbjct: 669  TGTPLQNNLPELWALLNFVLPKIFNSSKTFDEWFNTPFANTGTQEKLEMTEEETLLVIRR 728

Query: 601  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGR 660
            LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + AG +G  
Sbjct: 729  LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSSLQQQLYEQMLKHNAFFIGAGTEGAT 788

Query: 661  FSMLNIMNT----LMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXX 716
             + +  +N     L K  NHP++FD  E  +       N +REN    L   SG      
Sbjct: 789  KAGIKGLNNKVMQLRKICNHPFVFDEVENVI-------NPTRENS-SILYRVSGKFELLD 840

Query: 717  XXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPG 776
                     GHRVL+F QM +++DI+ D+L ++ + + RLDG   +  R   +  FNAP 
Sbjct: 841  RVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMRDLKYMRLDGGTKAEDRTGMLKLFNAPD 900

Query: 777  SDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 836
            S+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 901  SEYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 960

Query: 837  KDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEIL-KFGAGNMFAAK 895
             D+VEE +LERA +K+ ++  +I  G  D NK T      A E  E L +   G+     
Sbjct: 961  TDSVEEVILERAMQKLDIDGKVIQAGKFD-NKST------AEEQEEFLRRLLEGDTNKDD 1013

Query: 896  DNQKKLEDLNLDDVLSHAED 915
            +   +L+D  L+++L+  ED
Sbjct: 1014 EYSGELDDEELNEILARTED 1033

>Scas_662.7
          Length = 1342

 Score =  416 bits (1069), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 224/516 (43%), Positives = 319/516 (61%), Gaps = 43/516 (8%)

Query: 377 EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFA 436
           EK+  QP  + GG L+++Q+ G+ WM  L++ + NGILADEMGLGKT+Q+++ I++L   
Sbjct: 447 EKIDKQPSMLVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLFEE 506

Query: 437 RRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMG--NQKSRDIEREYEFYSNPKGKG 494
           ++  GP+LV+VPLST+  W   FEKWAP ++ + Y G  NQ+ R+++ +    +      
Sbjct: 507 KKDPGPYLVIVPLSTITNWTLEFEKWAPSLNTVIYKGTPNQR-RNLQHQVRIGN------ 559

Query: 495 KKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSL-YESLNSFKVANRL 553
                F+VL+TTYEYI+KDRA L   +W  + +DE HR+KNA+S L Y   + +K  +RL
Sbjct: 560 -----FDVLLTTYEYIIKDRALLAKHEWTHMIIDEGHRMKNAQSKLSYTITHYYKTRHRL 614

Query: 554 LITGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEEQEQ---------YI 598
           ++TGTPLQNN+ EL AL+NF++P  F   +  +      F N    ++           I
Sbjct: 615 ILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTGEKLELTEEETLLVI 674

Query: 599 RDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKG 658
           R LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   L  G +G
Sbjct: 675 RRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQQQLYEQMLKHNALFLGEGTEG 734

Query: 659 GRFSMLNIMNT----LMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXX 714
              S +  +N     L K  NHP++FD  E       G  N +R N    L   SG    
Sbjct: 735 ATKSGIKGLNNKIMQLRKICNHPFVFDEVE-------GVINPTRANS-NLLYRVSGKFEL 786

Query: 715 XXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNA 774
                      GHRVL+F QM +++DI+ D+L +K + + RLDG+  ++ R   ++ FNA
Sbjct: 787 LNRVLPKFKAAGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKADDRTGMLNDFNA 846

Query: 775 PGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRL 834
           P SD F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + RL
Sbjct: 847 PDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRL 906

Query: 835 VSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYT 870
           ++ D+VEE +LERA +K+ ++  +I  G  D NK T
Sbjct: 907 ITTDSVEEVILERAMQKLDIDGKVIQAGKFD-NKST 941

>YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundant
           chromatin remodeling complex (RSC), involved in the
           response to DNA damage, DNA helicase of the Snf2p
           family, has a bromodomain [4080 bp, 1359 aa]
          Length = 1359

 Score =  405 bits (1040), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 224/517 (43%), Positives = 317/517 (61%), Gaps = 45/517 (8%)

Query: 377 EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFA 436
           EK+  QP  + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+Q+++ I++L   
Sbjct: 456 EKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEV 515

Query: 437 RRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKK 496
           ++  GP LV+VPLST+  W   FEKWAP ++ I Y G               N +   + 
Sbjct: 516 KKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGT-------------PNQRHSLQH 562

Query: 497 QIK---FNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSF-KVANR 552
           QI+   F+VL+TTYEYI+KD++ L    W  + +DE HR+KNA+S L  +++ + +  NR
Sbjct: 563 QIRVGNFDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNR 622

Query: 553 LLITGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEEQEQ---------Y 597
           L++TGTPLQNN+ EL AL+NF++P  F   +  +      F N   +++           
Sbjct: 623 LILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLI 682

Query: 598 IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGA- 656
           IR LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + AG  
Sbjct: 683 IRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALFVGAGTE 742

Query: 657 ---KGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXX 713
              KGG   + N +  L K  NHP++FD  E       G  N SR N    L   +G   
Sbjct: 743 GATKGGIKGLNNKIMQLRKICNHPFVFDEVE-------GVVNPSRGNS-DLLFRVAGKFE 794

Query: 714 XXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFN 773
                       GHRVL+F QM +++DI+ D+L +K + + RLDG+  + +R   ++ FN
Sbjct: 795 LLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFN 854

Query: 774 APGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR 833
           AP SD F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R
Sbjct: 855 APDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILR 914

Query: 834 LVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYT 870
           L++ D+VEE +LERA +K+ ++  +I  G  D NK T
Sbjct: 915 LITTDSVEEVILERAMQKLDIDGKVIQAGKFD-NKST 950

>Kwal_26.9164
          Length = 1454

 Score =  405 bits (1041), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 229/558 (41%), Positives = 335/558 (60%), Gaps = 62/558 (11%)

Query: 377  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFA 436
            E++  QP  + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+QT++ +++L   
Sbjct: 588  EEIKQQPSILVGGTLKEYQLKGLQWMVSLYNNHLNGILADEMGLGKTIQTISLLTYLYEV 647

Query: 437  RRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKK 496
            +   GP LV+VPLST+  W   F+KWAP I  + Y G+   R              K K+
Sbjct: 648  KNVRGPSLVIVPLSTLTNWDSEFDKWAPVIRKVAYKGSPNER--------------KSKQ 693

Query: 497  QI----KFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN- 551
             I    +F+V++TT+EYI+K+RA L  IKW  + +DE HR+KNA+S L  +LN++   + 
Sbjct: 694  GIIRSGQFDVVLTTFEYIIKERALLSKIKWVHMIIDEGHRMKNAQSKLSLTLNNYYHTDY 753

Query: 552  RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN---------QDEEQEQ 596
            RL++TGTPLQNN+ EL AL+NF++P  F   +  D      F N          +EE   
Sbjct: 754  RLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLL 813

Query: 597  YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKN---YSALT 653
             IR LHK L+PF+LRRLKKDVEK LP K E++L+ ++S +Q + Y+ +L         L 
Sbjct: 814  VIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVLKCKMSALQQKLYEQMLKHRRLFIGDLN 873

Query: 654  AGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRE---NILRGLIMSSG 710
            +    G     N +  L K  NHP++F+  E+++       N +RE   NI R     +G
Sbjct: 874  SNKNVGMRGFNNQIMQLKKICNHPFVFEEVEDQI-------NPTRETNANIWR----VAG 922

Query: 711  XXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAID 770
                           GHR+LIF QM +I+DI+ D+L +  + + RLDG   S+ R + ++
Sbjct: 923  KFELLERILPKFKATGHRILIFFQMTQIMDIMEDFLRLSNMKYLRLDGHTKSDDRTLLLN 982

Query: 771  HFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVM 830
             FNAP S+ F FLLSTRAGGLG+NL +ADTVIIFD+DWNP  DLQA  RAHRIGQKN V 
Sbjct: 983  LFNAPNSEYFCFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVR 1042

Query: 831  VYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGN 890
            + RL+++++VEE +L+RA KK+ ++  +I  G  D NK T +      E   +L+    +
Sbjct: 1043 ILRLITENSVEEVILDRAHKKLDIDGKVIQAGKFD-NKSTSE------EQEALLR----S 1091

Query: 891  MFAAKDNQKKLEDLNLDD 908
            +  A++ QK+  +L L++
Sbjct: 1092 LLEAEEEQKRKRELGLEE 1109

>KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces
            cerevisiae YOR290c SNF2 component of SWI/SNF global
            transcription activator complex, hypothetical start
          Length = 1534

 Score =  402 bits (1034), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 223/561 (39%), Positives = 331/561 (59%), Gaps = 38/561 (6%)

Query: 377  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFA 436
            E++  QP  + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+QT++ +++L  A
Sbjct: 670  EEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEA 729

Query: 437  RRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKK 496
            +  +GP LV+VPLST+  W   F+KWAP +  I + G    R           PK    K
Sbjct: 730  KGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER----------KPKQALIK 779

Query: 497  QIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLI 555
              +F+V++TT+EYI+K+R  L  IKW    +DE HR+KNA+S L  +LN++  ++ RL++
Sbjct: 780  NREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 839

Query: 556  TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN---------QDEEQEQYIRD 600
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N          +EE    IR 
Sbjct: 840  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRR 899

Query: 601  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGR 660
            LHK L+PF+LRRLKKDVEK LP K E++L+ ++S +Q + Y+ +L      +   +   +
Sbjct: 900  LHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQK 959

Query: 661  FS----MLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXX 716
            FS      N +  L K  NHP++F+  E+++         + + I R    S+G      
Sbjct: 960  FSSSRGFNNQIMQLRKICNHPFVFEEVEDQI----NPARETNDTIWR----SAGKFELLE 1011

Query: 717  XXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPG 776
                     GHRVLIF QM +++DI+ D+L    + + RLDG   S+ R   ++ FNAP 
Sbjct: 1012 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPN 1071

Query: 777  SDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 836
            SD F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 1072 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1131

Query: 837  KDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKD 896
             ++VEE +L++A  K+ ++  +I  G  D     ++ E     L E  +          +
Sbjct: 1132 DNSVEEAILDKAHAKLDIDGKVIQAGKFDNKSTAEEQEALLRSLLEAEEEEKKRRELGIE 1191

Query: 897  NQKKLEDLNLDDVLSHAEDHV 917
             +++L+D  L+++L+  E+ +
Sbjct: 1192 EEEQLDDNELNEILARNENEI 1212

>AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH]
            (1439983..1444257,1444339..1444398) [4335 bp, 1444 aa]
          Length = 1444

 Score =  397 bits (1020), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 228/566 (40%), Positives = 329/566 (58%), Gaps = 48/566 (8%)

Query: 377  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFA 436
            E + VQP  + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+QT++ +++L   
Sbjct: 547  EDVRVQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEF 606

Query: 437  RRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKK 496
            +  +GP LV+VPLST+  W   F+KWAP +  + + G    R      +  S     G  
Sbjct: 607  KGIHGPFLVIVPLSTLTNWNAEFDKWAPTLRKLAFKGPPSER------KALSGIIKSGN- 659

Query: 497  QIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLI 555
               F+V++TT+EYI+K+R  L  +KW  + +DE HR+KNA+S L  +LN +   + RL++
Sbjct: 660  ---FDVVLTTFEYIIKERPLLSKVKWVHMIIDEGHRMKNAQSKLSLTLNQYYHTDYRLIL 716

Query: 556  TGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQDEEQEQYIRD 600
            TGTPLQNN+ EL AL+NF++P  F   +  D                E  +EE    IR 
Sbjct: 717  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRR 776

Query: 601  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGR 660
            LHK L+PF+LRRLKKDVEK LP K E++L+  +S +Q + Y+ +L      +       +
Sbjct: 777  LHKVLRPFLLRRLKKDVEKELPDKVEKVLKCRMSALQQKLYEQMLKHRRLFVVDDPSSKK 836

Query: 661  FSMLNIMNT----LMKASNHPYLFDSAEEKVLEKFGAGNMSRE---NILRGLIMSSGXXX 713
               L   N     L K  NHP++F+  E+++       N +RE   NI R     +G   
Sbjct: 837  MVGLRGFNNQIMQLKKICNHPFVFEEVEDQI-------NPNRETNANIWR----VAGKFE 885

Query: 714  XXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFN 773
                        GHRVLIF QM +I+DI+ D+L    + + RLDG   S+ R   ++ FN
Sbjct: 886  LLEKILPKFKASGHRVLIFFQMTQIMDIMEDFLRFCDMKYLRLDGHTKSDDRTALLNKFN 945

Query: 774  APGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR 833
            APGSD F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R
Sbjct: 946  APGSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILR 1005

Query: 834  LVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKTEPSAGEL--SEILKFGAGNM 891
            L++ ++VEE +LERA +K+ ++  +I  G  D     ++ E     L  +E  +     M
Sbjct: 1006 LITDNSVEEVILERAHRKLDIDGKVIQAGKFDNKSTAEEQEALLRSLLEAEEEQKRKREM 1065

Query: 892  FAAKDNQKKLEDLNLDDVLSHAEDHV 917
              A+D Q  L+D  L+++L+  ++ +
Sbjct: 1066 GVAEDEQ--LDDSELNEILARNDNEL 1089

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, hypothetical start
          Length = 1354

 Score =  395 bits (1016), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 217/514 (42%), Positives = 309/514 (60%), Gaps = 39/514 (7%)

Query: 377 EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFA 436
           EK+  QP  + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+Q+++ I++L   
Sbjct: 439 EKIEKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEV 498

Query: 437 RRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKK 496
           +++ GP+LV+VPLST+  W   FEKWAP +  I Y G    R   +      N       
Sbjct: 499 KQEPGPYLVIVPLSTITNWTLEFEKWAPSLTTIIYKGTPNQRHALQHKIRSGN------- 551

Query: 497 QIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSF-KVANRLLI 555
              F+VL+TTYEYI+KD+A L   +W  + +DE HR+KNA S L  ++  + +  NRL++
Sbjct: 552 ---FDVLLTTYEYIIKDKALLSKHEWSHMIIDEGHRMKNANSKLSFTITKYYRTRNRLIL 608

Query: 556 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEEQEQ---------YIRD 600
           TGTPLQNN+ EL AL+NF++P  F   +  +      F N   +++           IR 
Sbjct: 609 TGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLVIRR 668

Query: 601 LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGA---- 656
           LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + AG     
Sbjct: 669 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQQQLYQQMLKHNALFVGAGTEGAT 728

Query: 657 KGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXX 716
           KGG   + N +  L K  NHP++FD  E  V    G  ++        L   +G      
Sbjct: 729 KGGIKGLNNKIMQLRKICNHPFVFDEVEAVVNPSRGNSDL--------LYRVAGKFELLD 780

Query: 717 XXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPG 776
                    GHRVLIF QM +++DI+ D+L ++ + + RLDG+  +  R   +  FN   
Sbjct: 781 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRMRDLKYMRLDGSTKAEDRNDMLKEFNVEN 840

Query: 777 SDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 836
           S+ F FLLSTRAGGLG+NL +ADTVIIFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 841 SEYFCFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 900

Query: 837 KDTVEEEVLERARKKMILEYAIISLGVTDGNKYT 870
            D+VEE +LERA +K+ ++  +I  G  D NK T
Sbjct: 901 TDSVEEVILERAMQKLDIDGKVIQAGKFD-NKST 933

>Scas_594.7
          Length = 1703

 Score =  399 bits (1025), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 239/618 (38%), Positives = 353/618 (57%), Gaps = 58/618 (9%)

Query: 282  IEIMDMEHERRLDELQEFTNPERIIDSQRVELEDGTSQLQYLVKWRHLNYDEATWEDAAE 341
            I+++D   + R+  L + TN    +DS    ++D     + ++    L   EA+ ED + 
Sbjct: 713  IKLLDQTKDTRITHLLKQTNA--FLDSLTRAVKDQQKYTKEMIDSHLL---EASEEDKS- 766

Query: 342  IVKIAPE-PVKHFQSRQNSKILPQYSSNYTSERPRFEKLSVQPPFIKGGELRDFQLTGIN 400
               ++P  PV  F   ++ +    +     + R + E++  QP  + GG L+++QL G+ 
Sbjct: 767  ---VSPSMPVATFPDEEDGEEKGNFDYYSVAHRIK-EEIRQQPAMLVGGTLKEYQLKGLQ 822

Query: 401  WMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPLSTMPAWIETFE 460
            WM  L++ + NGILADEMGLGKT+QT++ +++L   +  +GP+LV+VPLST+  W   F 
Sbjct: 823  WMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYETKHIHGPYLVIVPLSTLSNWSNEFA 882

Query: 461  KWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSI 520
            KWAP +  I Y G+   R            K    K  +F+V++TT+EYI+K+RA L  +
Sbjct: 883  KWAPTMRCISYKGSPNER----------KSKHAIIKSGEFDVVLTTFEYIIKERALLSKV 932

Query: 521  KWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLITGTPLQNNIKELAALVNFLMPGRF 579
            KW  + +DE HR+KNA+S L  +LN++  ++ RL++TGTPLQNN+ EL AL+NF +P  F
Sbjct: 933  KWIHMIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFALPKIF 992

Query: 580  TIDQEID---------------FENQDEEQEQYIRDLHKRLQPFILRRLKKDVEKSLPSK 624
               +  D                E  +EE    IR LHK L+PF+LRRLKKDVEK LP K
Sbjct: 993  NSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDK 1052

Query: 625  TERILRVELSDVQTEYYKNILTKNYSALTAGAKGGR--FSMLNIMNTLM---KASNHPYL 679
             E++++ ++S +Q   Y+ +L   Y  L  G    +    +    N LM   K  NHP++
Sbjct: 1053 VEKVIKCKMSALQQIMYQQML--KYRRLFIGDHTNKKMVGLRGFNNQLMQLKKICNHPFV 1110

Query: 680  FDSAEEKVLEKFGAGNMSRE---NILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMV 736
            F+  E+++       N +RE   NI R     +G               GHRVLIF QM 
Sbjct: 1111 FEEVEDQI-------NPTRETNANIWR----VAGKFELLEKVLPKLKATGHRVLIFFQMT 1159

Query: 737  RILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLM 796
            +I+DI+ D+L    I + RLDG   S+ R   +  FNAP S+   F+LSTRAGGLG+NL 
Sbjct: 1160 QIMDIVEDFLRFIDIKYLRLDGHTKSDDRSNLLKLFNAPDSEYLCFILSTRAGGLGLNLQ 1219

Query: 797  TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 856
            TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + RL+++ +VEE +LERA KK+ ++ 
Sbjct: 1220 TADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITEHSVEEAILERAHKKLDIDG 1279

Query: 857  AIISLGVTDGNKYTKKTE 874
             +I  G  D    +++ E
Sbjct: 1280 KVIQAGKFDNKSTSEEQE 1297

>CAGL0M04807g complement(514847..520039) similar to sp|P22082
            Saccharomyces cerevisiae YOR290c SNF2 or sp|P32597
            Saccharomyces cerevisiae YIL126w STH1, hypothetical start
          Length = 1730

 Score =  397 bits (1021), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 223/561 (39%), Positives = 327/561 (58%), Gaps = 43/561 (7%)

Query: 377  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFA 436
            E++  QP  + GG L+++Q+ G+ WM  L++ + NGILADEMGLGKT+QT++ +++L   
Sbjct: 788  EEVRQQPSILVGGTLKEYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEM 847

Query: 437  RRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKK 496
            +   GP L++VPLST+P W   F KWAP +  I Y G+   R +          K    K
Sbjct: 848  KNIKGPFLIIVPLSTLPNWSSEFAKWAPKLRTISYKGSPNERKM----------KQAQIK 897

Query: 497  QIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLI 555
              +F+ ++TT+EYI+K+RA L  +KW  + +DE HR+KNA+S L  +LN+F  ++ RL++
Sbjct: 898  SGEFDAVITTFEYIIKERAILSKVKWVHMIIDEGHRMKNAQSKLSLTLNTFYHSDYRLIL 957

Query: 556  TGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQDEEQEQYIRD 600
            TGTPLQNN+ EL AL+NF++P  F   +  D                E  +EE    IR 
Sbjct: 958  TGTPLQNNLPELWALLNFVLPKIFNSAKSFDEWFNTPFANTGGQDKIELSEEETLLIIRR 1017

Query: 601  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGR 660
            LHK L+PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L      +    K   
Sbjct: 1018 LHKVLRPFLLRRLKKDVEKELPDKVEKVIKCKMSALQHAMYQQMLKHKQLFIGDQKKNKL 1077

Query: 661  FSMLNIMNTLM---KASNHPYLFDSAEEKVLEKFGAGNMSRE---NILRGLIMSSGXXXX 714
              +    N LM   K  NHP++F+  E+ +       N +R+   NI R     +G    
Sbjct: 1078 VGLRGFNNQLMQLKKICNHPFVFEEVEDHI-------NPTRDTNMNIWR----VAGKFEL 1126

Query: 715  XXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNA 774
                        HRVLIF QM +I+DI+ D+L    I + RLDG   S++R   +  FN 
Sbjct: 1127 LERILPKLKASRHRVLIFFQMTQIMDIMEDFLRYIDIKYLRLDGHTRSDERGELLKLFND 1186

Query: 775  PGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRL 834
            P S+ F F+LSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + RL
Sbjct: 1187 PNSEYFCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIIRL 1246

Query: 835  VSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAA 894
            ++ ++VEE +LERA KK+ ++  +I  G  D     ++ E     L E  +       A 
Sbjct: 1247 ITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTAEEQEALLRSLLEAEEGRRRRREAG 1306

Query: 895  KDNQKKLEDLNLDDVLSHAED 915
             + +++L D  ++++L+ +ED
Sbjct: 1307 IEEEEELRDNEINEILARSED 1327

>YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component of
            SWI-SNF global transcription activator complex, acts to
            assist gene-specific activators through chromatin
            remodeling, involved in sensitivity to UV irradiation
            [5112 bp, 1703 aa]
          Length = 1703

 Score =  394 bits (1013), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 220/527 (41%), Positives = 312/527 (59%), Gaps = 57/527 (10%)

Query: 377  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFA 436
            E +  QP  + GG L+D+Q+ G+ WM  L++ + NGILADEMGLGKT+QT++ +++L   
Sbjct: 753  EDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEM 812

Query: 437  RRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKK 496
            +   GP+LV+VPLST+  W   F KWAP +  I + G+               P  +  K
Sbjct: 813  KNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGS---------------PNERKAK 857

Query: 497  QIK-----FNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 551
            Q K     F+V++TT+EYI+K+RA L  +KW  + +DE HR+KNA+S L  +LN+   A+
Sbjct: 858  QAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHAD 917

Query: 552  -RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQDEEQE 595
             RL++TGTPLQNN+ EL AL+NF++P  F   +  D                E  +EE  
Sbjct: 918  YRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETL 977

Query: 596  QYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG 655
              IR LHK L+PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L   Y  L  G
Sbjct: 978  LVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQML--KYRRLFIG 1035

Query: 656  AKG-----GRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRE---NILRGLIM 707
             +      G     N +  L K  NHP++F+  E+++       N +RE   +I R    
Sbjct: 1036 DQNNKKMVGLRGFNNQIMQLKKICNHPFVFEEVEDQI-------NPTRETNDDIWR---- 1084

Query: 708  SSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRI 767
             +G               GHRVLIF QM +I+DI+ D+L    I + RLDG   S++R  
Sbjct: 1085 VAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSE 1144

Query: 768  AIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKN 827
             +  FNAP S+   F+LSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN
Sbjct: 1145 LLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKN 1204

Query: 828  HVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKTE 874
             V + RL++ ++VEE +LERA KK+ ++  +I  G  D    +++ E
Sbjct: 1205 EVRILRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTSEEQE 1251

>KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, start by similarity
          Length = 826

 Score =  331 bits (849), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 208/558 (37%), Positives = 295/558 (52%), Gaps = 96/558 (17%)

Query: 381 VQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQN 440
           +QP F+K  +L+ +Q  G+NW+  L+    NGILADEMGLGKT+Q++A +++ I+     
Sbjct: 187 MQPSFLKNCQLKPYQKEGLNWLITLYENGLNGILADEMGLGKTIQSIALLAF-IYEMDTK 245

Query: 441 GPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGN--QKSRDIEREYEFYSNPKGKGKKQI 498
           GP L+  PLST+  W+  F ++APDI V+ Y  +  Q +R      +F+ N KG+G    
Sbjct: 246 GPFLIAAPLSTVENWMNEFARFAPDIPVLKYYNSEGQAARHAMMG-KFFKNNKGEG---- 300

Query: 499 KFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGT 558
              V++T+YE I++D   + S +W+FL VDE HRLKN    L   L     +NRLL+TGT
Sbjct: 301 ---VIITSYEIIIRDIELILSYQWKFLIVDEGHRLKNINCKLIRELKRINTSNRLLLTGT 357

Query: 559 PLQNNIKELAALVNFLMPGRFTIDQEI-----DFEN--------------QDEEQEQYIR 599
           PLQNN+ EL +L+NF++P  F+ D EI     DF +               DE ++  I 
Sbjct: 358 PLQNNLGELWSLLNFILPNIFS-DFEIFNKWFDFSDLNLESSSEKLTKIINDELEKNLIS 416

Query: 600 DLHKRLQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTEYYKNIL------------T 646
           +LH  L+PF+LRRLKK+V   SLP K E I+   ++ +Q +YYK  L             
Sbjct: 417 NLHTILKPFLLRRLKKNVLAGSLPPKREYIITCPVTPLQKKYYKQALKGNLKQTIQKQAI 476

Query: 647 KNYSALTAGAKG---------------------------GRFSML--------------- 664
           K++  L A   G                           G+   L               
Sbjct: 477 KDFFTLNAEYIGTVSNKSIRDFIEWKLSADSQDIPNDNIGKMEKLYDMHIHKELLNKRLQ 536

Query: 665 NIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXX 724
           N+M  L +  N  YLF              +++ EN+L+    +SG              
Sbjct: 537 NMMIQLRQIVNSTYLF------YFPLLEPTDLTLENLLK----TSGKLQVLQKLVPELIK 586

Query: 725 DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLL 784
             H+VLIFSQ V +LD++ D+  +      R+DG++ +N R+  I+ F+  GS   +FLL
Sbjct: 587 KKHKVLIFSQFVSMLDLIEDWSELNNFISCRIDGSMQNNSRKEQIEEFSKKGSKANLFLL 646

Query: 785 STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 844
           STRA GLGINL  AD+VIIFDSDWNPQ DLQAM RAHRIGQ   V+VYRL   +T+E  +
Sbjct: 647 STRAAGLGINLTAADSVIIFDSDWNPQVDLQAMDRAHRIGQTKPVIVYRLYCDNTIENVI 706

Query: 845 LERARKKMILEYAIISLG 862
           + RA  K  LE  +I +G
Sbjct: 707 MTRAVNKRKLEKLVIQMG 724

>CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, hypothetical start
          Length = 844

 Score =  330 bits (846), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 205/548 (37%), Positives = 289/548 (52%), Gaps = 77/548 (14%)

Query: 382 QPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG 441
           QP ++K   L+ +Q+ G+NW+  L+    NGILADEMGLGKT+Q++A +S+ I+     G
Sbjct: 210 QPSYLKNCVLKPYQMEGLNWLITLYENGLNGILADEMGLGKTIQSIALLSF-IYEMDTKG 268

Query: 442 PHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREY--EFYSNPKGKGKKQIK 499
           P L+  PLST+  W+  F K+AP+I ++ Y   Q  +D  ++   +F+ N   +G     
Sbjct: 269 PFLIAAPLSTVDNWMNEFAKFAPEIPILKYYS-QNGQDARQKLLKKFFKNNNREG----- 322

Query: 500 FNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTP 559
             V++T+YE I++D   +   +W+FL VDE HRLKN    L + L     +NRLL+TGTP
Sbjct: 323 --VIVTSYEMIIRDANIIMGEQWKFLIVDEGHRLKNINCRLIQELKRINTSNRLLLTGTP 380

Query: 560 LQNNIKELAALVNFLMPGRFTIDQEI-----DFEN--------------QDEEQEQYIRD 600
           LQNN+ EL +L+NF++P  F  D EI     DF++               DE ++  I +
Sbjct: 381 LQNNLSELWSLLNFILPDIFA-DFEIFNKWFDFKDLDLQSNSAKLNKLINDELEKNLISN 439

Query: 601 LHKRLQPFILRRLKKDVEKS-LPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGG 659
           LH  L+PF+LRRLK  V K  LP K E I+   LS +QT++Y+  L+             
Sbjct: 440 LHTILKPFLLRRLKSVVLKDVLPPKREYIVNCPLSPIQTKFYRMALSGKLKVTVFKELVK 499

Query: 660 RFSMLN--IMNTLMKASNHPYL-FDSAEEKVLEKFGA-----------------GNMSRE 699
            F  LN   + T+   S   ++ +  +EE   +K  A                  N   +
Sbjct: 500 AFFTLNQEYIGTVSNKSIRDFIDYKLSEEPDEDKVTAVIKQMDDIYMEHLNTFTKNQRLQ 559

Query: 700 NILRGL-------------------------IMSSGXXXXXXXXXXXXXXDGHRVLIFSQ 734
           N++  L                         + SSG               GH++LIFSQ
Sbjct: 560 NMMMQLRQVVDSTLLFFFPYMEPEDITLDYLLASSGKLQMLQKLAIPLIKKGHKILIFSQ 619

Query: 735 MVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGIN 794
            V +LD+L D+  +   N  R+DG V +  R+  ID FN  G D  +FLLSTRA GLGIN
Sbjct: 620 FVGMLDLLEDWSELNSFNSLRIDGGVDNESRKEYIDEFNKKGDDHQIFLLSTRAAGLGIN 679

Query: 795 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 854
           L+ ADTVIIFDSDWNPQ DLQAM R HRIGQ   V+VYR    +T+E  +L RA  K  L
Sbjct: 680 LVAADTVIIFDSDWNPQVDLQAMDRCHRIGQTKPVIVYRFCCDNTIEHVILTRAVNKRKL 739

Query: 855 EYAIISLG 862
           E  +I +G
Sbjct: 740 ERMVIQMG 747

>Kwal_47.18077
          Length = 809

 Score =  323 bits (828), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 206/550 (37%), Positives = 286/550 (52%), Gaps = 76/550 (13%)

Query: 379 LSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARR 438
           L  QP  +K  +L+ +QL G+NW+  L+    NGILADEMGLGKT+Q++A +++ I    
Sbjct: 168 LHQQPSLLKNCQLKPYQLEGVNWLITLYENGLNGILADEMGLGKTLQSIALLAF-ITEMD 226

Query: 439 QNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQ-KSRDIEREYEFYSNPKGKGKKQ 497
             GP L+  PLST+  W+  F ++APDI V+ Y   Q +S       +F+ + KG+G   
Sbjct: 227 TGGPFLIAAPLSTLDTWVNEFSRFAPDIQVLKYYSTQGQSYRQSLLKKFFKSTKGQG--- 283

Query: 498 IKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITG 557
               V++T+YE I++D   + S +W+FL VDE HR+KN    L   L      NRLLITG
Sbjct: 284 ----VVITSYEIIIRDIELILSYQWKFLIVDEGHRIKNINCKLIRELKRINTLNRLLITG 339

Query: 558 TPLQNNIKELAALVNFLMPGRFTIDQEI-----DFEN--------------QDEEQEQYI 598
           T LQNN+ EL +L+NF+MP  F  D EI     DF +               DE ++  I
Sbjct: 340 TALQNNLSELWSLLNFIMPDIFA-DFEIFHKWFDFSDLELKSSSQGLNRLINDELEKNLI 398

Query: 599 RDLHKRLQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTEYYKNILT----------- 646
            +LH  L+PF+LRRLKK V   SLP K E I+   L+ VQ + YK+ L            
Sbjct: 399 SNLHAILKPFLLRRLKKVVLAGSLPPKREYIVNCPLTSVQKKLYKSALNGKLKQAIFKQA 458

Query: 647 -KNYSALTAGAKGGRFS---------------------MLNIMNTLMKASNHPYLFDS-- 682
            K++  L +   G   +                     +L  M+ L K   H  L +   
Sbjct: 459 IKDFFVLNSDQIGQVSNKSIRDFMEWKLNANDEDPDTEILQQMDKLYKQHIHRALLNKRL 518

Query: 683 ----------AEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIF 732
                      +  +L  F   N  +   L  L+ SSG               GH+VLIF
Sbjct: 519 QNPMVQLRQVVDSTLLFFFPFINPEKLT-LDFLLQSSGKLQILQQLVPPLIKKGHKVLIF 577

Query: 733 SQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLG 792
           +Q V +LD++ D+  +  +   R+DG++ +  R+  I+ FN P      FL+STRAGGLG
Sbjct: 578 TQFVGMLDLIEDWCELNDVRVCRIDGSMGNETRQEHIERFNDPDDSFDAFLISTRAGGLG 637

Query: 793 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 852
           INL  AD+VI+FDSDWNPQ DLQA  R HRIGQ   V+VYRL   +T+E  +L RA  K 
Sbjct: 638 INLTAADSVILFDSDWNPQVDLQATDRTHRIGQTKPVIVYRLCCDNTIEHVILTRAASKR 697

Query: 853 ILEYAIISLG 862
            LE  +I LG
Sbjct: 698 KLEKMVIQLG 707

>Scas_520.5
          Length = 863

 Score =  319 bits (817), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 196/551 (35%), Positives = 290/551 (52%), Gaps = 79/551 (14%)

Query: 382 QPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG 441
           QP  +K   L+ +QL G+NW+  L+    NGILAD+MGLGKT+Q++A +++ I+     G
Sbjct: 262 QPSMLKNCVLKPYQLEGLNWLITLYENGLNGILADDMGLGKTIQSIALLAF-IYEMDTKG 320

Query: 442 PHLVVVPLSTMPAWIETFEKWAPDIDVICYM--GNQKSRDIEREYEFYSNPKGKGKKQIK 499
           P L+  PLST+  W+  FEK+APD+ V+ Y   G +  R+ +    F+    G G     
Sbjct: 321 PFLIAAPLSTVDNWMNEFEKFAPDLPVLKYYHPGGKNERN-KLMRNFFKKTNGTG----- 374

Query: 500 FNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTP 559
             +++T+YE I++D   + S +W+FL VDE HRLKN    L + L     +NRLL+TGTP
Sbjct: 375 --IVVTSYEIIIRDADYIMSKQWKFLIVDEGHRLKNVNCRLIQELKRINTSNRLLLTGTP 432

Query: 560 LQNNIKELAALVNFLMPGRFT----IDQEIDFEN--------------QDEEQEQYIRDL 601
           LQNN+ EL +L+NF+MP  FT     ++  DF++               +E Q+  I +L
Sbjct: 433 LQNNLAELWSLLNFIMPDIFTDFEIFNKWFDFKDLEMESNSSKLNKVINEELQKNLISNL 492

Query: 602 HKRLQPFILRRLKKDVEKS-LPSKTERILRVELSDVQT-----------------EYYKN 643
           H  L+PF+LRRLKK V  + LP K E ++   L+ +Q                  EY K 
Sbjct: 493 HTILKPFLLRRLKKTVLANILPPKREYVVNCPLTPIQKKFYKRGLEGKLKKTIFKEYVKA 552

Query: 644 ILTKNYSALTAGA------------------KGGRFSM---LNIMNTLMKASNHPYLFDS 682
             T N   + + +                    G+  +   L  M+TL     H  + + 
Sbjct: 553 FFTLNSDYIGSVSNKSIREFIDYKLHEGETDSDGQIQLNDTLQKMDTLFMEYIHKEIANK 612

Query: 683 AEEKVLEK----------FGAGNMSRENI-LRGLIMSSGXXXXXXXXXXXXXXDGHRVLI 731
             + ++ +          F    +  E++ L+ L+ SSG               GH++LI
Sbjct: 613 RLQNMMMQLRQIVDSTLIFYFPYLRPEDLTLQELLESSGKLKTLQRLVIPLIAKGHKILI 672

Query: 732 FSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGL 791
           FSQ V +LD+L D+  +  +   R+DGT+ +  R+  +  FN   +   VFLLSTRA GL
Sbjct: 673 FSQFVNMLDLLEDWCDLNSLAAFRIDGTIDNESRKEQLSKFNDKKNKHMVFLLSTRAAGL 732

Query: 792 GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKK 851
           G+NL+ ADTV++FDSDWNPQ DLQAM R HRIGQ   V+VYR    +T+E  +L RA  K
Sbjct: 733 GVNLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQTKPVIVYRFCCDNTLEHVILTRAANK 792

Query: 852 MILEYAIISLG 862
             LE  +I +G
Sbjct: 793 RKLERLVIQMG 803

>ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH]
           (508448..510862) [2415 bp, 804 aa]
          Length = 804

 Score =  317 bits (811), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 200/547 (36%), Positives = 288/547 (52%), Gaps = 77/547 (14%)

Query: 382 QPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG 441
           QP  ++   L+ +Q+ G+NW+  L+    NGILADEMGLGKT+Q++A +++ I+     G
Sbjct: 178 QPTLVRNCTLKPYQVEGVNWLITLYENGLNGILADEMGLGKTIQSIALLAF-IYEMDTRG 236

Query: 442 PHLVVVPLSTMPAWIETFEKWAPDIDVICYM---GNQKSRDIEREYEFYSNPKGKGKKQI 498
           P LV  PLS +  WI  FEK+AP I V+ Y    G  K   I +E  F+    G+G    
Sbjct: 237 PFLVTAPLSVVDNWITEFEKFAPSIPVLKYYSADGPGKRHAILKE--FFRKNSGEG---- 290

Query: 499 KFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGT 558
              V++T+YE +++D   + S +W+FL VDE HRLKN    L   L      NRLL+TGT
Sbjct: 291 ---VVVTSYEIVMRDMNVILSHQWKFLIVDEGHRLKNINCKLIRELKRINTFNRLLLTGT 347

Query: 559 PLQNNIKELAALVNFLMPGRFTIDQEI-----DFENQD--------------EEQEQYIR 599
           PLQNN+ EL +L+NF++P  F  D EI     DF + D              E ++  + 
Sbjct: 348 PLQNNLAELWSLLNFILPDVFA-DFEIFSKWFDFSDLDLKTSSQRWDKIIGEELEKNLVT 406

Query: 600 DLHKRLQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKG 658
           +LH  L+PF+LRRLK+ V   +LP K E I+   L+ +QT +YK  L             
Sbjct: 407 NLHTILKPFLLRRLKRVVLADALPPKREYIINCPLTPLQTRFYKMALAGKLKRTVFTQAI 466

Query: 659 GRFSMLN---IMNTLMKASNHPYLFDSAEEKV--------LEKFGAGNMSRE-------N 700
             F  LN   I +   K       + +++E++        +EK    ++ +E       N
Sbjct: 467 KEFFTLNREHIGSVSNKTIREFIDYKTSDEEIQASKVITDMEKLYEQHIHKELRNKRLQN 526

Query: 701 ILRGL-------------------------IMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 735
           ++  L                         + +SG                H+VLIFSQ 
Sbjct: 527 LMMQLRQIVDSTFLFYFPYLKAEDLQLPVLLQTSGKLQILQQLLPRLLAAKHKVLIFSQF 586

Query: 736 VRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINL 795
           V +LD++ D+  +   +  R+DG++ +  RR  I+ F+  GS   +FLLSTRAGGLGINL
Sbjct: 587 VSMLDLIEDWCELNNYSACRIDGSMDNETRREQINSFSEKGSPHSLFLLSTRAGGLGINL 646

Query: 796 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 855
             AD+VI+FD+DWNPQ DLQAM R+HRIGQ++ V+VYRL    TVE  +L RA  K  LE
Sbjct: 647 TAADSVILFDNDWNPQVDLQAMDRSHRIGQQHPVIVYRLYCDKTVESVILARATNKRKLE 706

Query: 856 YAIISLG 862
             +I +G
Sbjct: 707 QLVIQMG 713

>KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, start by similarity
          Length = 1048

 Score =  270 bits (689), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 189/536 (35%), Positives = 267/536 (49%), Gaps = 83/536 (15%)

Query: 390  ELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPL 449
            EL+D+Q TGINW+  L+  + + ILADEMGLGKT Q ++F+++L      NGPHLVVVP 
Sbjct: 501  ELKDYQQTGINWLHLLYQNDLSCILADEMGLGKTCQVISFLAYLK-QTHHNGPHLVVVPS 559

Query: 450  STMPAWIETFEKWAPDIDVICYMGNQKSR----DIEREYEFYSNPKGKGKKQIKFNVLMT 505
            ST+  W+  F K+ P + V  Y G+Q+ R    DI  E E             +++V++T
Sbjct: 560  STLENWLREFNKFCPHLKVEPYYGSQQERAELRDILEENEG------------QYDVIVT 607

Query: 506  TYEYILKDRAELGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 562
            TY      + ++  ++   +  +  DE H LKN+ S  +  L       RLL+TGTPLQN
Sbjct: 608  TYNLAAGTKYDVSFLRNRNFDVVVYDEGHMLKNSMSERFNKLMKINAHFRLLLTGTPLQN 667

Query: 563  NIKELAALVNFLMPGRF---------TIDQEIDFENQDEE-----QEQYIRDLHKRLQPF 608
            N+KEL +L+ F+MP  F            Q+    + D+       E  I      ++PF
Sbjct: 668  NLKELMSLLEFIMPNLFVSKKDDLATVFKQKTRTSDADKGYNPLLAEHAIERAKTMMKPF 727

Query: 609  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGA---KGGRFS 662
            ILRR K  V K LP K   IL  E++++Q   Y+  + +   +   +  G    K  R  
Sbjct: 728  ILRRKKDQVLKHLPRKHNHILHCEMTELQKTLYQQEIKQVMEHRRKIKEGVKMEKASRNV 787

Query: 663  MLNIMNTLMKASNHPYLFDSA-EEKVLEKFGA-----------GNMS--RENI------- 701
              N++  L KAS HP LF     +K++ K              GN+   +E++       
Sbjct: 788  SKNLIMALRKASIHPLLFRHIYNDKIISKMSKAIIAEPEYYENGNIEYIKEDMSYMTDFE 847

Query: 702  LRGLI----------------MSSGXXXXXXXXXXXXXXDGH-RVLIFSQMVRILDILGD 744
            L  L                 M+SG                H +VL+FS   ++LDIL  
Sbjct: 848  LHKLCCKFPSLYKFKLQSDEWMNSGKVEQLKSVLHKIIDIQHEKVLVFSLFTQVLDILEF 907

Query: 745  YLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDF--VFLLSTRAGGLGINLMTADTVI 802
             LS   I F RLDG    N R+  ID F     DD   VFLLST+AGG GINL+ A+ VI
Sbjct: 908  VLSTLNIKFLRLDGQTQVNDRQSLIDRF---YEDDTIPVFLLSTKAGGFGINLVCANNVI 964

Query: 803  IFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 858
            IFD  +NP  D QA  RAHR+GQ   V V  L+S+DT+EE++L  A+ K+ L+  I
Sbjct: 965  IFDQSFNPHDDRQAADRAHRVGQTKEVQVTTLISRDTIEEKILHLAKNKLALDTHI 1020

>ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH]
           (877337..880396) [3060 bp, 1019 aa]
          Length = 1019

 Score =  265 bits (678), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 189/543 (34%), Positives = 273/543 (50%), Gaps = 92/543 (16%)

Query: 390 ELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQN--GPHLVVV 447
           EL+D+Q TG+NW+  L+  N + ILADEMGLGKT Q ++F+++L   + QN  GPHLVVV
Sbjct: 470 ELKDYQQTGLNWINLLYQHNLSCILADEMGLGKTCQVISFLAYL---KEQNHTGPHLVVV 526

Query: 448 PLSTMPAWIETFEKWAPDIDVICYMGNQKS----RDIEREYEFYSNPKGKGKKQIKFNVL 503
           P ST+  W+  F+K+ P + +  Y G+Q+     RDI  E +             +++ +
Sbjct: 527 PSSTLENWLREFKKFCPQLKIEPYYGSQQERAELRDILEENDG------------QYDAI 574

Query: 504 MTTYEYILKDRAELGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPL 560
           +TTY     ++A++  +K   +  +  DE H LKN+ S  +  L       RLL+TGTPL
Sbjct: 575 VTTYNLASGNKADVSFLKNRQFNVVIYDEGHMLKNSMSERFTKLMKIHANFRLLLTGTPL 634

Query: 561 QNNIKELAALVNFLMPGRF----------------TIDQEIDFENQDEEQEQYIRDLHKR 604
           QNN++EL +L+ F+MP  F                T D   D+ N    QE   R     
Sbjct: 635 QNNLRELMSLLEFIMPSLFVSKKDELAAVFKQRARTSDSNKDY-NPLLAQEAIDR-AKTI 692

Query: 605 LQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY----------KNILTKNYSALTA 654
           ++PFILRR K  V K LP+K   I   +++  Q   Y          + ++        A
Sbjct: 693 MKPFILRRRKDQVLKHLPAKHHHIEYCDMTPEQQAIYNREIRLVMEHRRMVRDGVLPTDA 752

Query: 655 GAKG--GRFSMLNIMNTLMKASNHPYLF---------DSAEEKVL---EKFGAGNMS--R 698
           G +    + +  N++  L KA+ HP LF             E++L   E   +GN    R
Sbjct: 753 GERALVAQSTSKNLIMALRKAAIHPLLFRHHYSDDRIAEMSERILAEPEYADSGNRDYIR 812

Query: 699 ENI-------LRGLI----------------MSSGXXXXXXXXXXXXXXDGHRVLIFSQM 735
           E++       L  L                 M+SG                 + L+FS  
Sbjct: 813 EDMSYMCDLELHRLCCRFPSLASFQLSEPTWMASGKVHRLQPLLRAAIARREKTLVFSLF 872

Query: 736 VRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINL 795
            ++LDIL   LS  GI F RLDG+ P N R+  ID F+   +D  VFLLST+AGG GINL
Sbjct: 873 TQVLDILELVLSSLGIAFLRLDGSTPVNDRQALIDRFHT-DTDVPVFLLSTKAGGFGINL 931

Query: 796 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 855
           + A+ VIIFD  +NP  D QA  RAHR+GQ   V V  LVS+ TVEE++L+ AR K+ L+
Sbjct: 932 VCANHVIIFDQSFNPHDDRQAADRAHRVGQTREVAVTTLVSRATVEEKILQLARHKLALD 991

Query: 856 YAI 858
            ++
Sbjct: 992 SSV 994

>CAGL0I01694g complement(141422..144637) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1071

 Score =  258 bits (660), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 168/526 (31%), Positives = 256/526 (48%), Gaps = 76/526 (14%)

Query: 391 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPLS 450
           L ++Q TG+ W+  L+ +   GI+ DEMGLGKT+Q  AF++ L  +   +GP L+V P +
Sbjct: 297 LFNYQKTGVQWLYELFQQRRGGIIGDEMGLGKTIQVTAFLAALHHSNLLSGPVLIVCPAT 356

Query: 451 TMPAWIETFEKWAPDIDVICYMG-----NQKSRDIERE-----------------YEFYS 488
            M  W     +W P    +         N KS   E E                 YE  S
Sbjct: 357 VMKQWCNEIHQWWPPFRAVILHSIGAGMNDKSNLTEDEIENMIIKSELENTDFHDYENAS 416

Query: 489 NPKGKGKKQIKF-----------NVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAE 537
             K K +  +             ++++TTY  +     +L ++ W +  +DE H+++N +
Sbjct: 417 KLKSKVETGMHMQNLISKVVADGHIIITTYVGLRIHSDKLLNVNWSYCVLDEGHKIRNPD 476

Query: 538 SSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRF----TIDQEI-------D 586
           S +  +    K  NR++++GTP+QNN+ EL +L +F+ PGR        Q+         
Sbjct: 477 SEISLTCKKLKCKNRIILSGTPIQNNLVELWSLFDFIYPGRLGTLPVFQQQFVQPINMGG 536

Query: 587 FENQDEEQEQY-------IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTE 639
           + N    Q Q        +RDL   + P++LRR+K DV K LP K E +L  +L++ Q  
Sbjct: 537 YANATNTQVQTGYRCAVALRDL---ISPYLLRRVKADVAKDLPKKKEMVLFCKLTEFQRR 593

Query: 640 YYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRE 699
            Y   L+   S   +  KGG+  +L  ++ L K  NHP L D   + +    G G+  R 
Sbjct: 594 KYLEFLS---SDELSQIKGGKRHVLYGIDILRKICNHPDLLD--RDYIKNTSGYGDPKR- 647

Query: 700 NILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIK-----GINFQ 754
                    SG              +GH+ L+F+Q  ++LDIL +++  K      I + 
Sbjct: 648 ---------SGKMQVVKQLLKLWKSEGHKTLLFTQSRQMLDILEEFIKFKEPELSDIRYL 698

Query: 755 RLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADL 814
           R+DGT     R+  +D FN    D  VFLL+TR GGLG+NL  A+ +II+D DWNP  DL
Sbjct: 699 RMDGTTSIQVRQTLVDRFNNESYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDL 756

Query: 815 QAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 860
           QA  RA RIGQK  V +YRL+   T+EE++  R   K  L   ++S
Sbjct: 757 QARERAWRIGQKREVSIYRLMISGTIEEKIYHRQIFKQFLMNKVLS 802

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1033

 Score =  256 bits (654), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 170/548 (31%), Positives = 265/548 (48%), Gaps = 80/548 (14%)

Query: 374 PRFEKLSVQPPFIKGGE----LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAF 429
           P+    ++   F+  G+    L  +Q T + W+  L+ +   GI+ DEMGLGKT+Q +AF
Sbjct: 244 PKISDANISEDFMVPGDIFPLLFPYQKTCVQWLCELYQQGCGGIIGDEMGLGKTIQIIAF 303

Query: 430 ISWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMG-----NQKSRDIEREY 484
           ++ L  +R+ NGP LVV P + M  W   F  W P    +         N+ ++  E E 
Sbjct: 304 LATLHHSRKLNGPVLVVCPATVMKQWCNEFHTWWPPFRAVILHSIGAGMNKGTQIPEEEL 363

Query: 485 E-----------FYSNPKGKGKKQIKF-----------------NVLMTTYEYILKDRAE 516
           E            Y++ + K K +                    ++++TTY  +      
Sbjct: 364 EKMLMTSNYGTFTYNDYEKKEKTRTSLESRKSVKKLLEKVITDGHIIITTYVGLRLHSEA 423

Query: 517 LGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMP 576
           L +++W +  +DE H+++N +S +  +    K  NR++++GTP+QNN+ EL +L +F+ P
Sbjct: 424 LLNVRWGYAILDEGHKIRNPDSDISLTCKQLKTQNRIILSGTPIQNNLTELWSLFDFVYP 483

Query: 577 GRF----TIDQEI-------DFENQDEEQEQY-------IRDLHKRLQPFILRRLKKDVE 618
           G+        Q+         + N    Q +        +RDL   + P++LRR+K DV 
Sbjct: 484 GKLGTLPVFQQQFANPINMGGYANASNIQVKTGYKCAVALRDL---ISPYLLRRVKSDVA 540

Query: 619 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPY 678
           K LP K E +L  +L+  Q   Y   L   +S      + G+  +L  ++ L K  NHP 
Sbjct: 541 KDLPKKNEMVLFCKLTQYQKSKYLEFL---HSDELMKIRKGKRQVLYGIDILRKICNHPD 597

Query: 679 LFDSAEEKV--LEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMV 736
           L D   +K+   E    GN +R          SG               GH+ L+F+Q  
Sbjct: 598 LLDLKRKKMNDYEDADYGNPAR----------SGKMQVVKQLLLLWHSQGHKTLLFTQSR 647

Query: 737 RILDILGDYLSIKG-----INFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGL 791
           ++LDIL +++S K      + F R+DGT     R+  +D FN    D  VFLL+TR GGL
Sbjct: 648 QMLDILQEFISYKDPELSDLKFLRMDGTTNIGSRQSLVDKFNNEPYD--VFLLTTRVGGL 705

Query: 792 GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKK 851
           GINL  A+ +IIFD DWNP  D+QA  RA RIGQK  V +YRL+   ++EE++  R   K
Sbjct: 706 GINLTGANRIIIFDPDWNPSTDMQARERAWRIGQKREVTIYRLMIAGSIEEKIYHRQIFK 765

Query: 852 MILEYAII 859
             L   I+
Sbjct: 766 QFLSNKIL 773

>YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase
           involved in transcription-coupled repair in some strain
           backgrounds, may have a role in chromatin remodeling,
           homolog of Cockayne syndrome B gene ERCC-6 [3258 bp,
           1085 aa]
          Length = 1085

 Score =  255 bits (652), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 172/529 (32%), Positives = 264/529 (49%), Gaps = 80/529 (15%)

Query: 391 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPLS 450
           L ++Q T + W+  L+ +N  GI+ DEMGLGKT+Q +AFI+ L  +    GP L+V P +
Sbjct: 297 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAALHHSGLLTGPVLIVCPAT 356

Query: 451 TMPAWIETFEKWAPDIDVICY--MG-----NQKSR----DIER----------EYEFYSN 489
            M  W   F+ W P +  +    MG     +QK +    D+E            YE + N
Sbjct: 357 VMKQWCNEFQHWWPPLRTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKN 416

Query: 490 PKGKGKKQIKFN---------------VLMTTYEYILKDRAELGSIKWQFLAVDEAHRLK 534
              + KK ++ +               +L+TTY  +     +L  +KWQ+  +DE H+++
Sbjct: 417 ST-RTKKALESSYHLDKLIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIR 475

Query: 535 NAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGR----------FTIDQE 584
           N +S +  +    K  NR++++GTP+QNN+ EL +L +F+ PG+          F I   
Sbjct: 476 NPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPIN 535

Query: 585 ID-FENQDEEQEQY-------IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDV 636
           I  + N    Q Q        +RDL   + P++LRR+K DV K LP K E +L  +L+  
Sbjct: 536 IGGYANATNIQVQTGYKCAVALRDL---ISPYLLRRVKADVAKDLPQKKEMVLFCKLTKY 592

Query: 637 QTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNM 696
           Q   Y   L   +S+     + G+ ++L  ++ L K  NHP L D             + 
Sbjct: 593 QRSKYLEFL---HSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDR------------DT 637

Query: 697 SRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKG-----I 751
            R N   G    SG               G++ L+F+Q  ++LDIL +++S K      +
Sbjct: 638 KRHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHL 697

Query: 752 NFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQ 811
           N+ R+DGT     R+  +D FN    D  VFLL+TR GGLG+NL  A+ +IIFD DWNP 
Sbjct: 698 NYLRMDGTTNIKGRQSLVDRFNNESFD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPS 755

Query: 812 ADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 860
            D+QA  RA RIGQK  V +YRL+   ++EE++  R   K  L   I++
Sbjct: 756 TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILT 804

>CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1, start by similarity
          Length = 1904

 Score =  258 bits (658), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 176/533 (33%), Positives = 267/533 (50%), Gaps = 72/533 (13%)

Query: 384  PFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG-- 441
            P      LR +Q  GINW+AFL   + +GIL D+MGLGKT+QT+  I+   + R++    
Sbjct: 1306 PVAIKATLRKYQQDGINWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRQEEYKL 1365

Query: 442  ---------PHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKG 492
                     P L+V P S    W   FE+++P + ++ Y G    R   R          
Sbjct: 1366 SGNIECRPLPSLIVCPPSLTGHWENEFEQYSPFLKIVVYAGGPSVRQPLR---------- 1415

Query: 493  KGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANR 552
              K+    ++++T+Y+    D   + S  + +  +DE H +KNA+S L +++   K  +R
Sbjct: 1416 --KQLSSADIIITSYDVARNDLDTISSYDYNYCVLDEGHLIKNAQSKLAKAVKLIKANHR 1473

Query: 553  LLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEEQEQ---Y 597
            L++TGTP+QNN+ EL +L +FLMPG          RF   I    + +   +EQE     
Sbjct: 1474 LILTGTPIQNNVVELWSLFDFLMPGFLGTEKSFQERFAKPIAASRNSKTSSKEQEAGALA 1533

Query: 598  IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY-------KNILTKNY- 649
            +  LHK++ PF+LRRLK+DV   LP K  +    ELSD+Q + Y       KN++ K+  
Sbjct: 1534 LEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYEDFAKKQKNVVEKDIQ 1593

Query: 650  SALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAE-------EKVLEKFGAG-----NMS 697
            +     +K   F  L  M    K  NHP L  S +       +  L++ G       N  
Sbjct: 1594 NTADVDSKQHIFQALQYMR---KLCNHPALVLSNDHPQLKQIQNYLKQTGCDLHDIRNAP 1650

Query: 698  RENILRGLIMSSG-------XXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYL---S 747
            +   LR L+   G                       HR LIF Q+  +LD++ + L    
Sbjct: 1651 KLTALRTLLFECGIGEADMDKKVTGEQLLTGSVISQHRALIFCQLKDMLDMIENDLFKRY 1710

Query: 748  IKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSD 807
            +  +++ RLDG+V    R+  +  FN   S D   LL+T+ GGLG+NL  ADTVI  + D
Sbjct: 1711 MPSVSYMRLDGSVDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHD 1769

Query: 808  WNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 860
            WNP  DLQAM RAHR+GQK  V VYR+V+K T+EE+++   + KM +   +++
Sbjct: 1770 WNPMNDLQAMDRAHRLGQKKVVNVYRIVTKGTLEEKIMGLQKFKMNIASTVVN 1822

>Scas_549.4
          Length = 1079

 Score =  254 bits (648), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 169/559 (30%), Positives = 264/559 (47%), Gaps = 77/559 (13%)

Query: 391 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPLS 450
           L ++Q T + W+  L+ +N  GI+ DEMGLGKT+Q +AF++ L  +   NGP L+V P +
Sbjct: 304 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIIAFLASLHHSGLLNGPVLIVCPAT 363

Query: 451 TMPAWIETFEKWAPDIDVICYMGNQKSRDIEREY--------------------EFYSNP 490
            M  W      W P +  I           ++ +                    +F +  
Sbjct: 364 VMKQWCNELHHWWPPLRTIILHSTGSGMSTKKNFSEEELEQAMMNANPNELTCEDFQNRS 423

Query: 491 KGKGKKQIKFNV-------------LMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAE 537
           K K   +  FN+             ++TTY  +     +L  + W +  +DE H+++N +
Sbjct: 424 KTKASLESTFNIQSLIDKVINDGHIIITTYVGLRIHSEQLLKVNWAYAVLDEGHKIRNPD 483

Query: 538 SSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRF----TIDQEI-------D 586
           S +  +    K  NR++++GTP+QNN+ EL +L +F+ PG+        Q+         
Sbjct: 484 SDISLTCKKIKTPNRIILSGTPIQNNLIELWSLFDFIYPGKLGTLPVFQQQFVMPINAGG 543

Query: 587 FENQDEEQEQ----YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYK 642
           + N    Q Q        L   + P++LRR+K DV K LP K E +L  +L+  Q   Y 
Sbjct: 544 YANATNIQVQTGVKCATALRNLISPYLLRRVKSDVAKDLPEKKEMVLFCKLTQYQKNRYL 603

Query: 643 NILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENIL 702
             L  N   LT   +GGR  +L  ++ L K  NHP L +  E +    +G  N  R    
Sbjct: 604 EFLNSN--ELTQ-IRGGRRHVLYGIDILRKICNHPDLLEREERQYETDYG--NPKR---- 654

Query: 703 RGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKG-----INFQRLD 757
                 SG              +GH+ L+F+Q  ++LDIL  ++  K      + + R+D
Sbjct: 655 ------SGKMQVVKQLLLLWHKEGHKTLLFTQSRQMLDILEQFIQFKDSDLSVLKYLRMD 708

Query: 758 GTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAM 817
           GT   ++R+  +D FN    D  VFLL+TR GGLG+NL  A+ +II+D DWNP  D+QA 
Sbjct: 709 GTSNISKRQGLVDQFNNEDYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDMQAR 766

Query: 818 ARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKTEPSA 877
            RA RIGQK  V +YRL+   ++EE++  R   K  L   I+    TD     +K     
Sbjct: 767 ERAWRIGQKREVSIYRLMVSGSIEEKIYHRQIFKQFLTNKIL----TDPK---QKRFFKM 819

Query: 878 GELSEILKFGAGNMFAAKD 896
            EL ++   G  N  A+++
Sbjct: 820 NELRDLFTLGGDNGLASEE 838

>Sklu_2125.3 YJR035W, Contig c2125 6474-9632
          Length = 1052

 Score =  253 bits (646), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 169/525 (32%), Positives = 250/525 (47%), Gaps = 76/525 (14%)

Query: 391 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPLS 450
           L ++Q T + W+  L+ +N  GI+ DEMGLGKT+Q ++F++ L  +   +GP L+V P +
Sbjct: 285 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIISFLASLHHSGMLDGPILIVCPAT 344

Query: 451 TMPAWIETFEKWAPDIDVICY------MGNQK--SRDIEREYEFYSNP------------ 490
            M  W   F  W P    +        M N++  S D   E    SNP            
Sbjct: 345 VMKQWCNEFHTWWPPFRAVILHSIGSGMSNKEKLSEDRLEEMLMNSNPEEFSYVDYTDSK 404

Query: 491 KGKGKKQIKFN-------------VLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAE 537
           K K   + K N             VL+TTY  +     EL  +KW +  +DE H+++N +
Sbjct: 405 KTKSTMESKLNLTKLVDKVVNDGHVLITTYVGLRLHADELLKVKWGYAVLDEGHKIRNPD 464

Query: 538 SSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRF----TIDQEI-------D 586
           S +  +    K +NR++++GTP+QNN+ EL +L +F+ PGR        Q+         
Sbjct: 465 SDISLTCKQLKTSNRVILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQQQFAIPINMGG 524

Query: 587 FENQDEEQEQY-------IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTE 639
           + N    Q Q        +RDL   + P++LRR+K DV K LP K E +L  +L+  Q  
Sbjct: 525 YANATNIQVQTGYKCAVALRDL---ISPYLLRRVKTDVAKDLPKKNEMVLFCKLTQYQRN 581

Query: 640 YYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRE 699
            Y   L    S      K G+  +L  ++ L K  NHP +         E +G       
Sbjct: 582 KYLQFLN---SGDLVKIKNGKRQVLYGIDILRKICNHPDILVRDMRHSEESYGDPK---- 634

Query: 700 NILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLS-----IKGINFQ 754
                    SG               GH+ L+F+Q  ++LDIL  ++S     +  + + 
Sbjct: 635 --------RSGKMQVVKQLLKLWKEQGHKTLLFTQSRQMLDILEKFISYRDPELSSLTYL 686

Query: 755 RLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADL 814
           R+DGT     R+  +D FN    D  VFLL+TR GGLG+NL  A+ +IIFD DWNP  DL
Sbjct: 687 RMDGTTNIAARQHLVDKFNNELYD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDL 744

Query: 815 QAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 859
           QA  RA RIGQK  V +YRL+   ++EE++  R   K  L   I+
Sbjct: 745 QARERAWRIGQKREVTIYRLMIAGSIEEKIYHRQIFKQFLTNKIL 789

>AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..161709)
            [5601 bp, 1866 aa]
          Length = 1866

 Score =  256 bits (653), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 176/532 (33%), Positives = 272/532 (51%), Gaps = 71/532 (13%)

Query: 384  PFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG-- 441
            P      LR +Q  GINW+AFL   + +GIL D+MGLGKT+QT+  I+   + R+++   
Sbjct: 1272 PVAIKATLRKYQQEGINWLAFLNHYHLHGILCDDMGLGKTLQTICIIASDQYLRQEDYKT 1331

Query: 442  ---------PHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKG 492
                     P L+V P S    W + FE++AP + V+ Y G   +R     Y      +G
Sbjct: 1332 TKSVETRPLPSLIVCPPSLTGHWEQEFEQYAPFLTVLVYAGGPSTR-----YPL----RG 1382

Query: 493  KGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANR 552
            K       ++++T+Y+    D   +    + +  +DE H +KN++S L +++ S +  +R
Sbjct: 1383 KLGDA---DIVVTSYDVARNDIDIISKHDYNYCVLDEGHIIKNSQSKLAKAVKSIRANHR 1439

Query: 553  LLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEEQEQ---Y 597
            L++TGTP+QNN+ EL +L +FLMPG          RF   I    + +   +EQE     
Sbjct: 1440 LILTGTPIQNNVVELWSLFDFLMPGFLGSEKAFQERFAKPIAASRNSKTSSKEQEAGALA 1499

Query: 598  IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYK-------NILTKNY- 649
            +  LHK++ PF+LRRLK+DV   LP K  +    ELSD+Q + YK       NI+ ++  
Sbjct: 1500 LEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQRQLYKDFAKKQKNIVERDIE 1559

Query: 650  SALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEE----KVLEKFGAGNMSRENI---- 701
            + +   +K   F  L  M    K  NHP L  S +     +V +      M   +I    
Sbjct: 1560 NTMELESKNHIFQALQYMR---KLCNHPSLVLSKDHPQYNQVQDYLSQTGMDIHDIAHAP 1616

Query: 702  ----LRGLIMSSGXXXXXXXXXXXXXXDG------HRVLIFSQMVRILDILGDYL---SI 748
                LR L++  G                      HR LIF Q+  +LD++ + L    +
Sbjct: 1617 KLGALRNLLLECGIGVQDVDQNSISLPSSENVISQHRALIFCQLKDMLDMIENDLFKKYL 1676

Query: 749  KGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDW 808
              + + RLDG+V S  R+  +  FN   S D   LL+T+ GGLG+NL  ADTVI  + DW
Sbjct: 1677 PSVTYMRLDGSVESRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFIEHDW 1735

Query: 809  NPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 860
            NP  DLQAM RAHR+GQK  V VYR+++K ++EE+++   + KM +   +++
Sbjct: 1736 NPMNDLQAMDRAHRLGQKKVVNVYRIITKGSLEEKIMGLQKFKMNIASTVVN 1787

>YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p family
            of DNA-dependent ATPases, involved in resistance to UV
            radiation [3396 bp, 1131 aa]
          Length = 1131

 Score =  253 bits (645), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 189/574 (32%), Positives = 284/574 (49%), Gaps = 83/574 (14%)

Query: 355  SRQNSKILPQYSSNYTSERPRFEKLSVQPPFIKGG-ELRDFQLTGINWMAFLWSKNDNGI 413
            +R+N+ ++   S N    +P  +    +P  +     L+D+Q TGINW+  L+    + I
Sbjct: 537  TRKNTHVISTTSRN--GRKPIVKFFKGKPRLLSPEISLKDYQQTGINWLNLLYQNKMSCI 594

Query: 414  LADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMG 473
            LAD+MGLGKT Q ++F ++L     + GPHLVVVP ST+  W+  F+K+AP + +  Y G
Sbjct: 595  LADDMGLGKTCQVISFFAYLK-QINEPGPHLVVVPSSTLENWLREFQKFAPALKIEPYYG 653

Query: 474  NQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSIK---WQFLAVDEA 530
            + + R+  R+       +  GK    ++V++TTY     ++ ++  +K   +  +  DE 
Sbjct: 654  SLQEREELRDIL----ERNAGK----YDVIVTTYNLAAGNKYDVSFLKNRNFNVVVYDEG 705

Query: 531  HRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI----- 585
            H LKN+ S  +  L   +   RLL+TGTPLQNN+KEL +L+ F+MP  F   +E      
Sbjct: 706  HMLKNSTSERFAKLMKIRANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKESFDAIF 765

Query: 586  --------DFENQDE--EQEQYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSD 635
                    D +N +    QE   R     ++PFILRR K  V K LP K   I   EL+ 
Sbjct: 766  KQRAKTTDDNKNHNPLLAQEAITR-AKTMMKPFILRRRKDQVLKHLPPKHTHIQYCELNA 824

Query: 636  VQTEYYK---NILTKNYSALTAG---------AKGGRFSMLNIMNTLMKASNHPYLFDSA 683
            +Q + Y     I+ ++   +  G         +K    S  N++  L KAS HP LF + 
Sbjct: 825  IQKKIYDKEIQIVLEHKRMIKDGELPKDAKEKSKLQSSSSKNLIMALRKASLHPLLFRNI 884

Query: 684  -EEKVLEKFG---------AGNMSRENI-----------LRGLI---------------- 706
              +K++ K           A N ++E I           L  L                 
Sbjct: 885  YNDKIITKMSDAILDEPAYAENGNKEYIKEDMSYMTDFELHKLCCNFPNTLSKYQLHNDE 944

Query: 707  -MSSGXXXXXXXXXXXXXXDGH-RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQ 764
             M SG              D   +VLIFS   ++LDIL   LS     F RLDG+   N 
Sbjct: 945  WMQSGKIDALKKLLKTIIVDKQEKVLIFSLFTQVLDILEMVLSTLDYKFLRLDGSTQVND 1004

Query: 765  RRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIG 824
            R++ ID F     D  +F+LST+AGG GINL+ A+ VIIFD  +NP  D QA  RAHR+G
Sbjct: 1005 RQLLIDKF-YEDKDIPIFILSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVG 1063

Query: 825  QKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 858
            Q   V +  L++KD++EE++ + A+ K+ L+  I
Sbjct: 1064 QTKEVNITTLITKDSIEEKIHQLAKNKLALDSYI 1097

>AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH]
           (511520..514597) [3078 bp, 1025 aa]
          Length = 1025

 Score =  250 bits (638), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 174/569 (30%), Positives = 275/569 (48%), Gaps = 96/569 (16%)

Query: 390 ELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPL 449
           +L  +Q T + W+  L  +N  GI+ DEMGLGKT+Q V+F++ L  + +  GP LVV P 
Sbjct: 262 KLFSYQKTCVQWLYELHQQNCGGIVGDEMGLGKTIQIVSFLASLHHSGKLKGPVLVVCPA 321

Query: 450 STMPAWIETFEKWAPDIDVICY------------MGNQKSRDI-------EREYEFYSNP 490
           + M  W   F+ W P    +              M  ++  ++       E  YE Y+N 
Sbjct: 322 TVMKQWCSEFQTWWPPFRAVILHSIGAGMITRKKMTEEQLEELLMRDESNEFSYEQYAN- 380

Query: 491 KGKGKKQIKF---------------NVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKN 535
            G+ KKQ++                ++L+TTY  +      L  + W +  +DE H+++N
Sbjct: 381 LGRTKKQLEARRGIESLVQKVVDDGHILITTYLGLQIHSDLLLHVNWDYAVLDEGHKIRN 440

Query: 536 AESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRF----TIDQEI------ 585
            ++ +  +    +  +R++++GTP+QNN+ EL +L +F+ PG+        Q+       
Sbjct: 441 PDAGISLTCKRLRTPHRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFANPINA 500

Query: 586 -DFENQDEEQEQ-------YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQ 637
             + N    Q Q        +RDL   + P++LRR+K DV K LP K E +L  +++  Q
Sbjct: 501 GGYANATNIQVQTGYKCAVALRDL---ISPYLLRRVKNDVAKDLPKKNEFVLFCKMTQFQ 557

Query: 638 TEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFG----A 693
            E Y   L    S      K GR  +L  ++ L K  NHP L +    K    FG    +
Sbjct: 558 KEKYLQFLN---SEDMIKIKNGRRQVLYGIDILRKICNHPDLLERDFRKHEPSFGDPRRS 614

Query: 694 GNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLS-----I 748
           G M+   +++ L+++                 GH+ L+F+Q  ++LDIL  Y+S     +
Sbjct: 615 GKMT---VIKQLLLT-------------WKKQGHKALLFTQSRQMLDILEAYISHKDPEL 658

Query: 749 KGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDW 808
            G+ + R+DGT     R+  +D FN       +FLL+TR GGLG+NL  A+ +IIFD DW
Sbjct: 659 AGLQYLRMDGTTNIAHRQALVDRFN--NGPYHLFLLTTRVGGLGVNLTGANRIIIFDPDW 716

Query: 809 NPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNK 868
           NP  DLQA  RA RIGQK  V +Y L+   ++EE++  R   K  L   ++S        
Sbjct: 717 NPSTDLQARERAWRIGQKRDVTIYLLMVAGSIEEKIYHRQIFKQFLTNKVLS-------D 769

Query: 869 YTKKTEPSAGELSEILKFGAGNMFAAKDN 897
             +K      EL ++  FG G   AA D+
Sbjct: 770 PKQKRFFKMNELHDLFSFGPG---AASDS 795

>CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, hypothetical start
          Length = 1126

 Score =  250 bits (639), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 179/544 (32%), Positives = 268/544 (49%), Gaps = 90/544 (16%)

Query: 391  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG---PHLVVV 447
            L+D+Q TGINW+  L+    + ILAD+MGLGKT Q ++F+++L    +Q G   PHL+VV
Sbjct: 572  LKDYQQTGINWLNLLYHNQISCILADDMGLGKTCQVISFLAYL----KQIGQPSPHLIVV 627

Query: 448  PLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTY 507
            P ST+  W+  F+K+ P + +  Y G Q+ R   RE           +   K++V++TTY
Sbjct: 628  PSSTLENWLREFQKFCPSLKIEPYYGTQQERADLREI--------LERNDGKYDVIVTTY 679

Query: 508  EYILKDRAELGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNI 564
                 ++ ++  +K   +  +  DE H LKN+ S  +  L       RLL+TGTPLQNN+
Sbjct: 680  NLAAGNKYDVSFLKTRNFNVVVYDEGHMLKNSMSERFNKLMRIHANFRLLLTGTPLQNNL 739

Query: 565  KELAALVNFLMPGRFTIDQEI-------DFENQDEEQ-------EQYIRDLHKRLQPFIL 610
            KEL +L+ F+MP  F   +E          +  D+ +       +Q I      ++PFIL
Sbjct: 740  KELMSLLEFIMPNLFVSKKESLAAVFKQRAKTSDDNKGHNPLLAQQAITRAKTMMKPFIL 799

Query: 611  RRLKKDVEKSLPSKTERILRVELSDVQTEYYK---NILTKNYSALTAG---------AKG 658
            RR K  V K LP+K  R     ++D Q E Y     ++ ++   +  G         +K 
Sbjct: 800  RRRKDQVLKHLPAKHVRTSYCAMNDTQREIYNREVKLVMEHKQMIRDGTLPEDKKERSKI 859

Query: 659  GRFSMLNIMNTLMKASNHP----YLFDSA----------EEKVLEKFGAGNMSRENI--- 701
               S  N++ +L KAS HP    +++D A          +E    + G     RE++   
Sbjct: 860  ENNSSKNLIMSLRKASIHPLLFRHIYDDAKIDKMCDAILDEPAYAENGNKEYIREDMSFM 919

Query: 702  ----LRGLI-----------------MSSGXXXXXXXXXXXXXXDG-HRVLIFSQMVRIL 739
                L  L                  M+SG                  +VLIF+   ++L
Sbjct: 920  TDFELHRLCCNFPNTLGDYQLKNDEWMNSGKVDALKKLLDDIINKKREKVLIFTLFTQVL 979

Query: 740  DILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDF---VFLLSTRAGGLGINLM 796
            DIL   LS     F RLDG+   N R+  ID F     DD    +F+LSTRAGG GINL+
Sbjct: 980  DILEKVLSTLNYKFLRLDGSTQVNDRQTMIDKF----YDDNTIPIFMLSTRAGGFGINLV 1035

Query: 797  TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 856
             A+ VIIFD  +NP  D QA  RAHR+GQ   V V  L++KD++EE++ + A+ K+ L+ 
Sbjct: 1036 CANHVIIFDQSFNPHDDRQAADRAHRVGQTKEVTVTTLITKDSIEEKIFQLAKTKLALDS 1095

Query: 857  AIIS 860
             + S
Sbjct: 1096 QVSS 1099

>YPL082C (MOT1) [5362] chr16 complement(398475..404078)
            Transcriptional Accessory Protein (TAF) involved in RNA
            polymerase II transcriptional repression through
            interaction with TATA-binding protein (TBP), member of
            the Snf2p family of DNA helicases [5604 bp, 1867 aa]
          Length = 1867

 Score =  253 bits (646), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 173/531 (32%), Positives = 269/531 (50%), Gaps = 67/531 (12%)

Query: 384  PFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG-- 441
            P      LR +Q  G+NW+AFL   + +GIL D+MGLGKT+QT+  I+   + R+++   
Sbjct: 1265 PIAIKATLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRKEDYEK 1324

Query: 442  ---------PHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKG 492
                     P L++ P S    W   F+++AP + V+ Y G    R   R       P+ 
Sbjct: 1325 TRSVESRALPSLIICPPSLTGHWENEFDQYAPFLKVVVYAGGPTVRLTLR-------PQL 1377

Query: 493  KGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANR 552
                    ++++T+Y+    D A L   ++ +  +DE H +KN++S L +++      +R
Sbjct: 1378 SDA-----DIIVTSYDVARNDLAVLNKTEYNYCVLDEGHIIKNSQSKLAKAVKEITANHR 1432

Query: 553  LLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEEQEQ---Y 597
            L++TGTP+QNN+ EL +L +FLMPG          RF   I    + +   +EQE     
Sbjct: 1433 LILTGTPIQNNVLELWSLFDFLMPGFLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVLA 1492

Query: 598  IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY-------KNILTKNY- 649
            +  LHK++ PF+LRRLK+DV   LP K  +    EL D+Q + Y       KN++ K+  
Sbjct: 1493 LEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELGDLQKQLYMDFTKKQKNVVEKDIE 1552

Query: 650  SALTAGAKGGRFSMLNIMN------TLMKASNHPYLF---DSAEEKVLEKFGAGNMSREN 700
            ++  A  K   F  L  M        L+ + NHP L    D  ++  L+     N  + +
Sbjct: 1553 NSEIADGKQHIFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGLDLHDIINAPKLS 1612

Query: 701  ILRGLIMSSGXXXXXXXXXXXXXXD--------GHRVLIFSQMVRILDILGDYLSIK--- 749
             LR L+   G              +         HR LIF Q+  +LD++ + L  K   
Sbjct: 1613 ALRTLLFECGIGEEDIDKKASQDQNFPIQNVISQHRALIFCQLKDMLDMVENDLFKKYMP 1672

Query: 750  GINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWN 809
             + + RLDG++    R+  +  FN   S D   LL+T+ GGLG+NL  ADTVI  + DWN
Sbjct: 1673 SVTYMRLDGSIDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWN 1731

Query: 810  PQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 860
            P  DLQAM RAHRIGQK  V VYR+++K T+EE+++   + KM +   +++
Sbjct: 1732 PMNDLQAMDRAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVN 1782

>Scas_664.9
          Length = 1859

 Score =  249 bits (637), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 173/531 (32%), Positives = 264/531 (49%), Gaps = 67/531 (12%)

Query: 384  PFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG-- 441
            P      LR +Q  G+NW+AFL     +GIL D+MGLGKT+QT+  I+   + R ++   
Sbjct: 1260 PVAIKATLRKYQQDGVNWLAFLNKYRLHGILCDDMGLGKTLQTICIIASDQYLRAEDYKK 1319

Query: 442  ---------PHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKG 492
                     P L+V P S    W   FE++AP + +I Y G    R   R+ E  S    
Sbjct: 1320 TNSVETRKLPSLIVCPPSLTGHWENEFEQYAPFLKIIVYAGGPSMRIPLRD-ELGSA--- 1375

Query: 493  KGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANR 552
                    ++++T+Y+    D + +    + +  +DE H +KNA+S L +++      +R
Sbjct: 1376 --------DIVITSYDVARNDLSIITKYDFNYCVLDEGHIIKNAQSKLAKAVKQISANHR 1427

Query: 553  LLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEEQEQ---Y 597
            L++TGTP+QNN+ EL +L +FLMPG          +F   I    + +   +EQE     
Sbjct: 1428 LILTGTPIQNNVVELWSLFDFLMPGFLGTEKMFQEKFAKPIAASRNSKTSSKEQEAGVLA 1487

Query: 598  IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY-------KNILTKNYS 650
            +  LHK++ PF+LRRLK+DV   LP K  +    ELSD+Q + Y       KN++ K+  
Sbjct: 1488 LEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYQDFAKKQKNVVEKDIE 1547

Query: 651  ALTAGAKGGR-FSMLNIMN------TLMKASNHPYLF---DSAEEKVLEKFGAGNMSREN 700
              T        F  L  M        L+ + NHP L    D  ++  ++     N  + N
Sbjct: 1548 NTTDTDNSQHIFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGIDLHDVINAPKLN 1607

Query: 701  ILRGLIMSSG--------XXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYL---SIK 749
             LR L+   G                        HR LIF Q+  +LD++ + L    + 
Sbjct: 1608 ALRTLLFECGIGEEDMERKSNPNQYLTGQNVISQHRALIFCQLKDMLDMVENDLFKRYMP 1667

Query: 750  GINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWN 809
             + + RLDG+V    R+  +  FN   S D   LL+T+ GGLG+NL  ADTVI  + DWN
Sbjct: 1668 SVTYMRLDGSVDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWN 1726

Query: 810  PQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 860
            P  DLQAM RAHR+GQK  V VYR+++K T+EE+++   + KM +   +++
Sbjct: 1727 PMNDLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVN 1777

>KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1 transcriptional accessory
            protein, start by similarity
          Length = 1873

 Score =  249 bits (636), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 166/531 (31%), Positives = 267/531 (50%), Gaps = 69/531 (12%)

Query: 384  PFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG-- 441
            P      LR +Q  G+NW+AFL   + +GIL D+MGLGKT+QT+  I+   + R ++   
Sbjct: 1280 PVAIKATLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRSEDYKK 1339

Query: 442  ---------PHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSN-PK 491
                     P L++ P S    W + F++++P ++V+ Y G    R     Y      P 
Sbjct: 1340 TQSEKTRPLPSLIICPPSLTGHWEQEFQQYSPTLNVLVYAGGPSVR-----YPLQGQVPT 1394

Query: 492  GKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 551
                     ++++T+Y+    D   L    + +  +DE H +KN++S L +++      +
Sbjct: 1395 A--------DIVVTSYDVARNDVDFLKKYDYNYCVLDEGHIIKNSQSKLAKAVKLINSNH 1446

Query: 552  RLLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEEQEQ--- 596
            RL++TGTP+QNN+ EL +L +FLMPG          RF   I    + +   +EQE    
Sbjct: 1447 RLVLTGTPIQNNVVELWSLFDFLMPGFLGTEKMFQERFAKPIASSRNSKTSSKEQEAGAL 1506

Query: 597  YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL---- 652
             +  LHK++ PF+LRRLK++V   LP K  +    ELSD+Q + Y + + K  + +    
Sbjct: 1507 ALEALHKQVLPFMLRRLKEEVLSDLPPKIIQDYYCELSDLQKQLYNDFVKKQKNVVEKDI 1566

Query: 653  --TAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGA------------GNMSR 698
              TA  +  +  +   +  + K  NHP L  ++     ++  +            G+  +
Sbjct: 1567 ENTAEVENKQ-HIFQALQYMRKLCNHPSLVLNSSHPQFQQVQSYLSQTGMDLHDIGHAPK 1625

Query: 699  ENILRGLIMSSGXXXXXXXXXXXX------XXDGHRVLIFSQMVRILDILGDYL---SIK 749
               L+ L++  G                      HRVLIF Q+  +LD++ + L    + 
Sbjct: 1626 LEALKTLLLECGIGIQDVEKKSNKNPSIDNVISQHRVLIFCQLKDMLDMVENDLLKKHLP 1685

Query: 750  GINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWN 809
             + F RLDG+V S  R+  +  FN   S D   LL+T+ GGLG+NL  ADTVI  + DWN
Sbjct: 1686 SVTFMRLDGSVDSRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWN 1744

Query: 810  PQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 860
            P  DLQAM RAHR+GQK  V VYR+++K T+EE+++   + KM +   I++
Sbjct: 1745 PMNDLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTIVN 1795

>Scas_548.4
          Length = 1054

 Score =  242 bits (618), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 174/538 (32%), Positives = 261/538 (48%), Gaps = 82/538 (15%)

Query: 391  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPLS 450
            L+D+Q TGINW+  L+    + ILAD+MGLGKT Q ++F ++L     + GPHLVVVP S
Sbjct: 496  LKDYQQTGINWLNLLYHNQMSCILADDMGLGKTCQVISFFAYLK-QINEPGPHLVVVPSS 554

Query: 451  TMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTYEYI 510
            T+  W+  F+K+ P + +  Y G+Q  R   RE        G+      ++V++TTY   
Sbjct: 555  TLENWLREFQKFCPTLKIEPYYGSQNERADLRE--ILERTAGQ------YDVIVTTYNLA 606

Query: 511  LKDRAELGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKEL 567
              ++ ++  ++   +  +  DE H LKN+ S  +  L   +   RLL+TGTPLQNN++EL
Sbjct: 607  AGNKYDVSFLRNRQFNVVVYDEGHMLKNSMSERFNKLMRIQGNFRLLLTGTPLQNNLREL 666

Query: 568  AALVNFLMPGRFTIDQEI-------DFENQDEEQ-------EQYIRDLHKRLQPFILRRL 613
             +L+ F+MP  F   +E          +  D+ +       ++ I      ++PFILRR 
Sbjct: 667  MSLLEFIMPALFISKKESLASVFKQRAKTTDDNKGHNPLLVQEAIERAKTMMKPFILRRR 726

Query: 614  KKDVEKSLPSKTERILRVELSDVQTEYY----KNILTKNYSALTAG--------AKGGRF 661
            K  V K LP+K  +I    + D+Q + Y    K ++      L           AK    
Sbjct: 727  KDQVLKHLPAKHHKIEYCIMQDLQRKIYDSEIKTVMEHKKMILDGTLPDDPKERAKIQSS 786

Query: 662  SMLNIMNTLMKASNHPYL------------------------------FDSAEEKVLEKF 691
            S  N++ TL KA+ HP L                              F   +  V+  F
Sbjct: 787  SSSNLIMTLRKAALHPLLFRTIYNDALIAKMSKAIINEPQYKVDGNIEFIKEDMSVMTDF 846

Query: 692  G--------AGNMSRENILRGLIMSSGXXXXXXXXXXXXXXD-GHRVLIFSQMVRILDIL 742
                        +SR  +     M+SG              +   +VLIFS   ++LDIL
Sbjct: 847  ELHRLCLNFPNTLSRYQLKNKEWMNSGKVDTLCRLLKEIIFERKEKVLIFSLFTQVLDIL 906

Query: 743  GDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFV--FLLSTRAGGLGINLMTADT 800
               LS     F RLDG+   N R+  ID F     DD +  F+LST+AGG GINL+ A+ 
Sbjct: 907  ELVLSELNYKFLRLDGSTQVNDRQSLIDKFY---EDDTIPIFILSTKAGGFGINLVCANN 963

Query: 801  VIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 858
            VIIFD  +NP  D QA  RAHR+GQ   V +  L++KD++EE++ + A+ K+ L+  I
Sbjct: 964  VIIFDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIFQLAKNKLALDSHI 1021

>ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH]
           complement(1244005..1248465) [4461 bp, 1486 aa]
          Length = 1486

 Score =  228 bits (581), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 128/337 (37%), Positives = 194/337 (57%), Gaps = 38/337 (11%)

Query: 372 ERPRFEKLSVQ----PPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTV 427
           E    EKLSV     PP ++G  LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT+
Sbjct: 649 ESTNLEKLSVVDVPVPPLLRGT-LRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTI 707

Query: 428 AFISWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFY 487
           A +++L   +   GPHL++VP S +  W   F+++AP   V+ Y G+ + R  +R     
Sbjct: 708 ALLAYLACEKENWGPHLIIVPTSVLLNWEMEFKRFAPGFKVLSYYGSPQQRKEKR----- 762

Query: 488 SNPKGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSF 547
              +G  K    F+V +T+Y+ ++ D+      KWQ++ +DEAH +KN +S+ +++L +F
Sbjct: 763 ---RGWNKLD-AFHVCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFKSTRWQALLNF 818

Query: 548 KVANRLLITGTPLQNNIKELAALVNFLMP------GRFTIDQEIDFENQ----------- 590
               RLL+TGTPLQNNI EL +L+ FLMP      G+ +   ++D   Q           
Sbjct: 819 NTRRRLLLTGTPLQNNIAELWSLLYFLMPQTALENGKISGFADLDAFQQWFGKPVDKIIA 878

Query: 591 ------DEEQEQYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNI 644
                 D+E  + +  LH+ L+P++LRRLK DVEK +P+K E IL   LS  Q   Y + 
Sbjct: 879 ANDSEHDDETRRTVSKLHQVLRPYLLRRLKADVEKQMPAKYEHILYCRLSKRQRFLYDDF 938

Query: 645 LTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFD 681
           +++  +  T  A G   S++N +  L K  NHP LF+
Sbjct: 939 MSRAQTKATL-ASGNFMSIINCLMQLRKVCNHPDLFE 974

 Score =  134 bits (337), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 87/138 (63%), Gaps = 1/138 (0%)

Query: 725  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLL 784
            +GHR LIF+QM ++LDIL  +L+  G  + RLDG      R+I  + FN       VF+L
Sbjct: 1232 EGHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQILTERFNTDPRIT-VFIL 1290

Query: 785  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 844
            S+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YR  S+ T+E  +
Sbjct: 1291 SSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFASEHTIESNI 1350

Query: 845  LERARKKMILEYAIISLG 862
            L++A +K  L+  +I  G
Sbjct: 1351 LKKANQKRQLDNIVIQKG 1368

>CAGL0M01188g complement(132330..136682) similar to sp|Q05471
           Saccharomyces cerevisiae YDR334w, start by similarity
          Length = 1450

 Score =  226 bits (575), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 127/342 (37%), Positives = 191/342 (55%), Gaps = 34/342 (9%)

Query: 381 VQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQN 440
           V  P +  G LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT++ +S+L   +   
Sbjct: 618 VPTPSLLRGTLRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLSYLACEKHNW 677

Query: 441 GPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKF 500
           GPHL+VVP S +  W   F+++AP   V+ Y GN + R  +R        KG  K    F
Sbjct: 678 GPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGNPQQRKEKR--------KGWNKPD-AF 728

Query: 501 NVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPL 560
           +V + +Y+ I++D+      KWQ++ +DEAH +KN  S+ +++L +F    R+L+TGTPL
Sbjct: 729 HVCIVSYQLIVQDQHSFKRKKWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRILLTGTPL 788

Query: 561 QNNIKELAALVNFLMPGRFTIDQEID-------FEN-----------------QDEEQEQ 596
           QNNI EL +L+ FLMP      Q++        F+                  QD E ++
Sbjct: 789 QNNIAELWSLLYFLMPQTVIDGQKVSGFADLDAFQQWFGRPVDKLIETGGTYEQDNETKR 848

Query: 597 YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGA 656
            +  LH+ L+P++LRRLK DVEK +P K E I+  +LS  Q   Y + +++  +  T  A
Sbjct: 849 TVEKLHQVLRPYLLRRLKADVEKQIPGKYEHIVYCKLSKRQRFLYDDFMSRAQTKATL-A 907

Query: 657 KGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSR 698
            G   S++N +  L K  NHP LF+    K    FG   ++R
Sbjct: 908 SGNFMSIVNCLMQLRKVCNHPDLFEVRPIKTSFLFGESVIAR 949

 Score =  137 bits (344), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/137 (48%), Positives = 88/137 (64%), Gaps = 1/137 (0%)

Query: 726  GHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLS 785
            GHR LIF+QM ++LDIL  +L+  G  + RLDG      R+I  + FN+      VF+LS
Sbjct: 1194 GHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQILTERFNSDPKIT-VFILS 1252

Query: 786  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 845
            +R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YR VS+ T+E  +L
Sbjct: 1253 SRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNIL 1312

Query: 846  ERARKKMILEYAIISLG 862
            ++A +K  L+  II  G
Sbjct: 1313 KKANQKRQLDDVIIQKG 1329

>Scas_646.3*
          Length = 1456

 Score =  224 bits (570), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 133/376 (35%), Positives = 212/376 (56%), Gaps = 42/376 (11%)

Query: 337 EDAAEIVKIAPEPVK-HFQSRQNSKILPQYSSNYTSER--PRFEKLSV---QPPFIKGGE 390
           ED+ + V   PE +    ++    ++LP  +    SE+  P  ++LSV     P +  G 
Sbjct: 584 EDSDDFVMSEPESITPASETPDKGELLPNEAGAENSEQVVPNEQQLSVVDVPVPSLLRGT 643

Query: 391 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPLS 450
           LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT++ +++L   ++  GPHL+VVP S
Sbjct: 644 LRTYQKQGLNWLASLFNNNTNGILADEMGLGKTIQTISLLAYLACEKQNWGPHLIVVPTS 703

Query: 451 TMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTYEYI 510
            +  W   F+++ P + V+ Y G+ + R  +R        KG  K    F+V + +Y+ +
Sbjct: 704 VLLNWEMEFKRFCPGLKVLTYYGSPQQRKEKR--------KGWNKPD-AFHVCIVSYQLV 754

Query: 511 LKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAAL 570
           ++D+      KWQ++ +DEAH +KN  S+ +++L +F    RLL+TGTPLQNN+ EL +L
Sbjct: 755 VQDQHSFKRKKWQYMVLDEAHNIKNFRSTRWQALLNFNTRRRLLVTGTPLQNNLAELWSL 814

Query: 571 VNFLMP----------------------GRFTIDQEIDF---ENQDEEQEQYIRDLHKRL 605
           + FLMP                      GR  +D+ I+      QD E ++ +  LH+ L
Sbjct: 815 LYFLMPQTVIDGKKVSGFADLDAFQQWFGR-PVDKLIETGAGYQQDAETKKTVSKLHQVL 873

Query: 606 QPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLN 665
           +P++LRRLK DVEK +P+K E I+   LS  Q   Y + ++++ +  T  A G   S++N
Sbjct: 874 RPYLLRRLKADVEKQMPAKYEHIVYCRLSKRQRFLYDDFMSRSQTKATL-ASGNFMSIVN 932

Query: 666 IMNTLMKASNHPYLFD 681
            +  L K  NHP LF+
Sbjct: 933 CLMQLRKVCNHPDLFE 948

 Score =  136 bits (342), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 67/147 (45%), Positives = 92/147 (62%), Gaps = 1/147 (0%)

Query: 725  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLL 784
            +GHR LIF+QM ++LD+L  +L+  G  + RLDG      R+I  + FN       VF+L
Sbjct: 1204 NGHRALIFTQMTKVLDVLERFLNYHGYIYMRLDGATKVEDRQILTERFNNDPRVT-VFIL 1262

Query: 785  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 844
            S+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YR VS+ T+E  +
Sbjct: 1263 SSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNI 1322

Query: 845  LERARKKMILEYAIISLGVTDGNKYTK 871
            L++A +K  L+  +I  G    + +TK
Sbjct: 1323 LKKANQKRQLDNVVIQRGGFHYDYFTK 1349

>KLLA0A03069g complement(271516..274203) similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54 DNA-dependent
           ATPase of the SNF2P family, start by similarity
          Length = 895

 Score =  220 bits (561), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 145/478 (30%), Positives = 234/478 (48%), Gaps = 34/478 (7%)

Query: 413 ILADEMGLGKTVQTVAFISWLIF-----ARRQNGPHLVVVPLSTMPAWIETFEKW-AP-D 465
           I+ADEMGLGKT+Q +A + W +       RR     ++V P S +  W    +KW  P  
Sbjct: 329 IMADEMGLGKTLQCLALM-WTMLKQGPQGRRSIDKCIIVCPSSLVNNWANEIDKWLGPGS 387

Query: 466 IDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFL 525
           +  +   G + S +     +  S+      + I   VL+ +Y+ + ++  +L + +   +
Sbjct: 388 LSSLAIDGKKSSLNNGNVADSVSHWASAQGRNIVKPVLIISYDTLRRNVEQLKNCEVGLM 447

Query: 526 AVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPG-------- 577
             DE HRLKNA+S  + +L+S +   R++++GTP+QN++ E  AL+NF  PG        
Sbjct: 448 LADEGHRLKNADSLTFTALDSIRCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGSRNDF 507

Query: 578 ----RFTIDQEIDFENQDEE---QEQYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILR 630
                  I Q  D    DEE    +  +R L   +  FI+RR    + K LP K E ++ 
Sbjct: 508 RKNFELPILQSRDSLATDEEVTLGKDRLRQLSNIVSKFIIRRTNNILAKYLPCKYEHVIF 567

Query: 631 VELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFD------SAE 684
           + L+  Q   Y++ +     A+    KG     L  +  L K  NHP L +       +E
Sbjct: 568 INLTPFQQSLYQHFIESR--AVKKIVKGDSNQPLKAIGLLKKLCNHPDLLELSEDIPGSE 625

Query: 685 EKVLEKFGAGNMSRENILRGLI---MSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDI 741
           E + + + +   SR +  R +I    SS                  ++++ S   + LD+
Sbjct: 626 ELIPDDYQSSVDSRTSRNRSVIQTAFSSKFSVLARFLYKIKTESNDKIVLISNYTQTLDL 685

Query: 742 LGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTV 801
           +            RLDGT+  N+R+  +D FN P   +F+FLLS++AGG GINL+ A+ +
Sbjct: 686 IEKMCFSNHYGVLRLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRL 745

Query: 802 IIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 859
           I+ D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   ++
Sbjct: 746 ILLDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 803

>Kwal_34.16082
          Length = 726

 Score =  215 bits (547), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 144/482 (29%), Positives = 234/482 (48%), Gaps = 76/482 (15%)

Query: 391 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPLS 450
           L ++Q T + W+  L+ +   GI+ DEMGLGKT+Q +AF++ L  + + +GP L+V P +
Sbjct: 263 LFNYQKTCVQWLYELFQQQCGGIIGDEMGLGKTIQIIAFLASLHHSGKLDGPVLIVCPAT 322

Query: 451 TMPAWIETFEKWAPDIDVICY------MGNQKSRDIEREYEFY--SNPK----------- 491
            +  W + F  W P    +        M  + +   E+  E +  SNP+           
Sbjct: 323 VLRQWCKEFHTWWPPFRTVILHSIGAGMTQKDTISEEKLEELFMNSNPEELSYDAYMDSK 382

Query: 492 --------GKGKKQI------KFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAE 537
                   G  + ++      + ++L+TTY  +      L +++W +  +DE H+++N +
Sbjct: 383 RTKSTLESGMARSKLINKVVSEGHILITTYVGLRIHADNLLNVRWSYAVLDEGHKIRNPD 442

Query: 538 SSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGR----------FTIDQEI-D 586
           + +  +    K  NR++++GTP+QNN+ EL +L +F+ PGR          F+I   +  
Sbjct: 443 ADISLTCKKLKTKNRIILSGTPIQNNLTELWSLFDFIYPGRLGTLPVFQQQFSIPINVGG 502

Query: 587 FENQDEEQEQY-------IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTE 639
           + N    Q Q        +R+L   + P++LRR+K DV K LP K E +L  +L+  Q  
Sbjct: 503 YANATNIQVQTGYKCAIALRNL---ISPYLLRRIKADVAKDLPKKNEMVLFCKLTQFQRR 559

Query: 640 YYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRE 699
            Y   L  N   LT   K G+  +L  ++ L K  NHP L +  + +    +G       
Sbjct: 560 KYLQFL--NSEDLTK-IKNGKRQVLFGIDILRKICNHPDLLEKDKRENESSYGDPK---- 612

Query: 700 NILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIK-----GINFQ 754
                    SG               GH+ L+F+Q  ++LDIL  ++S K      + + 
Sbjct: 613 --------RSGKMQVVKQLLRLWHSQGHKTLLFTQSRQMLDILEKFISYKDPELEDLTYL 664

Query: 755 RLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADL 814
           R+DGT     R+  +D FN    D  VFLL+TR GGLG+NL  A+ +IIFD DWNP  D+
Sbjct: 665 RMDGTTNIGSRQALVDSFNNGLYD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDM 722

Query: 815 QA 816
           QA
Sbjct: 723 QA 724

>AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH]
           complement(1426843..1431087) [4245 bp, 1414 aa]
          Length = 1414

 Score =  221 bits (562), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 127/333 (38%), Positives = 204/333 (61%), Gaps = 30/333 (9%)

Query: 378 KLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFAR 437
           +++++ P I    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L  A 
Sbjct: 642 EITIEQPKILACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHL--AE 699

Query: 438 RQN--GPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGK 495
           R N  GP +VV P ST+  W+   +K+ PD  ++ Y GN   R I R   F+     +  
Sbjct: 700 RYNIWGPFIVVTPASTLHNWVNEIQKFVPDFKILPYWGNGNDRKILR--RFWDRKHLRYS 757

Query: 496 KQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLI 555
           K   F+V++T+Y+ I+ D A L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+
Sbjct: 758 KDAPFHVMITSYQMIVSDAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLL 817

Query: 556 TGTPLQNNIKELAALVNFLMPGRFTIDQEI-DFENQDEEQ---------EQYIRDLHKRL 605
           TGTP+QN+++EL AL++F+MP  F    E  D+ ++D E          +Q +R LH  L
Sbjct: 818 TGTPIQNSMQELWALLHFIMPSLFDSHDEFNDWFSKDIESHAQSNTQLNQQQLRRLHMIL 877

Query: 606 QPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSAL------TAGA 656
           +PF+LRR+KK+V+  L  K E  +  +L+  Q + Y   K+ ++ +Y A+      ++G 
Sbjct: 878 KPFMLRRIKKNVQSELGDKIEIDVMCDLTHRQAKLYQVLKSQVSASYDAIENAASNSSGD 937

Query: 657 KGGRFSMLN--IMNTLM---KASNHPYLFDSAE 684
             G  S+ +  IMNT+M   K  NHP LF+ A+
Sbjct: 938 DSGNMSLSDSKIMNTVMEFRKVCNHPDLFERAD 970

 Score =  137 bits (346), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/144 (47%), Positives = 95/144 (65%), Gaps = 1/144 (0%)

Query: 727  HRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLST 786
            HRVLI+ QM R++D++ +YL+ +     RLDG+     RR  +  +    SD F+FLLST
Sbjct: 1257 HRVLIYFQMTRMMDLIEEYLTYRQYKHIRLDGSSKLEDRRDLVHDWQTK-SDIFIFLLST 1315

Query: 787  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 846
            RAGGLGINL +ADTVI +DSDWNP  D QAM RAHR+GQ   V VYRL+ K T+EE + +
Sbjct: 1316 RAGGLGINLTSADTVIFYDSDWNPTIDSQAMDRAHRLGQTKQVTVYRLLIKGTIEERMRD 1375

Query: 847  RARKKMILEYAIISLGVTDGNKYT 870
            RA++K  ++  ++     + N  T
Sbjct: 1376 RAKQKEHVQQVVMEGKTKENNVQT 1399

>Scas_669.20
          Length = 1397

 Score =  220 bits (560), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 126/334 (37%), Positives = 198/334 (59%), Gaps = 24/334 (7%)

Query: 379 LSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARR 438
           ++++ P +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L  A +
Sbjct: 633 VTIEQPKMLACTLKEYQLKGLNWLASLYDQGINGILADEMGLGKTVQSISVLAHL--AEK 690

Query: 439 QN--GPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKK 496
            N  GP+LVV P ST+  W+    K+ P   ++ Y GN   R + R  +F+     +  K
Sbjct: 691 HNIWGPYLVVTPASTLHNWVNEITKFVPQFKILPYWGNAADRKVLR--KFWDRKNLRYTK 748

Query: 497 QIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLIT 556
              F+V++T+Y+ ++ D   L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+T
Sbjct: 749 DSPFHVMITSYQMVVSDVTYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLT 808

Query: 557 GTPLQNNIKELAALVNFLMPGRFTIDQEI------DFENQDEE----QEQYIRDLHKRLQ 606
           GTP+QNN++EL AL++F+MP  F    E       D E+  E       Q +R LH  L+
Sbjct: 809 GTPIQNNMQELWALLHFIMPSLFDSHDEFSEWFAKDIESHAEANTQLNHQQLRRLHMILK 868

Query: 607 PFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNI-LTKNYSALTAGAKGGRFSM-L 664
           PF+LRR+KK+V+  L  K E  +  +L+  Q + Y+ +  T NY A+   A    FS   
Sbjct: 869 PFMLRRVKKNVQSELGDKIEIDVLCDLTQRQAKLYQVLKSTSNYDAIENAAGSDEFSSDQ 928

Query: 665 NIMNTLM---KASNHPYLFDSAEEK---VLEKFG 692
           N++NT+M   K  NHP LF+ A+        KFG
Sbjct: 929 NLVNTVMQFRKVCNHPDLFERADINSPFAFTKFG 962

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 102/158 (64%), Gaps = 1/158 (0%)

Query: 725  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLL 784
            +GHRVLI+ QM +++D++ +YL+ +  N  RLDG+     RR  + H      + FVFLL
Sbjct: 1235 EGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRDLV-HDWQTKPEIFVFLL 1293

Query: 785  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 844
            STRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYRL+ + T+EE +
Sbjct: 1294 STRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLIRGTIEERM 1353

Query: 845  LERARKKMILEYAIISLGVTDGNKYTKKTEPSAGELSE 882
             +RA++K  ++  ++     + N  T +   S  ++++
Sbjct: 1354 RDRAKQKEQVQQVVMEGKTQENNVKTIEASNSTTDITK 1391

>KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w SWR1 DEAH-box protein,
            putative RNA helicase, hypothetical start
          Length = 1572

 Score =  219 bits (558), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 188/326 (57%), Gaps = 36/326 (11%)

Query: 381  VQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQN 440
            V  P +  G LR +Q  G+NW+A L++   NGILADEMGLGKT+QT++ +++L   +   
Sbjct: 755  VPVPSLLRGTLRIYQKQGLNWLASLYNNKTNGILADEMGLGKTIQTISLLAYLACEKENW 814

Query: 441  GPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKG-KKQIK 499
            GPHL+VVP S +  W   F+++AP   V+ Y G+ + R   RE       K KG  K   
Sbjct: 815  GPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQR---RE-------KRKGWNKPDA 864

Query: 500  FNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTP 559
            F+V +T+Y+ ++ D+      KWQ++ +DEAH +KN  S+ +++L +F    RLL+TGTP
Sbjct: 865  FHVCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTP 924

Query: 560  LQNNIKELAALVNFLMP------GRFTIDQEIDF----------------EN--QDEEQE 595
            LQNN+ EL +L+ FLMP      G+ +   ++D                 EN  QDEE +
Sbjct: 925  LQNNLAELWSLLYFLMPQTALENGKVSGFADLDAFQQWFGRPVDKIVETGENYEQDEETK 984

Query: 596  QYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG 655
            + +  LH+ L+P++LRRLK DVEK +P K E I+   LS  Q   Y + +++  +  T  
Sbjct: 985  KTVSKLHQVLRPYLLRRLKADVEKQMPGKYEHIIYCRLSKRQRFLYDDFMSRAQTKETL- 1043

Query: 656  AKGGRFSMLNIMNTLMKASNHPYLFD 681
            A G   S++N +  L K  NHP LF+
Sbjct: 1044 ASGNFMSIINCLMQLRKVCNHPDLFE 1069

 Score =  141 bits (355), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 111/192 (57%), Gaps = 10/192 (5%)

Query: 725  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLL 784
            +GHR LIF+QM ++LDIL  +L+  G  + RLDG      R+I  + FN+      VF+L
Sbjct: 1325 NGHRALIFTQMTKVLDILEQFLNFHGYLYMRLDGATKIEDRQILTERFNSDPRIT-VFIL 1383

Query: 785  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 844
            S+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YR VS  T+E  +
Sbjct: 1384 SSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSDHTIESNI 1443

Query: 845  LERARKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKLEDL 904
            L++A +K  L+  +I  G    + +TK        LS     GA       D++  L+D 
Sbjct: 1444 LKKANQKRHLDNVVIQTGDFTTDYFTK--------LSVKDLLGAEAPEDIPDDKPLLQDQ 1495

Query: 905  -NLDDVLSHAED 915
             NL+ +L+ AED
Sbjct: 1496 KNLNKLLAQAED 1507

>Kwal_55.20143
          Length = 1494

 Score =  218 bits (555), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 119/327 (36%), Positives = 187/327 (57%), Gaps = 34/327 (10%)

Query: 379 LSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARR 438
           + V  P +  G LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT++ +++L   + 
Sbjct: 659 VDVPTPSLLRGTLRIYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLAYLACEKH 718

Query: 439 QNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQI 498
             GPHL++VP S +  W   F+++AP   V+ Y G+ + R  +R  + ++ P        
Sbjct: 719 NWGPHLIIVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKR--KGWNRPDA------ 770

Query: 499 KFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGT 558
            F+V +T+Y+ ++ D+      KWQ++ +DEAH +KN  S+ +++L +F    RLL+TGT
Sbjct: 771 -FHVCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGT 829

Query: 559 PLQNNIKELAALVNFLMP----------------------GRFT--IDQEIDFENQDEEQ 594
           PLQNN+ EL +L+ FLMP                      GR    I Q  +   QDEE 
Sbjct: 830 PLQNNLAELWSLLYFLMPQTAGTNGGIQGFADLEAFQQWFGRPVDKIIQTGEGYAQDEET 889

Query: 595 EQYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA 654
            + +  LH+ L+P++LRRLK DVEK +P+K E ++   LS  Q   Y + +++  +  T 
Sbjct: 890 RKTVTKLHQVLRPYLLRRLKADVEKQMPAKHEHVVYCRLSKRQRFLYDDFMSRAQTKETL 949

Query: 655 GAKGGRFSMLNIMNTLMKASNHPYLFD 681
            + G   S++N +  L K  NHP LF+
Sbjct: 950 SS-GNFMSIINCLMQLRKVCNHPDLFE 975

 Score =  136 bits (342), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 80/197 (40%), Positives = 114/197 (57%), Gaps = 15/197 (7%)

Query: 726  GHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFV--FL 783
            GHR LIF+QM ++LD+L  +L+  G  + RLDG     +R+I  + FN   +D+ +  F+
Sbjct: 1233 GHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEERQILTERFN---TDNRITAFI 1289

Query: 784  LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEE 843
            LS+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YR VS+ T+E  
Sbjct: 1290 LSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESN 1349

Query: 844  VLERARKKMILEYAIISLGVTDGNKYTKKT--EPSAGELSEILKFGAGNMF---AAKDNQ 898
            +L++A +K  L+  +I  G    +  TK +  +    EL +I       +    AA  + 
Sbjct: 1350 ILKKANQKRQLDNVVIQRGDFTTDYLTKLSVKDLVGAELPDIAASDKPLLMEEDAATKDP 1409

Query: 899  KKLEDLNLDDVLSHAED 915
            +KLE L     L+ AED
Sbjct: 1410 RKLEKL-----LAQAED 1421

>YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2p DNA
            helicase ATPase family [4545 bp, 1514 aa]
          Length = 1514

 Score =  218 bits (554), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 120/328 (36%), Positives = 190/328 (57%), Gaps = 36/328 (10%)

Query: 379  LSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARR 438
            + V  P +  G LR +Q  G+NW+A L++ + NGILADEMGLGKT+QT++ +++L   + 
Sbjct: 684  VDVPVPSLLRGNLRTYQKQGLNWLASLYNNHTNGILADEMGLGKTIQTISLLAYLACEKE 743

Query: 439  QNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQI 498
              GPHL+VVP S +  W   F+++AP   V+ Y G+ + R  +R        KG  K   
Sbjct: 744  NWGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKR--------KGWNKPD- 794

Query: 499  KFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGT 558
             F+V + +Y+ +++D+      +WQ++ +DEAH +KN  S+ +++L +F    RLL+TGT
Sbjct: 795  AFHVCIVSYQLVVQDQHSFKRKRWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGT 854

Query: 559  PLQNNIKELAALVNFLMP----------------------GRFTIDQEIDFEN---QDEE 593
            PLQNN+ EL +L+ FLMP                      GR  +D+ I+      QD+E
Sbjct: 855  PLQNNLAELWSLLYFLMPQTVIDGKKVSGFADLDAFQQWFGR-PVDKIIETGQNFGQDKE 913

Query: 594  QEQYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALT 653
             ++ +  LH+ L+P++LRRLK DVEK +P+K E I+  +LS  Q   Y + +++  +  T
Sbjct: 914  TKKTVAKLHQVLRPYLLRRLKADVEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKAT 973

Query: 654  AGAKGGRFSMLNIMNTLMKASNHPYLFD 681
              A G   S++N +  L K  NHP LF+
Sbjct: 974  L-ASGNFMSIVNCLMQLRKVCNHPNLFE 1000

 Score =  139 bits (349), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/193 (40%), Positives = 112/193 (58%), Gaps = 4/193 (2%)

Query: 725  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLL 784
            +GHR LIF+QM ++LD+L  +L+  G  + RLDG      R+I  + FN   S   VF+L
Sbjct: 1261 NGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFNT-DSRITVFIL 1319

Query: 785  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 844
            S+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YR VS+ T+E  +
Sbjct: 1320 SSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNI 1379

Query: 845  LERARKKMILEYAIISLGVTDGNKYTKKT--EPSAGELSEILKFGAGNMFAAKDNQKKLE 902
            L++A +K  L+  +I  G    + ++K +  +    EL E    G   + A  D   K +
Sbjct: 1380 LKKANQKRQLDNVVIQEGDFTTDYFSKLSVRDLLGSELPENASGGDKPLIADADVAAK-D 1438

Query: 903  DLNLDDVLSHAED 915
               L+ +L+ AED
Sbjct: 1439 PRQLERLLAQAED 1451

>CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces
            cerevisiae YGL150c INO80, hypothetical start
          Length = 1484

 Score =  216 bits (550), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 120/329 (36%), Positives = 197/329 (59%), Gaps = 24/329 (7%)

Query: 378  KLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFAR 437
            +++++ P +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L    
Sbjct: 709  EITIEQPKMLACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEHH 768

Query: 438  RQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQ 497
               GP LVV P ST+  W+    K+ P   ++ Y G+   R + R  +F+     +  ++
Sbjct: 769  NIWGPFLVVTPASTLHNWVNEISKFVPQFKILPYWGSANDRKVLR--KFWDRKNLRYSEK 826

Query: 498  IKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITG 557
              F+V++T+Y+ ++ D + L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+TG
Sbjct: 827  SPFHVMITSYQMVVADASYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTG 886

Query: 558  TPLQNNIKELAALVNFLMPGRFTIDQEI------DFENQDEE----QEQYIRDLHKRLQP 607
            TP+QNN++EL AL++F+MP  F    E       D E+  E      +Q +R LH  L+P
Sbjct: 887  TPIQNNMQELWALLHFIMPSLFDSHDEFNEWFSRDIESHAEGNSSLNQQQLRRLHMILKP 946

Query: 608  FILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSALTAGA------KG 658
            F+LRR+KK+V+  L  K E  +  +L+  QT+ Y   K+ ++ NY A+   A       G
Sbjct: 947  FMLRRIKKNVQSELGDKIEIDVMCDLTQRQTKLYQVLKSQMSSNYDAIENAAAEGSDIAG 1006

Query: 659  GRFSMLNIMNTLM---KASNHPYLFDSAE 684
            G  S  +I+N +M   K  NHP LF+ A+
Sbjct: 1007 GGNSDQSIINAVMQFRKVCNHPDLFERAD 1035

 Score =  142 bits (357), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 100/157 (63%), Gaps = 1/157 (0%)

Query: 725  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLL 784
            + HRVLI+ QM +++D++ +YL+ +  N  RLDG+     RR  + H      + F+FLL
Sbjct: 1310 NDHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRDLV-HDWQTNPEIFIFLL 1368

Query: 785  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 844
            STRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYRL+ + T+EE +
Sbjct: 1369 STRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTKQVTVYRLLVRGTIEERM 1428

Query: 845  LERARKKMILEYAIISLGVTDGNKYTKKTEPSAGELS 881
             +RA++K  ++  ++     D N  T  T P   +L+
Sbjct: 1429 RDRAKQKEQVQQVVMEGKTKDTNIQTTHTRPEHEQLT 1465

>AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH]
           complement(83368..86055) [2688 bp, 895 aa]
          Length = 895

 Score =  213 bits (541), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 147/486 (30%), Positives = 233/486 (47%), Gaps = 48/486 (9%)

Query: 413 ILADEMGLGKTVQTVAFISWLIFARRQNGP----HLVVVPLSTMPAWIETFEKW-APDID 467
           I+ADEMGLGKT+Q +A +  L+    Q  P     ++V P S +  W     KW  PD  
Sbjct: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386

Query: 468 VICYMGNQKSR----DIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQ 523
               +  +KS      + +    ++  +G+    +   VL+ +YE + ++   L   K  
Sbjct: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGR---NVVKPVLIISYETLRRNVENLKGCKVG 443

Query: 524 FLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPG------ 577
            +  DE HRLKN +S  + SL+S     R++++GTP+QN++ E  AL+NF  PG      
Sbjct: 444 LMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRA 503

Query: 578 RFTIDQEI------DFENQDEE---QEQYIRDLHKRLQPFILRRLKKDVEKSLPSKTERI 628
           +F  + EI      D +  D+E    E  + +L + +  FI+RR    + K LP K E I
Sbjct: 504 QFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHI 563

Query: 629 LRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKVL 688
           L V LS +Q   Y++ +     A      G +   L  +  L K  NHP L D  +E   
Sbjct: 564 LFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQ--PLKAIGLLKKLCNHPDLLDLPDEIA- 620

Query: 689 EKFGAGNM---------------SRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFS 733
              G+ N+                R ++      SS                  ++++ S
Sbjct: 621 ---GSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLIS 677

Query: 734 QMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGI 793
              + LD++            RLDGT+  N+R+  +D FN P  ++F+FLLS++AGG GI
Sbjct: 678 NYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGI 737

Query: 794 NLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMI 853
           NL+ A+ +I+ D DWNP AD QA+AR  R GQK    +YR ++  ++EE++ +R   KM 
Sbjct: 738 NLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMS 797

Query: 854 LEYAII 859
           L   ++
Sbjct: 798 LSSCVV 803

>Scas_668.18
          Length = 875

 Score =  212 bits (540), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 150/512 (29%), Positives = 246/512 (48%), Gaps = 44/512 (8%)

Query: 386 IKGGELRDF-QLTGINWMAFLWSKNDNG----ILADEMGLGKTVQTVAFISWLIFARRQN 440
           + G  ++DF     +N       +N+ G    I+ADEMGLGKT+Q +A + W +  +   
Sbjct: 277 VTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTLQCIALM-WTLLRQGPQ 335

Query: 441 GPHLV-----VVPLSTMPAWIETFEKW-APDIDVICYMGNQKSR----DIEREYEFYSNP 490
           G  L+     V P S +  W     KW  P       +  +KS     +       +S  
Sbjct: 336 GKRLIDKCIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWA 395

Query: 491 KGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVA 550
           +  G+  +K  VL+ +YE + ++  +L +     +  DE HRLKN +S  + +L+S    
Sbjct: 396 QATGRNIVK-PVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCP 454

Query: 551 NRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI------------DFENQDEE---QE 595
            R++++GTP+QN++ E  AL+NF  PG      E             D ++ DEE    E
Sbjct: 455 RRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGE 514

Query: 596 QYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNIL-TKNYSALTA 654
           + ++ L   +  FI+RR    + K LP K E ++ V L   Q + Y  +L +++ + +  
Sbjct: 515 EQLQKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVK 574

Query: 655 GAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLI-------M 707
           G  G +   L  +  L K  NHP L +  EE  ++ F    +  E  ++G          
Sbjct: 575 GVGGTQ--PLKAIGVLKKLCNHPNLINLDEE--IDDFDDLEIPDEYNMQGSKSRDVQPQF 630

Query: 708 SSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRI 767
           S                   ++++ S   + LD++      K  +  RLDGT+  N+R+ 
Sbjct: 631 SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690

Query: 768 AIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKN 827
            +D FN P   +F+FLLS++AGG GINL+ A+ +I+ D DWNP AD QA+AR  R GQK 
Sbjct: 691 LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750

Query: 828 HVMVYRLVSKDTVEEEVLERARKKMILEYAII 859
              +YR +S  ++EE++ +R   KM L   ++
Sbjct: 751 DCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782

>Kwal_27.11388
          Length = 1334

 Score =  215 bits (548), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 130/349 (37%), Positives = 207/349 (59%), Gaps = 24/349 (6%)

Query: 378 KLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFAR 437
           ++++  P +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L    
Sbjct: 581 EITIDQPKLLTCTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAENY 640

Query: 438 RQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQ 497
              GP +VV P ST+  W+    K+ PD  ++ Y GN   R I R   F+   + +  K 
Sbjct: 641 NIWGPFIVVTPASTLHNWVNEISKFLPDFKILPYWGNGNDRKILRR--FWDRKQFRYGKD 698

Query: 498 IKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITG 557
             F+V++T+Y+ ++ D A L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+TG
Sbjct: 699 APFHVMVTSYQMVVSDAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTG 758

Query: 558 TPLQNNIKELAALVNFLMPGRF-TIDQEIDFENQDEEQ---------EQYIRDLHKRLQP 607
           TP+QNN++EL AL++F+MP  F + D+  D+ ++D E          +Q +R LH  L+P
Sbjct: 759 TPIQNNMQELWALLHFIMPSLFDSHDEFSDWFSKDIESHAQSNTKLNQQQLRRLHMILKP 818

Query: 608 FILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSALTAGAKGGRFSM- 663
           F+LRR+KK+V+  L  K E  +  +L+  Q + Y   K+ ++  Y A+   A     S  
Sbjct: 819 FMLRRIKKNVQSELGEKIEIDVMCDLTRRQHKLYQVLKSQMSAAYDAIENAAGSDEASSD 878

Query: 664 LNIMNTLM---KASNHPYLFDSAEEKVLEKFGAGNMSRE-NILR--GLI 706
            NI+NT+M   K  NHP LF+   E V   F   +  R  +ILR  G+I
Sbjct: 879 QNIVNTVMQFRKVCNHPDLFE--REDVRSPFAFTDFGRSGSILREGGMI 925

 Score =  133 bits (334), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 65/133 (48%), Positives = 90/133 (67%), Gaps = 1/133 (0%)

Query: 727  HRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLST 786
            HRVLI+ QM +++D++ +YLS +     RLDG+     RR  + H      + F+FLLST
Sbjct: 1187 HRVLIYFQMTKMMDLMEEYLSFRQYKHIRLDGSSKLEDRRDLV-HDWQTKPEIFIFLLST 1245

Query: 787  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 846
            RAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYRL+ + T+EE + +
Sbjct: 1246 RAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLIRGTIEERMRD 1305

Query: 847  RARKKMILEYAII 859
            RA++K  ++  ++
Sbjct: 1306 RAKQKEQVQQVVM 1318

>YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of the
            Snf2p-like family of probable DNA helicases [4470 bp,
            1489 aa]
          Length = 1489

 Score =  212 bits (539), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 119/330 (36%), Positives = 193/330 (58%), Gaps = 26/330 (7%)

Query: 379  LSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARR 438
            ++++ P I    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L     
Sbjct: 694  ITIEQPKILACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAENHN 753

Query: 439  QNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQI 498
              GP LVV P ST+  W+    K+ P   ++ Y GN   R + R  +F+     +  K  
Sbjct: 754  IWGPFLVVTPASTLHNWVNEISKFLPQFKILPYWGNANDRKVLR--KFWDRKNLRYNKNA 811

Query: 499  KFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGT 558
             F+V++T+Y+ ++ D   L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+TGT
Sbjct: 812  PFHVMVTSYQMVVTDANYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGT 871

Query: 559  PLQNNIKELAALVNFLMPGRFTIDQEI------DFENQDEE----QEQYIRDLHKRLQPF 608
            P+QN+++EL AL++F+MP  F    E       D E+  E      +Q +R LH  L+PF
Sbjct: 872  PIQNSMQELWALLHFIMPSLFDSHDEFNEWFSKDIESHAEANTKLNQQQLRRLHMILKPF 931

Query: 609  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSAL--------TAGAK 657
            +LRR+KK+V+  L  K E  +  +L+  Q + Y   K+ ++ NY A+        T+ + 
Sbjct: 932  MLRRVKKNVQSELGDKIEIDVLCDLTQRQAKLYQVLKSQISTNYDAIENAATNDSTSNSA 991

Query: 658  GGRFSMLNIMNTLM---KASNHPYLFDSAE 684
                S  N++N +M   K  NHP LF+ A+
Sbjct: 992  SNSGSDQNLINAVMQFRKVCNHPDLFERAD 1021

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/135 (49%), Positives = 93/135 (68%), Gaps = 1/135 (0%)

Query: 725  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLL 784
            +GHRVLI+ QM +++D++ +YL+ +  N  RLDG+     RR  + H      + FVFLL
Sbjct: 1314 EGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRDLV-HDWQTNPEIFVFLL 1372

Query: 785  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 844
            STRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYRL+ + T+EE +
Sbjct: 1373 STRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLVRGTIEERM 1432

Query: 845  LERARKKMILEYAII 859
             +RA++K  ++  ++
Sbjct: 1433 RDRAKQKEQVQQVVM 1447

>YGL163C (RAD54) [1826] chr7 complement(193711..196407)
           DNA-dependent ATPase of the Snf2p family, required for
           mitotic recombination and DNA repair of X-ray damage
           [2697 bp, 898 aa]
          Length = 898

 Score =  207 bits (527), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 147/493 (29%), Positives = 230/493 (46%), Gaps = 65/493 (13%)

Query: 413 ILADEMGLGKTVQTVAFISWLIFARRQNGPHLV-----VVPLSTMPAWIETFEKW-APDI 466
           I+ADEMGLGKT+Q +A + W +  +   G  L+     V P S +  W     KW  P+ 
Sbjct: 332 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNT 390

Query: 467 DVICYMGNQKSR----DIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSIKW 522
                +  +KS     +       ++  + +G+  +K  VL+ +YE + ++  +L +   
Sbjct: 391 LTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVK-PVLIISYETLRRNVDQLKNCNV 449

Query: 523 QFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTID 582
             +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL++F  PG     
Sbjct: 450 GLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSR 509

Query: 583 QEI--DFEN----------QDEE---QEQYIRDLHKRLQPFILRRLKKDVEKSLPSKTER 627
            E   +FEN           D+E    E  ++ L   +  FI+RR    + K LP K E 
Sbjct: 510 AEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEH 569

Query: 628 ILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFD------ 681
           ++ V L  +Q E Y N L K+          G    L  +  L K  NHP L +      
Sbjct: 570 VIFVNLKPLQNELY-NKLIKSREVKKVVKGVGGSQPLRAIGILKKLCNHPNLLNFEDEFD 628

Query: 682 ---------------SAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDG 726
                          S    V  K+ A     E  L  +   S                 
Sbjct: 629 DEDDLELPDDYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDD--------------- 673

Query: 727 HRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLST 786
            ++++ S   + LD++      K  +  RLDGT+  N+R+  +D FN P   +F+FLLS+
Sbjct: 674 -KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSS 732

Query: 787 RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 846
           +AGG GINL+ A+ +I+ D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +
Sbjct: 733 KAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQ 792

Query: 847 RARKKMILEYAII 859
           R   KM L   ++
Sbjct: 793 RQSMKMSLSSCVV 805

>Kwal_14.1537
          Length = 842

 Score =  206 bits (524), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 145/483 (30%), Positives = 223/483 (46%), Gaps = 44/483 (9%)

Query: 413 ILADEMGLGKTVQTVAFISWLIFARRQNGP----HLVVVPLSTMPAWIETFEKWAPDIDV 468
           I+ADEMGLGKT+Q +A +  L+    Q  P     ++V P S +  W     KW      
Sbjct: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWL----- 414

Query: 469 ICYMGNQKSRDIEREYEFYSNPK----------GKGKKQIKFNVLMTTYEYILKDRAELG 518
               G   S  I+ +    +N             +G+  +K  VL+ +YE + ++   L 
Sbjct: 415 --GKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVK-PVLIISYETLRRNVEHLN 471

Query: 519 SIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGR 578
           + +   L  DE HRLKNAES  + +L+S     R++++GTP+QN++ E  AL+NF  PG 
Sbjct: 472 NCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL 531

Query: 579 FTIDQEI--DFEN----------QDEE---QEQYIRDLHKRLQPFILRRLKKDVEKSLPS 623
                E   +FEN           D E     + ++ L   +  FI+RR    + K LP 
Sbjct: 532 LGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPC 591

Query: 624 KTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLF--- 680
           K E +L V L   Q   Y+ +L      L           L  +  L K  NHP L    
Sbjct: 592 KYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLP 651

Query: 681 ---DSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGH-RVLIFSQMV 736
              + +E+ + E +    +S+          SG              +   +++I S   
Sbjct: 652 EDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYT 711

Query: 737 RILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLM 796
           + LD++            RLDGT+  N+R+  +D FN     +F+FLLS++AGG GINL+
Sbjct: 712 QTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLI 771

Query: 797 TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 856
            A+ +I+ D DWNP AD QA+AR  R GQK    +YR +   T+EE++ +R   KM L  
Sbjct: 772 GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLSS 831

Query: 857 AII 859
            ++
Sbjct: 832 CVV 834

>CAGL0I04224g complement(369858..372686) highly similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54, start by
           similarity
          Length = 942

 Score =  206 bits (524), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 144/481 (29%), Positives = 231/481 (48%), Gaps = 41/481 (8%)

Query: 413 ILADEMGLGKTVQTVAFISWLIFARRQNGPHLV-----VVPLSTMPAWIETFEKW-APDI 466
           I+ADEMGLGKT+Q +A + W +  +   G  L+     V P S +  W     KW  P+ 
Sbjct: 376 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNT 434

Query: 467 DVICYMGNQKSR------DIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSI 520
                +  +KS        +    + ++  +G+    I   VL+ +Y+ + ++  +L + 
Sbjct: 435 LSPLAVDGKKSSLASGATSVAEAIKNWAQAQGR---NIVKPVLIISYDTLRRNVKQLQNT 491

Query: 521 KWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFT 580
           +   L  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG   
Sbjct: 492 EVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 551

Query: 581 IDQEI--DFE-------------NQDEEQEQYIRDLHKRLQPFILRRLKKDVEKSLPSKT 625
              E   +FE             N  +  EQ ++ L   +  FI+RR    + K LP K 
Sbjct: 552 TRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKY 611

Query: 626 ERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEE 685
           E ++ V L+  Q + Y N+L K+          G    L  +  L K  NHP L    EE
Sbjct: 612 EHVIFVNLTPFQKQVY-NMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCNHPDLIKLDEE 670

Query: 686 KVLEKFGAGNMSRE-NILRG------LIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRI 738
             L+ +   ++  + +I  G         S                   ++++ S   + 
Sbjct: 671 --LDNYNDLDIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQT 728

Query: 739 LDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTA 798
           LD++      +     RLDGT+  N+R+  +D FN P   +F+FLLS++AGG GINL+ A
Sbjct: 729 LDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 788

Query: 799 DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 858
           + +I+ D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   +
Sbjct: 789 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCV 848

Query: 859 I 859
           +
Sbjct: 849 V 849

>KLLA0E08965g complement(797861..802330) similar to sp|P53115
            Saccharomyces cerevisiae YGL150c INO80, hypothetical
            start
          Length = 1489

 Score =  207 bits (527), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 119/347 (34%), Positives = 202/347 (58%), Gaps = 31/347 (8%)

Query: 378  KLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFAR 437
            ++++  P +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L  A 
Sbjct: 733  EITIDQPKMLACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHL--AD 790

Query: 438  RQN--GPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGK 495
            R N  GP +VV P ST+  W+    ++ P   ++ Y GN   R   R+  F+     +  
Sbjct: 791  RYNIWGPFIVVTPASTLHNWVNEISRFVPQFKILPYWGNANDRKTLRK--FWDRKHLRYG 848

Query: 496  KQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLI 555
            +   F+V++T+Y+ ++ D + L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+
Sbjct: 849  RDAPFHVMVTSYQMVVSDASYLQKMKWQYMILDEAQAIKSSQSSRWKTLLSFHCRNRLLL 908

Query: 556  TGTPLQNNIKELAALVNFLMPGR----------FTIDQEIDFENQDEEQEQYIRDLHKRL 605
            TGTP+QNN++EL AL++F+MP            F+ D E   E+  E  ++ +R LH  L
Sbjct: 909  TGTPIQNNMQELWALLHFIMPSLFDSHDEFSDWFSKDIESHAESNTELNQEQLRRLHMVL 968

Query: 606  QPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSALTAGAKGGRFS 662
            +PF+LRR+KK+V+  L  K E  +  +L+  Q + Y   K+ ++  Y A+   A     +
Sbjct: 969  KPFMLRRIKKNVQSELGDKIEIDVLCDLTFRQAKLYQVLKSQVSGGYDAIENAAGNDDVT 1028

Query: 663  ----MLNIMNTLMKASNHPYLFDSAEEKVLEKFG------AGNMSRE 699
                ++N++    K  NHP LF+ A+  V+  F       + ++SRE
Sbjct: 1029 SDQKLVNLVMEFRKVCNHPDLFERAD--VMSPFSFVSFGESASLSRE 1073

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/133 (48%), Positives = 91/133 (68%), Gaps = 1/133 (0%)

Query: 727  HRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLST 786
            HRVLI+ QM +++D++ +YL+ +     RLDG+   + RR  + H      D F+FLLST
Sbjct: 1336 HRVLIYFQMTKMMDLMEEYLTYRQYTHIRLDGSSKLDDRRDLV-HDWQTKPDIFIFLLST 1394

Query: 787  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 846
            RAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYRL+ + T+EE + +
Sbjct: 1395 RAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLIRGTIEERMRD 1454

Query: 847  RARKKMILEYAII 859
            RA++K  ++  ++
Sbjct: 1455 RAKQKEHVQQVVM 1467

>YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the
           Snf2/Rad54 subfamily of NTP-dependent DNA helicases
           [2562 bp, 853 aa]
          Length = 853

 Score =  203 bits (517), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 116/284 (40%), Positives = 164/284 (57%), Gaps = 32/284 (11%)

Query: 382 QPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG 441
           QP  +K   L+ +QL G+NW+  L+    NGILADEMGLGKTVQ++A +++ I+     G
Sbjct: 213 QPRLLKNCILKPYQLEGLNWLITLYENGLNGILADEMGLGKTVQSIALLAF-IYEMDTKG 271

Query: 442 PHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYE-FYSNPKGKGKKQIKF 500
           P LV  PLST+  W+  F K+APD+ V+ Y G    ++   + + F+    G G      
Sbjct: 272 PFLVTAPLSTLDNWMNEFAKFAPDLPVLKYYGTNGYKERSAKLKNFFKQHGGTG------ 325

Query: 501 NVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPL 560
            +++T+YE IL+D   + S  W+FL VDE HRLKN    L + L     +NRLL+TGTPL
Sbjct: 326 -IVITSYEIILRDTDLIMSQNWKFLIVDEGHRLKNINCRLIKELKKINTSNRLLLTGTPL 384

Query: 561 QNNIKELAALVNFLMPGRFTIDQEI-----DFEN----------------QDEEQEQYIR 599
           QNN+ EL +L+NF+MP  F  D EI     DF++                 DE Q+  I 
Sbjct: 385 QNNLAELWSLLNFIMPDIFA-DFEIFNKWFDFDSLNLGSGSNSEALNKLINDELQKNLIS 443

Query: 600 DLHKRLQPFILRRLKKDVEKS-LPSKTERILRVELSDVQTEYYK 642
           +LH  L+PF+LRRLKK V  + LP K E I+   ++  Q ++YK
Sbjct: 444 NLHTILKPFLLRRLKKVVLANILPPKREYIINCPMTSAQEKFYK 487

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 102/161 (63%)

Query: 702 LRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVP 761
           L  L+ +SG              +GH+VLI+SQ V +LD++ D+  +      R+DG+V 
Sbjct: 595 LETLLKTSGKLQILQKLIPPLISEGHKVLIYSQFVNMLDLIEDWCDLNSFATFRIDGSVN 654

Query: 762 SNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAH 821
           +  R+  ++ FN+      +FLLSTRA GLGINL+ ADTV++FDSDWNPQ DLQAM R H
Sbjct: 655 NETRKDQLEKFNSSKDKHNIFLLSTRAAGLGINLVGADTVVLFDSDWNPQVDLQAMDRCH 714

Query: 822 RIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLG 862
           RIGQ++ V+VYRL   +T+E  +L RA  K  LE  +I +G
Sbjct: 715 RIGQESPVIVYRLCCDNTIEHVILTRAANKRNLERMVIQMG 755

>AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH]
           complement(295808..298519) [2712 bp, 903 aa]
          Length = 903

 Score =  196 bits (498), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 137/474 (28%), Positives = 223/474 (47%), Gaps = 53/474 (11%)

Query: 413 ILADEMGLGKTVQTVAFISWLIF---ARRQNGPH--------------LVVVPLSTMPAW 455
           +LADEMGLGKT  T+A I W +     R  + P               LVV P++ +  W
Sbjct: 295 LLADEMGLGKTCMTIALI-WTLLKQHPRPSSVPCSQLGVALQGICQKVLVVCPVTLIGNW 353

Query: 456 IETFEKWAP--DIDVICYMG-NQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILK 512
            + F KW P   I ++     N   +D      F        + Q  + VL+  YE +L 
Sbjct: 354 KKEFIKWLPMNRIGILTLSSKNTPEKDKNDVRNFL-------RVQRTYQVLILGYEKLLN 406

Query: 513 DRAEL--GSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAAL 570
             +EL     K   L  DE HRLKN+ S + + L   ++  ++++TGTP+QN++ E   +
Sbjct: 407 VFSELDQAKSKLDLLICDEGHRLKNSSSKILKCLTDLEIERKVILTGTPIQNDLNEFYTI 466

Query: 571 VNFLMPGRF------------TIDQEIDFENQDEEQ-----EQYIRDLHKRLQPFILRRL 613
           +NF+ PG               I +  D  N+  +Q     E   +DL +  + FILRR 
Sbjct: 467 INFINPGILGTFAHFKRVYITPITRARDVNNKHNDQIVSLGESRSQDLIEITKKFILRRT 526

Query: 614 KKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKA 673
              +   LP +T+ ++  + +  Q + +  +L          +     S L ++    K 
Sbjct: 527 SSIIADYLPPRTDIVVFCKPTQHQLDAFNQVLVGTRVDFQNMSFN---SSLGLITLFKKI 583

Query: 674 SNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFS 733
            N P L  S++     K   G  +   I +                     D  +V++ S
Sbjct: 584 CNSPSLV-SSDSYFQSKVNGGTPALR-IAQSTTSGKLKVLMSLLHQIAHRSDNEKVVVIS 641

Query: 734 QMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGI 793
              + LDI+G+ +S   +++ RLDG+ P+ +R   ++ FN   +  F FLLS ++GG+G+
Sbjct: 642 NYTQTLDIIGNLMSSASLSYLRLDGSTPAKERDAIVNDFNRSQTI-FGFLLSAKSGGVGL 700

Query: 794 NLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLER 847
           NL+ A  +I+FD+DWNP  DLQAM+R HR GQK    +YRLV+   ++E++ +R
Sbjct: 701 NLVGASRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKIFQR 754

>KLLA0F11814g complement(1089699..1092494) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54 required for
           mitotic diploid-specific recombination and repair and
           meiosis, start by similarity
          Length = 931

 Score =  195 bits (496), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 145/487 (29%), Positives = 240/487 (49%), Gaps = 69/487 (14%)

Query: 413 ILADEMGLGKTVQTVAFISWLIFAR-------RQNGPHL--------VVVPLSTMPAWIE 457
           +LADEMGLGKT+ T+  I W +  +        Q G  L        +V P++ +  W +
Sbjct: 317 LLADEMGLGKTLMTITLI-WTLLKQTPYPTIINQRGVTLAGEISKVLIVCPVTLIGNWKK 375

Query: 458 TFEKWAP--DIDVIC-YMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDR 514
            F+KW P   I V+  +  N  + D  +   F   P+        + VL+  YE +L  +
Sbjct: 376 EFKKWLPMNRIGVLTLHSRNSPTEDKAQVRSFLKVPR-------TYQVLIVGYEKLLSIK 428

Query: 515 AELGSIK--WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVN 572
            EL + K     +  DE HRLKN +S + + L S  +  +++++GTP+QN+++E   +++
Sbjct: 429 DELQNEKRNLDLVICDEGHRLKNKDSKILKVLQSLDIEKKIVLSGTPIQNDLEEFYTIID 488

Query: 573 FLMPG------RF------TIDQEIDF---ENQDEEQEQYIRD--LHKRLQPFILRRLKK 615
           F+ PG      RF       I +  D    +NQ   ++  +R   L +  + FILRR  +
Sbjct: 489 FINPGILGSFGRFKREYILPIARSRDVNAKQNQTLVEQGLLRSDQLIEITKRFILRRTNE 548

Query: 616 DVEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGAKGGRFSMLN-IMNTLM 671
            +++ LP +T+ I+  + +  Q E +  ILT+   N+S +T  +  G  ++   I N+  
Sbjct: 549 ILQQYLPPRTDLIIFCKPTAEQVEAFHKILTEGQLNFSNMTFNSSLGLITLFKKICNSTR 608

Query: 672 KASNHPY----LFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGH 727
                PY    L          KF +G +    IL  L+                     
Sbjct: 609 LIKTDPYYEERLSQVQTSSTSGKFTSGKL---RILLSLL------------HELKTKTDE 653

Query: 728 RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTR 787
           +V++ S   + LDI+  + S +G    RLDG+  +  R   +  FN   S  FVFLLS +
Sbjct: 654 KVVVISNYTQTLDIIEGHCSSEGYTSARLDGSTATKTRDQIVTSFNNDPSI-FVFLLSAK 712

Query: 788 AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLER 847
           +GG+G+NL+ A  +++FD+DWNP  DLQAM+R HR GQ+    +YRLV+   ++E++L+R
Sbjct: 713 SGGVGLNLIGASRLVLFDNDWNPSIDLQAMSRIHRDGQRRPCFIYRLVTTGCIDEKILQR 772

Query: 848 ARKKMIL 854
              K+ L
Sbjct: 773 QLMKIAL 779

>YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for
           mitotic diploid-specific recombination and repair and
           for meiosis [2775 bp, 924 aa]
          Length = 924

 Score =  194 bits (492), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 151/478 (31%), Positives = 236/478 (49%), Gaps = 62/478 (12%)

Query: 413 ILADEMGLGKTVQTVAFISWLI----FARR----QNG--------PHLVVVPLSTMPAWI 456
           +LAD+MGLGKT+ ++  I  LI    FA +    Q+G          LVV P++ +  W 
Sbjct: 309 LLADDMGLGKTLMSITLIWTLIRQTPFASKVSCSQSGIPLTGLCKKILVVCPVTLIGNWK 368

Query: 457 ETFEKWA--PDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDR 514
             F KW     I V+  + ++ S D+++        +   K Q  + VL+  YE +L   
Sbjct: 369 REFGKWLNLSRIGVLT-LSSRNSPDMDKMAV-----RNFLKVQRTYQVLIIGYEKLLSVS 422

Query: 515 AELGSIK--WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVN 572
            EL   K     L  DE HRLKN  S +  +L S  +  +LL+TGTP+QN++ E   +++
Sbjct: 423 EELEKNKHLIDMLVCDEGHRLKNGASKILNTLKSLDIRRKLLLTGTPIQNDLNEFFTIID 482

Query: 573 FLMPG----------RFTI--DQEIDFEN--------QDEEQEQYIRDLHKRLQPFILRR 612
           F+ PG          RF I   +  D  N        + EE+ + + ++ KR   FILRR
Sbjct: 483 FINPGILGSFASFKRRFIIPITRARDTANRYNEELLEKGEERSKEMIEITKR---FILRR 539

Query: 613 LKKDVEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGAKGGRFSMLNIMNT 669
               +EK LP KT+ IL  +    Q   +K+IL     ++  LT        S L ++  
Sbjct: 540 TNAILEKYLPPKTDIILFCKPYSQQILAFKDILQGARLDFGQLTFS------SSLGLITL 593

Query: 670 LMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRV 729
           L K  N P L  S  +   +       S+++  R L  S                   +V
Sbjct: 594 LKKVCNSPGLVGS--DPYYKSHIKDTQSQDSYSRSL-NSGKLKVLMTLLEGIRKGTKEKV 650

Query: 730 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAG 789
           ++ S   + LDI+ + +++ G++  RLDG++P+ QR   +  FN      F FLLS ++G
Sbjct: 651 VVVSNYTQTLDIIENLMNMAGMSHCRLDGSIPAKQRDSIVTSFNR-NPAIFGFLLSAKSG 709

Query: 790 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLER 847
           G+G+NL+    +I+FD+DWNP  DLQAM+R HR GQK    +YRLV+   ++E++L+R
Sbjct: 710 GVGLNLVGRSRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKILQR 767

>Kwal_27.10513
          Length = 900

 Score =  191 bits (486), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 137/482 (28%), Positives = 234/482 (48%), Gaps = 57/482 (11%)

Query: 413 ILADEMGLGKTVQTVAFISWLIFAR---------RQNGPHL--------VVVPLSTMPAW 455
           +LADEMGLGKT+ T+  + W +  +          QNG  L        VV P++ +  W
Sbjct: 295 LLADEMGLGKTLMTITLV-WTLLKQTPIPSKANSSQNGISLQGLCNKILVVCPVTLIGNW 353

Query: 456 IETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRA 515
              F KW  +++ I  +      + E++     N     + Q  + VL+  YE +L    
Sbjct: 354 KREFSKWL-NVNRIGILTLSSKSNAEKDKLTVRNFL---RVQRTYQVLVIGYEKLLSVTE 409

Query: 516 EL--GSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNF 573
           EL     K   +  DE HRLKN +S   ++++S +V  ++++TGTP+QN++ E   + +F
Sbjct: 410 ELLEAKSKIDLVICDEGHRLKNGQSKTLKAISSLEVPRKIMLTGTPIQNDLAEFFTIADF 469

Query: 574 L---MPGRFT---------IDQEIDFENQ-----DEEQEQYIRDLHKRLQPFILRRLKKD 616
           L   + G F+         I +  D  N+      E+     ++L +  + F LRR  + 
Sbjct: 470 LNDGILGTFSKFKRDFINPITRARDLNNKHNNLIQEKGRDKTQELIEITKNFTLRRTAET 529

Query: 617 VEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGAKGGRFSMLN-IMNTLMK 672
           + K LPSKT+ +L  + +  Q + ++  L+    ++S LT  +  G  ++   I N+   
Sbjct: 530 ISKFLPSKTDVVLFCKPTSGQLDAFRKTLSAAQLDFSRLTFNSSLGLITLFKKICNSPSL 589

Query: 673 ASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIF 732
            S   Y  ++ +     K  A +  +  +L  L+                     +V+I 
Sbjct: 590 ISQDSYYLETIKPNSEVKISAPDSGKLRVLMALL-----------DNLRKLSPQEKVVIV 638

Query: 733 SQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLG 792
           S   + LDI+ + +    ++F RLDG+  +  R   ++ FN   S  F FLLS ++GG+G
Sbjct: 639 SNYTQTLDIIQNMICSNSLSFTRLDGSTANKDRDKIVNSFNTVPSI-FAFLLSAKSGGMG 697

Query: 793 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 852
           +NL+ A  +I+FD+DWNP  DLQAM+R HR GQK    +YRL++   ++E++ +R   K 
Sbjct: 698 LNLIGASRLILFDNDWNPAIDLQAMSRIHRDGQKRECYIYRLLTTGCIDEKIFQRQLAKT 757

Query: 853 IL 854
            L
Sbjct: 758 SL 759

>Scas_718.40
          Length = 926

 Score =  191 bits (484), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 146/495 (29%), Positives = 238/495 (48%), Gaps = 56/495 (11%)

Query: 413 ILADEMGLGKTVQTVAFISWLI--------FARRQNGPHL--------VVVPLSTMPAWI 456
           +LADEMGLGKT+ T+  I  L+         A  Q+G  L        VV P++ +  W 
Sbjct: 305 LLADEMGLGKTLMTITLIWTLLKQSPSLKNIACSQSGVPLHGLCRKILVVCPVTLIGNWK 364

Query: 457 ETFEKWAPDIDV-ICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRA 515
             F KW     + I  + ++ + ++++     +  K   + Q  F VL+  YE +L    
Sbjct: 365 REFAKWLNLNRIGILTLSSRNTPEMDK-----TAVKNFLRVQRTFQVLVIGYEKLLSVSE 419

Query: 516 ELGSIK--WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNF 573
           EL   +     L  DE HRLKN  S +   L + ++  ++L++GTP+QN++ E   +++F
Sbjct: 420 ELHGSRDLIDLLICDEGHRLKNGSSKVLNVLKNLEIKRKILLSGTPIQNDLNEFYTIIDF 479

Query: 574 LMPG----------RFT--IDQEIDFENQDEEQ-----EQYIRDLHKRLQPFILRRLKKD 616
           L PG          RF   I +  D EN+  E      E   +++    + F LRR    
Sbjct: 480 LNPGILGSYPYFKKRFIAPITRGRDTENRHNEDIIELGEGRSKEMIDITRKFTLRRTNAI 539

Query: 617 VEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGAKGGRFSMLNIMNTLMKA 673
           + K LP KT+ IL  + +  Q   + +IL++   +++ L+  +  G  ++        K 
Sbjct: 540 LSKYLPPKTDIILFCKPTQSQLLAFNDILSRSRIDFANLSFNSSLGLITLFK------KI 593

Query: 674 SNHPYLF--DSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLI 731
            N P L   DS  +  +   G   + +E   R L                   +  +V+I
Sbjct: 594 CNSPTLIGDDSYYQSKIRPDG---VIQERYDRSLNSGKLKILMTLLEKIKGNTNNEKVVI 650

Query: 732 FSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGL 791
            S   + LDI+ + ++   +   RLDG+ P+ QR   ++ FN   S  F FLLS ++GG+
Sbjct: 651 VSNYTQTLDIIQNLMNSAQMVSCRLDGSTPAKQRDSIVNTFNRNPSI-FAFLLSAKSGGV 709

Query: 792 GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKK 851
           G+NL+ A  +I+FD+DWNP  DLQAM+R HR GQK H  +YRL++   ++E++L+R   K
Sbjct: 710 GLNLIGASRLILFDNDWNPSIDLQAMSRIHRDGQKKHCYIYRLITTGCIDEKILQRQLMK 769

Query: 852 MILEYAIISLGVTDG 866
             L    +    T G
Sbjct: 770 HSLSKKFLDSSYTTG 784

>CAGL0M01958g complement(238113..240875) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54, hypothetical
           start
          Length = 920

 Score =  186 bits (471), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 143/501 (28%), Positives = 231/501 (46%), Gaps = 72/501 (14%)

Query: 413 ILADEMGLGKTVQTVAFISWLI----FARRQNGPHL------------VVVPLSTMPAWI 456
           ILAD+MGLGKT+ T+  I  L+    FA +     L            +V P++ +  W 
Sbjct: 311 ILADDMGLGKTLMTITLIWTLLKQTPFASKVQCSQLGVPLSGMISKVVIVCPVTLIGNWK 370

Query: 457 ETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFN----VLMTTYEYILK 512
             F+KW   ++ I  +      +++ +       K   +  IK N    VL+  YE +L 
Sbjct: 371 REFKKWL-GLNRIGILTLNPKNNVDMD-------KISVRNFIKVNRTYQVLILGYEKVLT 422

Query: 513 DRAEL--GSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAAL 570
            + EL     K   L  DE HRLKN  S + + L S  +  ++++TGTP+QN++ E   +
Sbjct: 423 VQEELLKQKDKLDLLICDEGHRLKNGASKILKVLKSLDIDKKVILTGTPIQNDLNEFFTI 482

Query: 571 VNFLMPGRF------------TIDQEIDFEN--------QDEEQEQYIRDLHKRLQPFIL 610
           ++F+ PG               I +  D  N        Q EE+   + +  KR   FIL
Sbjct: 483 IDFVNPGVLGTYASFKKLYINPISRARDINNKFNTKVIEQGEEKSNQLIEFTKR---FIL 539

Query: 611 RRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTL 670
           RR    + K LP KT+ IL    +  Q + +++I+      +          ++N+M  +
Sbjct: 540 RRSNNILSKFLPPKTDIILFCRPTIEQIKAFRDIIENVRVDMNNITFNTSLGLINLMKKV 599

Query: 671 MKA----SNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGXXXXXXXXXXXXXXDG 726
             +     N PY   + +  +   F   N S          SSG                
Sbjct: 600 CNSPSLLCNDPYYQSNVDSNI---FTVSNKSN---------SSGKLTVLLELLLEIKATS 647

Query: 727 --HRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLL 784
              +V+I S   + LDI+   ++   ++  RLDG  P+ QR + ++ FN    + F FLL
Sbjct: 648 PMEKVVIVSNYTQSLDIIQGLMNSNQLSNCRLDGATPAKQRDMLVNTFNN-NPNIFGFLL 706

Query: 785 STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 844
           S +AGG+G+NL+ A  +++FD+DWNP  DLQAM+R HR GQK    +YRL++   ++E++
Sbjct: 707 SAKAGGVGLNLIGASRLVLFDNDWNPAVDLQAMSRIHREGQKRPCYIYRLITTGCIDEKI 766

Query: 845 LERARKKMILEYAIISLGVTD 865
           L+R   K  L    +S   +D
Sbjct: 767 LQRQLMKHNLTRKFLSSNTSD 787

>Kwal_26.7123
          Length = 1081

 Score =  174 bits (440), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 169/328 (51%), Gaps = 52/328 (15%)

Query: 391 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQN---GPHLVVV 447
           L+D+Q TGINW+  L+  N + ILADEMGLGKT Q +AF+S+L    +QN   GPHLVVV
Sbjct: 524 LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL----KQNNEPGPHLVVV 579

Query: 448 PLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTY 507
           P ST+  W+  F K+ PD+ +  Y G+Q+ R   R  +   +  G      +++V++TTY
Sbjct: 580 PSSTLENWLREFNKFCPDLKIEPYYGSQQERAELR--DILEDNDG------QYDVIVTTY 631

Query: 508 EYILKDRAELGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNI 564
                ++ ++  +K   +  +  DE H LKN+ S  +  L   +   RLL+TGTPLQNN+
Sbjct: 632 NLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNL 691

Query: 565 KELAALVNFLMPGRF----------------TIDQEIDFENQDEEQEQYIRDLHKRLQPF 608
           KEL +L+ F+MP  F                T D   D+ N    QE   R     ++PF
Sbjct: 692 KELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDY-NPLLAQEAIAR-AKTMMKPF 749

Query: 609 ILRRLKKDVEKSLPSKTERILRVELSDVQTEYY----------KNILTKNYSALT----- 653
           ILRR K  V K LP K  +I   E+SDVQ   Y          K +L +     +     
Sbjct: 750 ILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLREREEEGSAEEPR 809

Query: 654 -AGAKGGRFSMLNIMNTLMKASNHPYLF 680
                GG     N++ +L KA+ HP LF
Sbjct: 810 PTKKNGGAQISKNLIMSLRKAALHPLLF 837

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 88/133 (66%), Gaps = 5/133 (3%)

Query: 728  RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDF--VFLLS 785
            +VL+FS   ++LDIL   L+   INF RLDG+   N R+  ID F+    DD   VF+LS
Sbjct: 924  KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFH---DDDTIPVFILS 980

Query: 786  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 845
            T+AGG GINL+ A+ VIIFD  +NP  D QA  R+HR+GQ   V +  L++++++EE++L
Sbjct: 981  TKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKIL 1040

Query: 846  ERARKKMILEYAI 858
            + A+ K+ L+  I
Sbjct: 1041 QLAKNKLALDTYI 1053

>Sklu_1582.2 , Contig c1582 197-1048
          Length = 283

 Score =  148 bits (374), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/161 (47%), Positives = 100/161 (62%), Gaps = 3/161 (1%)

Query: 705 LIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQ 764
           L+ +SG              +GH+VLIFSQ V +LD++ D+  +      R+DG++ +  
Sbjct: 29  LLQTSGKLQILQQLVPKLINEGHKVLIFSQFVNMLDLIEDWCELNDFQACRIDGSMDNEV 88

Query: 765 RRIAIDHFNAPGSDDF---VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAH 821
           R+  I  FN+  +D     VFLLSTRAGGLGINL  AD+V+IFDSDWNPQ DLQAM R H
Sbjct: 89  RQEQIGKFNSKTTDSHANDVFLLSTRAGGLGINLTAADSVVIFDSDWNPQVDLQAMDRTH 148

Query: 822 RIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLG 862
           RIGQ   V+VYRL   +TVE  +L RA  K  LE  +I +G
Sbjct: 149 RIGQDRPVIVYRLCCDNTVEHVILTRAVSKRKLEKLVIQMG 189

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 107/212 (50%), Gaps = 21/212 (9%)

Query: 374 PRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDN----GILADEMGLGKTVQTVAF 429
           P++E      P   G +L  FQL G++WM    S+ D+    G+LADEMG+GKT+QT+A 
Sbjct: 208 PKYEPHRAPQPADMGVKLLPFQLEGLHWM---LSQEDSIYNGGVLADEMGMGKTIQTIA- 263

Query: 430 ISWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPD-IDVICYMGNQKS------RDIER 482
              L+   R   P LVV P   +  W    E+     +    Y G  ++      +DI+ 
Sbjct: 264 ---LLMNDRSKKPSLVVAPTVALMQWKNEIEQHTNGALSTYIYHGASRTINIHDLKDIDV 320

Query: 483 EYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYE 542
               YS  +   +KQ   N        ++K+++ L +I +    +DEAH +K+  S+   
Sbjct: 321 ILTTYSVLESVFRKQ---NYGFRRKNGLVKEKSLLHNIDFYRAILDEAHNIKDRTSNTSR 377

Query: 543 SLNSFKVANRLLITGTPLQNNIKELAALVNFL 574
           ++N+ K   R  ++GTPLQN I E+ +L+ FL
Sbjct: 378 AVNALKTQKRWCLSGTPLQNRIGEMYSLIRFL 409

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 70/131 (53%), Gaps = 1/131 (0%)

Query: 730 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAG 789
           ++FSQ   +LD++   L   G    +L G++   QR   I +F     +  VFL+S +AG
Sbjct: 681 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRDQTIKYF-MDNIECEVFLVSLKAG 739

Query: 790 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 849
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + R   +D++E  ++E   
Sbjct: 740 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIEARIIELQE 799

Query: 850 KKMILEYAIIS 860
           KK  + +A I+
Sbjct: 800 KKANMIHATIN 810

>KLLA0C05368g 481598..486415 some similarities with sgd|S0005717
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1605

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 88/147 (59%), Gaps = 3/147 (2%)

Query: 728  RVLIFSQMVRILDILGDYLSIK-GINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLST 786
            +++IFSQ     +ILG ++    G+NF R DG++ S+QR   I+ F    ++  V L+S 
Sbjct: 1448 KLVIFSQFTMFFEILGHFIKKNLGLNFLRYDGSMSSSQRSACIESF-YQDNNYRVMLISM 1506

Query: 787  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 846
            +AG  G+ L  A+ VI+ D  WNP  + QAM R HRI Q+  V V+RL+ K +VE+ ++E
Sbjct: 1507 KAGNSGLTLTCANHVILADPFWNPFVEEQAMDRCHRISQEREVYVHRLLIKMSVEDRIVE 1566

Query: 847  -RARKKMILEYAIISLGVTDGNKYTKK 872
             + +KK ++  A+    + + NK  +K
Sbjct: 1567 LQNKKKTLVNLAMDPTQIREVNKLGRK 1593

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 81/381 (21%), Positives = 155/381 (40%), Gaps = 97/381 (25%)

Query: 395  QLTGINWMAFLW-SKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPH--------LV 445
            Q  G+ W+  +  S    G+LAD+MGLGKTVQ++A +         N P         LV
Sbjct: 923  QRQGLRWLVSMEKSSKRGGLLADDMGLGKTVQSLALL-------MANKPEPKSAIKTTLV 975

Query: 446  VVPLSTMPAWI-ETFEKWAPDIDV--ICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNV 502
            V P++ +  W  E   K   D++V  + + G + +    R +          K   ++++
Sbjct: 976  VAPVAVLRVWKDEVAVKIKKDVNVKVVIFGGGENNSSKFRSW----------KDLAEYDI 1025

Query: 503  LMTTYEYILKDRAELGSIKWQ-------------------------------------FL 525
            ++ +Y+ +  +  +   + W+                                      +
Sbjct: 1026 VLVSYQTLASEFKKHWPLSWKNGEHQPDVHAVDLKLMNQVKSSDEYFSPFYRNDSEFYRV 1085

Query: 526  AVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL-MP-----GRF 579
             +DEA  +KN ++   ++  +     R  ++GTP+QNNI EL +L+ FL +P      +F
Sbjct: 1086 ILDEAQNIKNKKTQAAKACCTISSTFRWALSGTPIQNNIGELYSLIRFLRIPPYNKEAKF 1145

Query: 580  ------TIDQEIDFENQDEEQEQYIRDLHKRLQPFILRRLKKDVEKS-----LPSKTERI 628
                   ++ +  ++  D E+++ ++ +   L+  +LRR K           LP K  + 
Sbjct: 1146 HSDIGAVLNTKKPYDYNDSERQRAMKKVQVLLRAIMLRRTKTSQIDGKPILQLPEKHLKE 1205

Query: 629  LRVELSDVQTEYYKNILTKNY----SALTAGAKGGRF-SMLNIMNTLMKASNHPYLFDSA 683
               +L   + E+Y+ + +K+       L +  K G + S+L ++  L +A  H  L    
Sbjct: 1206 SANKLEGDELEFYQALESKSRDKAKKMLESKQKQGAYSSILTLLLRLRQACLHSELV--- 1262

Query: 684  EEKVLEKFGAGNMSRENILRG 704
                  K G  N     I+ G
Sbjct: 1263 ------KIGESNAKSSKIING 1277

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
           (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/222 (29%), Positives = 106/222 (47%), Gaps = 41/222 (18%)

Query: 374 PRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKND---NGILADEMGLGKTVQTVAFI 430
           P ++ +    P      L  FQL G++WMA L   N+    G+LADEMG+GKTVQ    I
Sbjct: 125 PAYKPIRAAQPAGLTVPLLPFQLEGLHWMA-LQENNERYRGGVLADEMGMGKTVQ---MI 180

Query: 431 SWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNP 490
           S L+ A +  GP LVV P   +  W    +K         Y G        R   F+   
Sbjct: 181 SLLLHANK--GPTLVVAPTVALIQWKNEIDK---------YTGGAL-----RSLVFHGPG 224

Query: 491 KGKGKKQIKF-NVLMTTYEY-----------------ILKDRAELGSIKWQFLAVDEAHR 532
           +    +++   +V++TTY                   ++++++ L ++ +  + +DEAH 
Sbjct: 225 RSAVSEELAAADVVLTTYAVLESVYRKQTQGFRRKAGVVREQSPLHAVDFYRVVLDEAHN 284

Query: 533 LKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL 574
           +K+  S    S+N+ +   R  +TGTPLQN I E+ +L+ FL
Sbjct: 285 IKDRSSGTARSVNALRAVRRWCLTGTPLQNRIGEMYSLIRFL 326

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 74/137 (54%), Gaps = 3/137 (2%)

Query: 730 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAG 789
           ++FSQ   +LD++   L   G    +L G++   QR   I++F      + VFL+S +AG
Sbjct: 597 IVFSQFTSMLDLVEWRLKRAGFQTAKLQGSMTPTQRAETINYFMDNVHCE-VFLVSLKAG 655

Query: 790 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 849
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + R   +D++E  ++E   
Sbjct: 656 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQHRPVKITRFCIEDSIESRIIELQE 715

Query: 850 KKMILEYAIISLGVTDG 866
           KK  + +A  +LG  +G
Sbjct: 716 KKANMIHA--TLGQDEG 730

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 104/199 (52%), Gaps = 17/199 (8%)

Query: 391 LRDFQLTGINWMAFLWSKNDNG-ILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPL 449
           L  FQL G++W+      + NG +LADEMG+GKT+QT+A    L+ +     P LVV P 
Sbjct: 194 LLPFQLEGLHWLQQQEESDYNGGVLADEMGMGKTIQTIA----LLMSDITRKPSLVVAPT 249

Query: 450 STMPAWIETFEKWA-PDIDVICYMGNQKS------RDIEREYEFYSNPKGKGKKQI-KFN 501
             +  W    E+     + V  Y G  ++      +D++     Y+  +   +KQ+  F 
Sbjct: 250 VALMQWKNEIEQHTNKKLSVYMYHGANRTNNLGDFKDVDVILTTYAVLESVYRKQVYGFK 309

Query: 502 VLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 561
               T    +K+++ L SI +  + +DEAH +K+  S+  +++NS +   R  ++GTPLQ
Sbjct: 310 RKAGT----VKEKSLLHSINFYRVILDEAHNIKDRTSNTAKAVNSLQTKKRWCLSGTPLQ 365

Query: 562 NNIKELAALVNFLMPGRFT 580
           N I E+ +L+ FL    FT
Sbjct: 366 NRIGEMYSLIRFLNIEPFT 384

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 70/131 (53%), Gaps = 1/131 (0%)

Query: 730 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAG 789
           ++FSQ   +LD++   L   G    +L G++   QR   I +F      + VFL+S +AG
Sbjct: 651 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYFMENIHCE-VFLVSLKAG 709

Query: 790 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 849
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + R   +D++E  ++E   
Sbjct: 710 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQFRPVKITRFCIEDSIESRIIELQE 769

Query: 850 KKMILEYAIIS 860
           KK  + +A I+
Sbjct: 770 KKASMIHATIN 780

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 109/239 (45%), Gaps = 52/239 (21%)

Query: 373 RPRFEKLSVQPPFIKGG---------ELRDFQLTGINWMAFLWSKNDN----GILADEMG 419
           R  F  L   PP++            +L  FQL G++W   L S+ ++    G+LADEMG
Sbjct: 157 RNVFTDLKNAPPYVPQRSKQPDGMTIKLLPFQLEGLHW---LISQEESIYAGGVLADEMG 213

Query: 420 LGKTVQTVAFISWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAP-DIDVICYMGNQKSR 478
           +GKT+QT+A    L+       P LVV P   +  W    E+     + +  Y G  ++ 
Sbjct: 214 MGKTIQTIA----LLMNDLTKSPSLVVAPTVALMQWKNEIEQHTKGQLKIYIYHGASRTT 269

Query: 479 DIEREYEFYSNPKGKGKKQIKFNVLMTTYEYI-----------------LKDRAELGSIK 521
           DI              K    ++V++TTY  +                  K  + L +I 
Sbjct: 270 DI--------------KDLQGYDVVLTTYAVLESVFRKQNYGFRRKNGLFKQPSVLHNID 315

Query: 522 WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFT 580
           +  + +DEAH +K+ +S+   ++N+ K   R  ++GTPLQN I E+ +L+ FL    FT
Sbjct: 316 FYRVILDEAHNIKDRQSNTARAVNNLKTQKRWCLSGTPLQNRIGEMYSLIRFLNINPFT 374

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 70/131 (53%), Gaps = 1/131 (0%)

Query: 730 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAG 789
           ++FSQ   +LD++   L   G    +L G++   QR   I +F      + VFL+S +AG
Sbjct: 641 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRDETIKYFMNNIQCE-VFLVSLKAG 699

Query: 790 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 849
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + R   +D++E  ++E   
Sbjct: 700 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIEARIIELQE 759

Query: 850 KKMILEYAIIS 860
           KK  + +A I+
Sbjct: 760 KKANMIHATIN 770

>Scas_591.10
          Length = 772

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 111/234 (47%), Gaps = 56/234 (23%)

Query: 366 SSNYTSER-PRFEKLSVQPPFIKGGELRDFQLTGINWMA------FLWSKNDNGILADEM 418
           SS Y + R P+ E +S++        L  FQL G++W+       F       G+LADEM
Sbjct: 148 SSPYVAIRAPQPEGMSIK--------LLPFQLEGLHWLIQQEEGIF-----KGGVLADEM 194

Query: 419 GLGKTVQTVAFISWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSR 478
           G+GKT+QT+A    L+       P LVV P   +  W                  NQ + 
Sbjct: 195 GMGKTIQTIA----LLMNDLTKRPSLVVAPTVALMQWKNEI--------------NQHTD 236

Query: 479 DIEREYEFYSNPKGKGKKQI-KFNVLMTTYEY-----------------ILKDRAELGSI 520
              + Y F+   K    K + +++V++TTY                   ++K+ + L +I
Sbjct: 237 GKLKVYMFHGTSKNIDIKTLSEYDVVLTTYAVLESVFRKQNYGFKRKHGVVKELSVLHNI 296

Query: 521 KWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL 574
           ++  + +DEAH +K+ +S+   ++N+ K   R  +TGTPLQN I E+ +L+ FL
Sbjct: 297 EFYRVILDEAHNIKDRQSNTARAVNNLKTQKRWCLTGTPLQNRIGEMYSLIRFL 350

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 70/131 (53%), Gaps = 1/131 (0%)

Query: 730 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAG 789
           ++FSQ   +LD++   L   G    +L G++   QR   I +F     +  VFL+S +AG
Sbjct: 623 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRDETIKYF-MNNIECEVFLVSLKAG 681

Query: 790 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 849
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + R   +D++E  ++E   
Sbjct: 682 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQFRPVKITRFCIEDSIESRIIELQE 741

Query: 850 KKMILEYAIIS 860
           KK  + +A I+
Sbjct: 742 KKANMIHATIN 752

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 81/133 (60%), Gaps = 3/133 (2%)

Query: 728  RVLIFSQMVRILDILGDYLS-IKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLST 786
            ++++FSQ     DIL  ++  +  +++ R DGT+  N R   I+ F     ++ + L+S 
Sbjct: 1420 KLIVFSQFTTFFDILQFFIKKVLNVSYLRYDGTMNGNVRASVIERFYRE-KNERLLLISM 1478

Query: 787  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 846
            +AG  G+ L  A+ VI+ D  WNP  + QAM R +RI Q+  V ++RL+ K+T+E+ ++E
Sbjct: 1479 KAGNSGLTLTCANHVILVDPFWNPYVEEQAMDRCYRISQQREVYIHRLLLKNTIEDRIVE 1538

Query: 847  -RARKKMILEYAI 858
             + RK+ ++E A+
Sbjct: 1539 LQNRKRTLVENAM 1551

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 112/276 (40%), Gaps = 70/276 (25%)

Query: 395  QLTGINWMAFL-WSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPLSTMP 453
            Q  G+ W+     SK   G+LAD+MGLGKTVQ +A +     A      +LVV P++ + 
Sbjct: 900  QRQGLYWLLKTESSKFKGGLLADDMGLGKTVQAIALMLANRSADSTCKTNLVVGPVAVLR 959

Query: 454  AW---IETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTYEYI 510
             W   I T  K      V+ Y G            F        K    ++V++ +Y+ +
Sbjct: 960  VWHDEINTKVKKQAQFSVMIYGG------------FGGKKVENFKAMHNYDVVLVSYQTL 1007

Query: 511  LKD------------------RAELGSIK-----------WQ-FLA---------VDEAH 531
              +                    E+ SIK           W  F +         +DEA 
Sbjct: 1008 AVEFKKHWPARLQGTSENGGQLPEVASIKAMNSMKLRNEYWSPFFSDDSNFYRIILDEAQ 1067

Query: 532  RLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI------ 585
             +KN ++   ++  +     R  ++GTP+QNNI EL +L+ FL    +  +Q+       
Sbjct: 1068 NIKNKQTQAAKACCTLNGTYRWALSGTPIQNNILELYSLLRFLRIAPYNREQKFKEDIGN 1127

Query: 586  -------DFENQDEEQEQYIRDLHKRLQPFILRRLK 614
                   DF++ D ++   ++ +   L+  +LRR K
Sbjct: 1128 ALLSRGGDFDSMDTKRA--LKKVRVLLRAIMLRRAK 1161

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 94/357 (26%), Positives = 152/357 (42%), Gaps = 80/357 (22%)

Query: 395  QLTGINWMAFL-WSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG----PHLVVVPL 449
            Q  G+ W+     SK   G+LAD+MGLGKTVQ +A    L+ A R +      +L+V P+
Sbjct: 737  QRLGLQWLLNAETSKRKGGLLADDMGLGKTVQAIA----LMLANRSSNESKKTNLIVAPV 792

Query: 450  STMPAW---IETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTT 506
            S +  W   IET  K + D +   Y G    +   R ++  SN          F+V++ +
Sbjct: 793  SVLRVWKGEIETKIKESSDFNSAIYGGVNGIK--FRSWDKLSN----------FDVILVS 840

Query: 507  YEYI---------------------LKDRAELGSIK-----WQ----------FLAVDEA 530
            Y+ +                     + D   + S+K     W            + +DE 
Sbjct: 841  YQTLANELKKHWPERLKTDSKQLPPVPDIKAMNSLKTKNEYWSPFYSDDSTFYRIILDEG 900

Query: 531  HRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL-MPG-----RFTIDQE 584
              +KN ++   ++  +     R +++GTP+QNN++EL +L+ FL +P      RF  D  
Sbjct: 901  QNIKNMKTQAAKACCTVNSVYRWILSGTPIQNNMEELYSLIRFLRIPPYNRHERFQQDIG 960

Query: 585  IDFEN-----QDEEQEQYIRDLHKRLQPFILRRLKKDVEKS-----LPSKTERILRVELS 634
              F N       E ++Q I+ +   L+  +LRR K D         LP K          
Sbjct: 961  RPFSNLKQNYDSESRKQAIKKVRVLLRAIMLRRSKTDKIDGVPILELPPKNVNAQETTFK 1020

Query: 635  DVQTEYYKNILTKNYS----ALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKV 687
            D + E+YK +  KN       L +  +G   S+L ++  L +A  HP L    E+K 
Sbjct: 1021 DDELEFYKALEHKNKQLAKKLLESKVQGNYSSVLTLLLRLRQACCHPELVILGEKKA 1077

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 80/146 (54%), Gaps = 3/146 (2%)

Query: 725  DGHRVLIFSQMVRILDILGDYLSIK-GINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFL 783
            D  +++IFSQ    LD+L   L+ +  I+  +  G + +  R   I  F +   D  V L
Sbjct: 1249 DSEKIIIFSQFTTFLDLLEHILATRLKISCLKYTGDMNAKVRSEIISRFYSE-EDKRVLL 1307

Query: 784  LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEE 843
            +S +AG  G+ L  A+ V+I D  WNP  + QA  R +RI Q   V V+RL  K++VE+ 
Sbjct: 1308 ISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTREVTVHRLFIKNSVEDR 1367

Query: 844  VLERAR-KKMILEYAIISLGVTDGNK 868
            +LE  + K+ +++ A+ +  + D NK
Sbjct: 1368 ILELQKLKRDMVDAAMDAKKIKDINK 1393

>Kwal_14.1868
          Length = 1357

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 71/125 (56%), Gaps = 2/125 (1%)

Query: 728  RVLIFSQMVRILDILGDYLSIK-GINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLST 786
            ++++FSQ     D+L  ++    G  + R DG++ S  R   I+ F     +  + L+S 
Sbjct: 1196 KIIVFSQFTTFFDLLQHFIRKDLGAQYLRYDGSMDSQSRAATIEEFYR-SLERRILLISM 1254

Query: 787  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 846
            +AG  G+ L  A+ VI+ D  WNP  + QAM R +RI Q   V V+RL+ K++VE+ +LE
Sbjct: 1255 KAGNAGLTLTCANHVILIDPFWNPFVEEQAMDRCYRISQTRDVQVHRLLVKNSVEDRILE 1314

Query: 847  RARKK 851
              +KK
Sbjct: 1315 LQKKK 1319

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 86/360 (23%), Positives = 153/360 (42%), Gaps = 78/360 (21%)

Query: 391  LRDFQLTGINWMAFLWSKN-DNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPL 449
            L   Q  G++W+  +   N   G+LAD+MGLGKTVQ +A +            +L+V P+
Sbjct: 675  LMKHQRQGLHWLLTVEKSNRKGGLLADDMGLGKTVQAIALMLANKSGVENCKTNLIVAPV 734

Query: 450  STMPAW---IETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTT 506
            + +  W   ++T  K    + V+ Y G   ++      E Y       +  ++ +V++ +
Sbjct: 735  AVLRVWQAEVKTKVKKTSGLKVLIYGGGNGAK-----VENY-------RSLLRHDVVLVS 782

Query: 507  YEYI--------------------------------LKDRAELGS------IKWQFLAVD 528
            Y+ +                                LK+R E  S       K+  + +D
Sbjct: 783  YQTLASELKKHWPARLSEDSEEAKITDIPDLKALNSLKERKEYWSPFYCNESKFYRIILD 842

Query: 529  EAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI--- 585
            EA  +KN ++   ++  +     R  ++GTP+QNNI EL +L+ FL    +  +Q+    
Sbjct: 843  EAQNIKNKKTQSAKACCTLDATYRWALSGTPMQNNIMELYSLIRFLKISPYKREQKFKLD 902

Query: 586  ----------DFENQDEEQEQYIRDLHKRLQPFILRRLK--KDVEKSLPSKTERILRVE- 632
                      D+++ D  ++Q I+ +   L+  +LRR K  K   K +    E+I+    
Sbjct: 903  IGNPLGKATNDYDSHD--RQQAIKKVQVLLRAIMLRRTKDSKIDGKPILELPEKIITNRE 960

Query: 633  --LSDVQTEYYKNILTKNYSA----LTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEK 686
              L   + ++Y ++  KN       L   AKG   S+L ++  L +A  HP L    E K
Sbjct: 961  DVLQGAELQFYSDLEAKNQKKVEKLLNNRAKGSYSSILTLLLRLRQACCHPELVIIGERK 1020

>Kwal_23.3660
          Length = 768

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 94/206 (45%), Gaps = 9/206 (4%)

Query: 662 SMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGN-----MSRENILRGLIMSSGXXXXXX 716
           S L  +  L     H  L     +  LE  G+GN     +SR NI +G   SS       
Sbjct: 545 SFLENLEKLTCPVCHIALSIDLSQPALEFAGSGNKKQSIVSRLNI-QGSWRSSTKIEALV 603

Query: 717 XXXXXXXXDGHRV--LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNA 774
                   D   +  ++FSQ   +LD++   L   G    +L G++   QR   I +F  
Sbjct: 604 EELYNLRSDRRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYF-M 662

Query: 775 PGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRL 834
             +   VFL+S +AGG+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + R 
Sbjct: 663 DNTHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRF 722

Query: 835 VSKDTVEEEVLERARKKMILEYAIIS 860
             +D++E  ++E   KK  + +A I+
Sbjct: 723 CIEDSIESRIIELQEKKANMIHATIN 748

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 99/204 (48%), Gaps = 37/204 (18%)

Query: 390 ELRDFQLTGINWM-AFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVP 448
           +L  FQL G++W+ +   S  + G+LADEMG+GKT+QT+A    L+       P LVV P
Sbjct: 161 KLLPFQLEGLHWLISQEHSVYNGGVLADEMGMGKTIQTIA----LLMNDVTKKPSLVVAP 216

Query: 449 LSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIK-FNVLMTTY 507
              +  W    E+         + G +    I     F+   +     + K  +VL+TTY
Sbjct: 217 TVALMQWKNEIEQ---------HTGGKLKTHI-----FHGANRTSNVGEFKDVDVLLTTY 262

Query: 508 EY-----------------ILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVA 550
                              + K+ + L ++ +  + +DEAH +K+ +S+  +++NS    
Sbjct: 263 AVLESVFRKQNYGFKRKSGVYKEPSVLHNMNFYRVILDEAHNIKDRQSNTAKAVNSLLTE 322

Query: 551 NRLLITGTPLQNNIKELAALVNFL 574
            +  +TGTPLQN I E+ +L+ FL
Sbjct: 323 KKWCLTGTPLQNRIGEMYSLIRFL 346

>Scas_721.100
          Length = 1137

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (53%), Gaps = 6/136 (4%)

Query: 726  GHRVLIFSQMVRILDILGDYLS----IKGINFQRLDGTVPSNQRRIAIDHFNAPG-SDDF 780
            G +V+IFSQ    LDIL D L            + DG +   +R   +  F     S   
Sbjct: 980  GEQVVIFSQFSSYLDILEDELKEAFPTDVAKIYKFDGRLSLKERSTVLQDFQIKDLSRQK 1039

Query: 781  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 840
            + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N+V V R + ++++
Sbjct: 1040 ILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRIHRIGQTNNVKVVRFIIENSI 1099

Query: 841  EEEVLE-RARKKMILE 855
            EE++L  + RK+ I E
Sbjct: 1100 EEKMLRIQERKRTIGE 1115

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 132/303 (43%), Gaps = 68/303 (22%)

Query: 412 GILADEMGLGKTVQTVAFISWLIFAR---------------RQNGPHL---------VVV 447
           GIL+DEMGLGKT+ T+A I    +                 R+  PHL         +VV
Sbjct: 502 GILSDEMGLGKTISTLALILSCPYDSEVVDKKLFKGEEDDIRETQPHLKPYASKTTLIVV 561

Query: 448 PLSTMPAWIETFEKWAPDIDV---ICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLM 504
           P+S +  W   F K     D+   I Y GN  S  +++      NP           V++
Sbjct: 562 PMSLLNQWNTEFNKANNSSDMRSEIYYGGNVSS--LKKLLTKTHNPP---------TVVI 610

Query: 505 TTYEYI----------------LKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFK 548
           TTY  +                ++  + L S+ +  + +DE H ++N  +   +++    
Sbjct: 611 TTYGIVQSEWSKIFKKQNIGAEIQSSSGLFSVDFYRIVIDEGHTIRNRTTLTSKAIMDLT 670

Query: 549 VANRLLITGTPLQNNIKELAALVNFL------MPGRFTIDQEIDFENQDEEQEQYIRDLH 602
              + ++TGTP+ N + +L +LV FL        G + +     FEN++ +Q   +  ++
Sbjct: 671 SKCKWVLTGTPIINRLDDLYSLVRFLKLEPWSQIGYWKMFVSTPFENKNFKQAFDV--VN 728

Query: 603 KRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGA 656
             L+P +LRR K  KD++      LP K   + R++LS  Q   YK +L +   ++  G 
Sbjct: 729 AILEPVLLRRTKQMKDIDGKPLVELPPKEVIVERLKLSKAQNAVYKYLLDRAEQSVILGL 788

Query: 657 KGG 659
             G
Sbjct: 789 ARG 791

>Scas_674.12d
          Length = 1323

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 2/128 (1%)

Query: 725  DGHRVLIFSQMVRILDILGDYL-SIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFL 783
            D  +++IFSQ     DI   +L  +  + + +  G + + QR   I  F    +++ + L
Sbjct: 1164 DTEKIIIFSQFTSFFDIFQHFLEKLLKVPYLKYTGAMTAQQRADVITKF-YRQANERILL 1222

Query: 784  LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEE 843
            +S +AG  G+ L  A+ VII D  WNP  + QA  R +RI Q   V V+RL  KD+VE+ 
Sbjct: 1223 ISMKAGNSGLTLTCANHVIIVDPFWNPYVEEQAQDRCYRISQTREVHVHRLFIKDSVEDR 1282

Query: 844  VLERARKK 851
            + E   KK
Sbjct: 1283 IAELQEKK 1290

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 93/344 (27%), Positives = 145/344 (42%), Gaps = 58/344 (16%)

Query: 395 QLTGINWMAFL-WSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNG----PHLVVVPL 449
           Q  G++W+  +  SK   G+LAD+MGLGKTVQ +A    L+ A R        +L+V P+
Sbjct: 654 QKIGLHWLLNVEASKKKGGLLADDMGLGKTVQGIA----LMLANRSKDQACKTNLIVAPV 709

Query: 450 STMPAW---IETFEKWAPDIDVICYMGNQKSRDIEREYEF----YSNPK----------- 491
           + +  W   +ET  K   +     Y G  K    +   E+     S P            
Sbjct: 710 AVLRVWGGELETKIKKEANFSAFIYGGGDKLATWKELSEYDAIMVSYPTLAIEFKKHWPA 769

Query: 492 --GKGKKQI-------KFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYE 542
             GK +KQ+         N L    EY         +  +  + +DE   +KN ++   +
Sbjct: 770 SLGKDQKQLPAIPQLAAMNSLKKKDEYFSPFFCNEST--FYRIILDEGQNIKNKKTRAAK 827

Query: 543 SLNSFKVANRLLITGTPLQNNIKELAALVNFL-MPG-----RFTIDQEIDFENQ-----D 591
           +  S     R + +GTP+QN++ EL +L+ FL +P      RF  D    F  +     D
Sbjct: 828 ACCSLDATYRWVFSGTPIQNSMDELYSLIRFLRIPPYHREERFMADIGRPFLRKNGNYDD 887

Query: 592 EEQEQYIRDLHKRLQPFILRRLKKDVEKS-----LPSKTERILRVELSDVQTEYYKNILT 646
            +++Q I+ +   L   +LRR K D+        LP K   I    L   + E+Y ++  
Sbjct: 888 FDRKQAIKKVQVLLSAIMLRRSKSDMIDGKPLLELPPKQIEIDSAALEGDELEFYTDLEA 947

Query: 647 KNYS----ALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEK 686
           KN       L   AKG   S+L ++  L +A  H  L    E K
Sbjct: 948 KNRKLAERLLKRKAKGNYSSVLTLLLRLRQACVHSELVLIGERK 991

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
            cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 71/138 (51%), Gaps = 5/138 (3%)

Query: 726  GHRVLIFSQMVRILDILGDYL----SIKGINFQRLDGTVPSNQRRIAIDHFNAPG-SDDF 780
            G +V++FSQ    LDIL   L    S   +   + DG +   +R   ++ F     +   
Sbjct: 993  GEQVVVFSQFSSYLDILESQLNEVYSSNKLKVYKFDGRLSLKERTAVLEDFKVKDYAVQK 1052

Query: 781  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 840
            V LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N V V R V   ++
Sbjct: 1053 VLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIHRIGQTNSVKVIRFVIDGSI 1112

Query: 841  EEEVLERARKKMILEYAI 858
            EE++L    +K  L  A+
Sbjct: 1113 EEKMLRIQDRKRTLGEAM 1130

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 74/314 (23%), Positives = 133/314 (42%), Gaps = 75/314 (23%)

Query: 407 SKNDNGILADEMGLGKTVQTVAFI----------SWLIFARRQNG--------------- 441
           S  + GIL+DEMGLGKT+  ++ +          S  +F +  +                
Sbjct: 504 SFKNGGILSDEMGLGKTISALSLVLMRPKDEHTTSQSLFHQESSNLSSDDVIEIKEPERS 563

Query: 442 ----PHLVVVPLSTMPAWIETFEKWAPDIDVIC---YMGN---QKSRDIEREYEFYSNPK 491
                 L++VP+S +  W + F+K   +  + C   Y GN    KS  I+R+     NP 
Sbjct: 564 YAYKTTLIIVPMSLLTQWRDEFDKVNNNAGLTCELYYGGNVSSLKSLLIKRK-----NPP 618

Query: 492 GKGKKQIKFNVLMTTYEYILKDRAELG----------------SIKWQFLAVDEAHRLKN 535
                     V++TTY  +  +  +L                 SI++  + +DE H ++N
Sbjct: 619 ---------TVVLTTYGIVQNEWTKLSKDGTNIRSLGRTSGIFSIEFFRIILDEGHTIRN 669

Query: 536 AESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFT----IDQEIDFENQD 591
             +   +++       R ++TGTP+ N + +L +LV FL    ++      Q I    ++
Sbjct: 670 KSTITSKAVLELSSKYRWILTGTPIINRLDDLYSLVKFLKLEPWSQIGYWKQFITNPFEE 729

Query: 592 EEQEQYIRDLHKRLQPFILRRLK--KDVEKS----LPSKTERILRVELSDVQTEYYKNIL 645
              +Q    ++  ++P +LRR K  KD + +    LP K   I +++LS  Q   Y+  L
Sbjct: 730 RNFKQAFDVVNAIMEPVLLRRTKQMKDTDGNPLVQLPPKEIVIEKLQLSKKQKLIYEEFL 789

Query: 646 TKNYSALTAGAKGG 659
            +      +G + G
Sbjct: 790 QRAEKTFRSGLQSG 803

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
            DNA-dependent ATPase of the Snf2p family of DNA
            helicases, member of the RAD6 epistasis group, involved
            in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 71/138 (51%), Gaps = 5/138 (3%)

Query: 726  GHRVLIFSQMVRILDILGDYL----SIKGINFQRLDGTVPSNQRRIAIDHFNAPG-SDDF 780
            G +V+IFSQ    LDIL   L    S       + DG +   +R   +  F     S   
Sbjct: 1012 GEQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRLSLKERTSVLADFAVKDYSRQK 1071

Query: 781  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 840
            + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N V V R + +D++
Sbjct: 1072 ILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRLHRIGQTNSVKVMRFIIQDSI 1131

Query: 841  EEEVLERARKKMILEYAI 858
            EE++L    KK  +  A+
Sbjct: 1132 EEKMLRIQEKKRTIGEAM 1149

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 84/337 (24%), Positives = 138/337 (40%), Gaps = 74/337 (21%)

Query: 412 GILADEMGLGKTVQTVAFISWL----------IF-----ARRQNGPH------------- 443
           GIL+DEMGLGKTV   + +             +F     A   N P              
Sbjct: 528 GILSDEMGLGKTVAAYSLVLSCPHDSDVVDKKLFDIENTAVSDNLPSTWQDNKKPYASKT 587

Query: 444 -LVVVPLSTMPAWIETFEKW--APDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKF 500
            L+VVP+S +  W   F K   +PD+    Y G   S          S      K +   
Sbjct: 588 TLIVVPMSLLTQWSNEFTKANNSPDMYHEVYYGGNVS----------SLKTLLTKTKTPP 637

Query: 501 NVLMTTYEYILKD----------------RAELGSIKWQFLAVDEAHRLKNAESSLYESL 544
            V++TTY  +  +                 + L S+ +  + +DE H ++N  +   +++
Sbjct: 638 TVVLTTYGIVQNEWTKHSKGRMTDEDVNISSGLFSVNFYRIIIDEGHNIRNRTTVTSKAV 697

Query: 545 NSFKVANRLLITGTPLQNNIKELAALVNFLM--PGRFTIDQEIDFENQDEEQEQYIRD-- 600
            + +   + ++TGTP+ N + +L +LV FL   P R  I+    F +   E + Y +   
Sbjct: 698 MALQGKCKWVLTGTPIINRLDDLYSLVKFLELDPWR-QINYWKTFVSTPFESKNYKQAFD 756

Query: 601 -LHKRLQPFILRRLKKDVEK------SLPSKTERILRVELSDVQTEYYKNILTKNYSALT 653
            ++  L+P +LRR K+  +K       LP K   I R+  S  Q   YK +L K   ++ 
Sbjct: 757 VVNAILEPVLLRRTKQMKDKDGKPLVELPPKEVVIKRLPFSKSQDLLYKFLLDKAEVSVK 816

Query: 654 AGAKGGRF-----SMLNIMNTLMKASNHPYLFDSAEE 685
           +G   G       ++L  +  L +   HP L  S +E
Sbjct: 817 SGIARGDLLKKYSTILVHILRLRQVCCHPGLIGSQDE 853

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
            complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 68/129 (52%), Gaps = 5/129 (3%)

Query: 728  RVLIFSQMVRILDILGDYL----SIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDF-VF 782
            +V++FSQ    LDIL + L    +       + DG +   +R   +  F         V 
Sbjct: 930  QVVVFSQFSSYLDILENELRQSFASDICEIYKFDGRLDLKERSNVLAKFTEKSLVKMKVL 989

Query: 783  LLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEE 842
            LLS +AGG+G+NL  A    I D  W+P  + QAM R HRIGQ N V +YR + ++++EE
Sbjct: 990  LLSLKAGGVGLNLTCASHAFIMDPWWSPGMEDQAMDRIHRIGQSNTVKIYRFIVENSIEE 1049

Query: 843  EVLERARKK 851
            ++L    KK
Sbjct: 1050 KMLRIQEKK 1058

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 123/290 (42%), Gaps = 65/290 (22%)

Query: 411 NGILADEMGLGKTVQTVAFISWL------IFARRQNGP---------------------H 443
            GILADEMGLGKT+  +A I+ +      +    Q  P                      
Sbjct: 455 GGILADEMGLGKTISILALITMVPSDTKHLLTTAQEKPPVGHLSLELGISTVKPYTASTT 514

Query: 444 LVVVPLSTMPAWIETFEKWAPDIDVIC---YMGNQKSRDIEREYEFYSNPKGKGKKQ-IK 499
           L+VVP+S +P W   F +      + C   Y GN             SN +    KQ   
Sbjct: 515 LIVVPMSLLPQWRNEFVRVNDGNGLYCEVYYAGN------------VSNLRTLLVKQKSP 562

Query: 500 FNVLMTTYEYILKDRAELG------------SIKWQFLAVDEAHRLKNAESSLYESLNSF 547
            +V++TTY  +  + ++L             S+++  + +DE H ++N  +   +++ + 
Sbjct: 563 PSVVLTTYGVVQTEWSKLQQFDYEASNEGLFSVEFFRIILDEGHNIRNRTTKTSKAVMAL 622

Query: 548 KVANRLLITGTPLQNNIKELAALVNFL-MPGRFTIDQEIDFENQDEEQEQY---IRDLHK 603
               + ++TGTP+ N + +L +L+ F+       ID    F +   E++ Y   +  +  
Sbjct: 623 TSRRKWVLTGTPIMNRLDDLFSLIKFMNFEPWCKIDYWRQFVSDPFEKKDYSSALEVIQA 682

Query: 604 RLQPFILRRLK--KDVEKS----LPSKTERILRVELSDVQTEYYKNILTK 647
            + P +LRR K  KD + +    LP K   I  +  SD +   YK  L+K
Sbjct: 683 VMGPILLRRTKNMKDEDGNPLVQLPPKEVVIEMIRFSDTEAGLYKYFLSK 732

>Kwal_47.17771
          Length = 972

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 69/138 (50%), Gaps = 5/138 (3%)

Query: 726 GHRVLIFSQMVRILDIL----GDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDF- 780
           G ++++FSQ    LDI+        S       + DG +   +R   +  F         
Sbjct: 815 GEQIVVFSQFSSFLDIIETEISSCFSKSTTKVYKFDGRLSMKERSKVLQDFAVKDMTRLK 874

Query: 781 VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 840
           + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N+V V R + + ++
Sbjct: 875 ILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRIHRIGQVNNVKVVRFIIEHSI 934

Query: 841 EEEVLERARKKMILEYAI 858
           EE++L    +K  L  A+
Sbjct: 935 EEKMLRIQERKRTLGEAV 952

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 125/295 (42%), Gaps = 47/295 (15%)

Query: 412 GILADEMGLGKTVQTVAFI------------------------------SWLIFAR-RQN 440
           GILADEMGLGKT+  +A I                               W   ++   +
Sbjct: 336 GILADEMGLGKTISILAMILTVPSDSSYGKEKLREASESPDPEISVLGSQWSGGSKPYAS 395

Query: 441 GPHLVVVPLSTMPAWIETFEKWAPDIDVIC--YMGNQKSRDIEREYEFYSNPK----GKG 494
           G  LVVVP+S +  W + FEK +   +  C  Y G   S       +  S P       G
Sbjct: 396 GTTLVVVPMSLLSQWQQEFEKASSSKEATCEIYYGGNTSSLKSLLTKTKSPPTVLITTYG 455

Query: 495 KKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLL 554
             Q +++ L+     +  D + L S+++  + +DE H ++N  +    SL   K     +
Sbjct: 456 TVQHEWSRLLNKNGQMDTDVSGLFSVEFFRIVIDEGHTIRNRNTRTSRSLMDLKSTRSWI 515

Query: 555 ITGTPLQNNIKELAALVNFLMPGRFT-IDQEIDFENQDEEQEQY---IRDLHKRLQPFIL 610
           +TGTP+ N + +L +LV F+    ++ I     F +   E++ Y      +   L+P IL
Sbjct: 516 LTGTPIINRLDDLYSLVKFMRLEPWSQIGYWKTFVSDPFEKKNYKAAFDIVSSILEPVIL 575

Query: 611 RRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGG 659
           RR K  +DV+      LP K   I +V  +  +   YK  L K  S++  G   G
Sbjct: 576 RRTKGMRDVDGKRLVELPPKEVIIEKVAFNKNEDALYKYFLNKAESSVKEGLDRG 630

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 76/134 (56%), Gaps = 5/134 (3%)

Query: 728  RVLIFSQMVRILDILGDYLSIKGINFQRLD--GTVPSNQRRIAIDHFNAPGSDDFVFLLS 785
            +++IFSQ     +IL  +L  K +NF  L   G++ + +R   I+ F     +  + L+S
Sbjct: 1463 KIIIFSQFTTFFEILEHFLKNK-LNFPYLKYIGSMNAQRRSDVINEF-YRDPEKRILLIS 1520

Query: 786  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 845
             +AG  G+ L  A+ V+I D  WNP  + QA  R +RI Q   V V++L  KD+VE+ + 
Sbjct: 1521 MKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTKKVQVHKLFIKDSVEDRIS 1580

Query: 846  E-RARKKMILEYAI 858
            E + RKK +++ A+
Sbjct: 1581 ELQKRKKEMVDSAM 1594

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 87/348 (25%), Positives = 151/348 (43%), Gaps = 61/348 (17%)

Query: 395  QLTGINWMAFLW-SKNDNGILADEMGLGKTVQTVAFISWLIFARR----QNGPHLVVVPL 449
            Q  G++W+  +  S    G+LAD+MGLGKT+Q +A    L+ A R    +   +L+V P+
Sbjct: 947  QRLGLHWLLQVENSAKKGGLLADDMGLGKTIQAIA----LMLANRSEESKCKTNLIVAPV 1002

Query: 450  STMPAW---IETFEKWAPDIDVICYMGNQKS-----RDIER------EYEFYSN------ 489
            S +  W   +ET  K         + G+        RD+ R       Y+  +N      
Sbjct: 1003 SVLRVWKGELETKVKKRAKFTTFIFGGSGNGKVKHWRDLARYDAVLVSYQTLANEFKKHW 1062

Query: 490  PKGKGKKQIKF---------NVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSL 540
            PK    +Q +          N L T+ EY         S  ++ L +DE   +KN  +  
Sbjct: 1063 PKKLDGEQNQLPAVPHIQALNRLKTSNEYYSPFFCN-DSTFYRIL-LDEGQNIKNKNTRA 1120

Query: 541  YESLNSFKVANRLLITGTPLQNNIKELAALVNFL-MP-----GRFTID------QEIDFE 588
             ++  +     R +++GTP+QN++ EL +L+ FL +P      RF +D      +   ++
Sbjct: 1121 SKACCTINGMYRWVLSGTPIQNSMDELYSLIRFLRIPPYHKEQRFKLDIGRFFQRNKQYQ 1180

Query: 589  NQDEEQEQYIRDLHKRLQPFILRRLKKDVEKS-----LPSKTERILRVELSDVQTEYYKN 643
              +E+++  +R +   L   +LRR K D         LP K   +    L   + ++Y  
Sbjct: 1181 YDNEDRKNALRKVRVLLNAIMLRRSKADKIDGKPLLELPPKIVEVDESRLKGEELKFYTA 1240

Query: 644  ILTKNYS----ALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKV 687
            + +KN +     L    +G   S+L ++  L +A  H  L    E+K 
Sbjct: 1241 LESKNQALAKKLLNNSTRGSYSSVLTLLLRLRQACCHSELVVMGEKKA 1288

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
            Saccharomyces cerevisiae YLR032w RAD5 DNA helicase, start
            by similarity
          Length = 1114

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 72/134 (53%), Gaps = 6/134 (4%)

Query: 726  GHRVLIFSQMVRILDILG----DYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDF- 780
            G ++++FSQ    LDIL      +L    +   + DG +   +R   ++ F+        
Sbjct: 957  GEQIIVFSQFSSFLDILEIELRSHLPRDQVIIYKFDGRLDMKERTRILEQFHDKDLSCIK 1016

Query: 781  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 840
            + LLS + GG+G+NL  A    + D  W+P  + QA+ R HRIGQ+  V V R +  ++V
Sbjct: 1017 LLLLSLKTGGVGLNLTCASRAFMMDPWWSPGMEDQAIDRIHRIGQQQTVKVVRFIIDNSV 1076

Query: 841  EEEVLE-RARKKMI 853
            EE++L  + RK+M+
Sbjct: 1077 EEKMLRIQERKRML 1090

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 135/307 (43%), Gaps = 74/307 (24%)

Query: 410 DNGILADEMGLGKTVQTVAFISWLIF---------------------------ARRQNGP 442
           + GILADEMGLGKT+  +A I    +                            R     
Sbjct: 478 NGGILADEMGLGKTISALALICTASYDEAHEKKIESTKKPSMKEMSSQVDSSPLRHSQHK 537

Query: 443 H--------LVVVPLSTMPAWIETFEKWAPDIDVIC--YMGNQKSRDIEREYEFYSNPKG 492
           H        L+VVP+S +  W   FEK   D+   C  Y GN   +D+ R Y    N   
Sbjct: 538 HDTYAYRTTLIVVPMSLLNQWQSEFEKANKDLKKRCEIYYGNN-IKDL-RAYVLGPNAP- 594

Query: 493 KGKKQIKFNVLMTTY-----EYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSF 547
                   +V++TTY     EY     + L ++ +  + +DE H ++N  +   +++ + 
Sbjct: 595 --------SVIITTYGIIQSEYGRTSTSGLFNVVFFRIILDEGHTIRNRSTRTSKAVIAL 646

Query: 548 KVANRLLITGTPLQNNIKELAALVNFL---------MPGRFTIDQEIDFENQDEEQEQYI 598
           + + + ++TGTP+ N + +L +LV FL            R+     + FE  +  Q   +
Sbjct: 647 RSSRKWILTGTPIINRLDDLFSLVQFLNLEPWSHINYWKRYV---SVPFEKGNYAQAFDV 703

Query: 599 RDLHKRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTKNYSAL 652
             ++  L+P +LRR K  KDV+     SLP K   + +++LS  +   Y+++L    +++
Sbjct: 704 --INAVLEPVLLRRTKNMKDVDGKPLVSLPPKEVIVEKLQLSSSEKRVYQSMLEDAENSV 761

Query: 653 TAG-AKG 658
             G AKG
Sbjct: 762 KEGLAKG 768

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 74/138 (53%), Gaps = 5/138 (3%)

Query: 726  GHRVLIFSQMVRILDILGDYL----SIKGINFQRLDGTVPSNQRRIAIDHF-NAPGSDDF 780
            G +V++FSQ    LDIL + L    S       + DG +    R   +D F     S   
Sbjct: 970  GEQVVVFSQFSSYLDILENELTSSFSKADAKIYKFDGRLNLKDRSRVLDTFATKDLSKLK 1029

Query: 781  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 840
            + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ+++V + R + ++++
Sbjct: 1030 ILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRVHRIGQESNVKIIRFIMENSI 1089

Query: 841  EEEVLERARKKMILEYAI 858
            EE++L    +K  L  A+
Sbjct: 1090 EEKMLSIQDRKRTLGEAV 1107

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 126/291 (43%), Gaps = 67/291 (23%)

Query: 412 GILADEMGLGKTVQTVAFISWLI--------------------FARRQNGPH-----LVV 446
           G+LADEMGLGKT+ T+A IS +                     +  + + P+     L+V
Sbjct: 496 GLLADEMGLGKTISTLAMISMVPCDTDPVEEKNKRENEIGMNDYGYKSDKPYASKTTLIV 555

Query: 447 VPLSTMPAWIETFEKWAPDIDVIC--YMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLM 504
           VP+S +  W + FEK   + +  C  Y G +    I    +  + P           +++
Sbjct: 556 VPMSLLFQWQKEFEKANNNPNAHCEIYYGGRAGNLITLLTKTKNPP----------TIIL 605

Query: 505 TTYEYI--------------LKDRAELGSIKWQF--LAVDEAHRLKNAESSLYESLNSFK 548
           T+Y  I              ++  A +G    +F  + +DE H ++N  +   +++    
Sbjct: 606 TSYGVIQSEWSKLPRCNNNRIEQGAAIGLFSVEFFRIVIDEGHSIRNRTTRTSKAVMDLS 665

Query: 549 VANRLLITGTPLQNNIKELAALVNFL------MPGRFTIDQEIDFENQDEEQEQYIRDLH 602
            + + ++TGTP+ N + +L +LV F+        G +       FE ++ +Q   +  + 
Sbjct: 666 SSRKWVLTGTPIINRLDDLFSLVKFMKLEPWSQIGYWKSFVSGPFEKKNYKQAFDV--VS 723

Query: 603 KRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTK 647
             L+P +LRR K  KD+      +LP K   I +V+ +  +   YK  L K
Sbjct: 724 SVLEPVLLRRTKQMKDINGKPLVTLPLKEIVIEKVKFNTSEDILYKFFLNK 774

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 68/130 (52%), Gaps = 10/130 (7%)

Query: 728  RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIA--IDHFNAPGSDDFVFLLS 785
            ++L++SQ    + ++   LS+  IN    +     N R +   I  F    SD    LL+
Sbjct: 1299 QILMYSQSFDFMKVVSQVLSLHNIN----NICCLQNNRNVGDMIARFKKT-SDITCLLLN 1353

Query: 786  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 845
             R+ G G+NL+ A  + + D   N   ++QAM+R +RIGQ+    V+  + ++TVEE ++
Sbjct: 1354 IRSLGAGLNLLNARHIFLLDPILNVNEEIQAMSRNNRIGQRQETYVWNFMLENTVEESIM 1413

Query: 846  ERARKKMILE 855
               R K +LE
Sbjct: 1414 ---RYKCVLE 1420

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 16/78 (20%)

Query: 412 GILADEMGLGKTVQTVAFISW----------LIFARR------QNGPHLVVVPLSTMPAW 455
           G+LA+EMGLGKT++ +A I            L F         +    L+V P S +  W
Sbjct: 352 GVLAEEMGLGKTLEILALICINKRKYKADEPLDFVSESGKVISKCSTTLIVCPGSILKQW 411

Query: 456 IETFEKWAPDIDVICYMG 473
           I+  +   P I +  Y G
Sbjct: 412 IDEMQSTHPAIKIYHYGG 429

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 78/163 (47%), Gaps = 8/163 (4%)

Query: 725  DGHRVLIFSQMVRILDILGDYLSIKGI-NFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFL 783
            D  +V+++SQ    L ++G  L +  I +   L  T    +    I++F    S     L
Sbjct: 1378 DPPQVILYSQKTEYLKVIGKVLKLYHIEHLACLSNTANVGE---TINNFKRQPSVT-CLL 1433

Query: 784  LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEE 843
            L+ +  G G+NL+ A  + + D   N   +LQAM R +RIGQ     V+  + ++TVEE 
Sbjct: 1434 LNVKTLGAGLNLINAKHIFLLDPILNNSDELQAMGRNNRIGQDEETFVWNFMIRNTVEEN 1493

Query: 844  VLERARKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEILKF 886
            +L   R K ILE          G+KY +  + +  E S+  KF
Sbjct: 1494 IL---RYKCILEERKRKEKSKKGDKYDEAQDETDNEESDDAKF 1533

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 95/214 (44%), Gaps = 48/214 (22%)

Query: 412 GILADEMGLGKTVQTVAFI---------SWLIFARRQN------GPHLVVVPLSTMPAWI 456
           G+LA+EMGLGKT++ ++ I         S   F   +N         L++ P + +  W+
Sbjct: 387 GVLAEEMGLGKTIEILSLILLNRRKLKDSEATFIDDENRTITKTKTTLIICPNAILKQWL 446

Query: 457 ETFEKWAPDIDVICYMG-NQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKD-- 513
           E  E  A  +    Y G N+  +D +   E         ++  ++++++T+Y  I  +  
Sbjct: 447 EEIELHANSLKWYTYRGYNEIMKDCKTVDE-------AVQQLCQYDIIVTSYNIIATEVH 499

Query: 514 RAE---------LGSIKWQF---LAVDEAHRLKNAESSLYESLNSFKV-ANRLL------ 554
            AE         L S K+ +   LA+ + +R+   E  +  S +++      LL      
Sbjct: 500 HAEFNRSIRSRRLKSPKYDYSSPLALMQFYRIILDEVQMLRSSSTYSAKCTSLLHRIHTW 559

Query: 555 -ITGTPLQNNIKELAALVNFLMPGRFTIDQEIDF 587
            ++GTP+Q NI     ++++L    F    E+DF
Sbjct: 560 GVSGTPIQ-NIYNFRMIMSYLKLHPFC--DEVDF 590

>Scas_573.9
          Length = 1502

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 7/121 (5%)

Query: 728  RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIA--IDHFNAPGSDDFVFLLS 785
            ++L++SQ    L +LG  L+   I       T  SN   I   I  F +  S+    LL+
Sbjct: 1333 QILLYSQSANFLKVLGKILTKNDIEHL----TCLSNSSTIGKKIARFKS-QSNITCLLLN 1387

Query: 786  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 845
             +  G G+NL+ A  + + D   N   +LQAM R +RIGQK    V+ L+  ++VEE + 
Sbjct: 1388 VKTLGAGLNLLNARHIFLLDPIINHSDELQAMNRNNRIGQKYETYVWNLIINNSVEENIF 1447

Query: 846  E 846
            +
Sbjct: 1448 K 1448

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 18/83 (21%)

Query: 412 GILADEMGLGKTVQTVAFISWLIFAR----------------RQNGPHLVVVPLSTMPAW 455
           G+L++EMGLGKT++ +A I  ++  R                R+    L+V P + +  W
Sbjct: 371 GLLSEEMGLGKTIEVLALI--MLNKRDVIKEDSFIDDQNKTIRRTNLTLIVCPNAILTQW 428

Query: 456 IETFEKWAPDIDVICYMGNQKSR 478
           I        ++ +  YMG+  +R
Sbjct: 429 INETNAHTENLKIFHYMGSLATR 451

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 62/130 (47%), Gaps = 10/130 (7%)

Query: 728  RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIA--IDHFNAPGSDDFVFLLS 785
            +++I+SQ   +L+I+   L    I F     T   N R  A  ++ F A   +    LL 
Sbjct: 1359 QIVIYSQYAELLEIVAHVLKQNSIKFL----TTTKNVRNFAKVVETFKA-DPEITCLLLD 1413

Query: 786  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 845
            T+    G+ L+ A  V + +   N   + QA+ R HRIGQ +   V+  +  +TVE  +L
Sbjct: 1414 TKRQASGLTLINATHVFLLEPIVNNSTEFQAINRIHRIGQTSETYVWHFMLLNTVEHSIL 1473

Query: 846  ERARKKMILE 855
               R K ILE
Sbjct: 1474 ---RYKSILE 1480

>Kwal_14.1287
          Length = 1518

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 67/163 (41%), Gaps = 42/163 (25%)

Query: 728  RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDF------- 780
            +++I+SQ    L +L   L                  ++ +I H N  GS  F       
Sbjct: 1332 QIIIYSQYSEFLGLLSKVL------------------KQHSIQHCNTAGSGKFSKIVEKF 1373

Query: 781  -------VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR 833
                     LL+      G+ L+ A  V I D   N   +LQA+ R HRIGQ     V+ 
Sbjct: 1374 KKNPEVTCLLLNVTRQATGLTLVNATHVFIMDPIMNTSDELQAINRTHRIGQTRETYVWN 1433

Query: 834  LVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKTEPS 876
             V ++TVE+ ++   R K +LE  I S       +   KT+PS
Sbjct: 1434 FVVRNTVEQNIV---RLKGVLEERIAS-------RQRLKTQPS 1466

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 18/69 (26%)

Query: 408 KNDNGILADEMGLGKTVQTVAFISWLIFARRQNGP----------------HLVVVPLST 451
           K+  G+L++EMGLGKT++ +A +  L+  R  NG                 +L+V P S 
Sbjct: 351 KHAKGVLSEEMGLGKTLEILALM--LVHKRTINGAPTFLSDSKKTILKTATNLIVCPDSI 408

Query: 452 MPAWIETFE 460
           +  WI+  E
Sbjct: 409 LQQWIDEVE 417

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 64/129 (49%), Gaps = 9/129 (6%)

Query: 728  RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNA-PGSDDFVFLLST 786
            +++IFS     L IL   L+   +   R    + + +   A+D F   P       LL+ 
Sbjct: 1353 QIVIFSSHSAFLSILSTLLTAHNVTHAR---PLRNTKFAKAVDTFRKDPNCT--CLLLNV 1407

Query: 787  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 846
             +   G+ L+ A  +I+ +   +   + QA++R HRIGQK+   V+  + ++TVEE ++ 
Sbjct: 1408 HSQSTGLTLVNARHLILLEPIMDSSTEAQAISRIHRIGQKDVTYVWNFMVRNTVEESIM- 1466

Query: 847  RARKKMILE 855
              + K +LE
Sbjct: 1467 --KYKAVLE 1473

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 43/92 (46%), Gaps = 20/92 (21%)

Query: 408 KNDNGILADEMGLGKTVQTVAFISWLI---------FAR-------RQNGPHLVVVPLST 451
           K   G+LADEMGLGKT++ +  IS  +         F         R+   +L+V P S 
Sbjct: 349 KKARGVLADEMGLGKTIEILTLISTNVRNLSNESSSFVSPINEKEVRRVKTNLIVCPESI 408

Query: 452 MPAWIETFE----KWAPDIDVICYMGNQKSRD 479
           +  WI+  +    K   D  V  Y G +K+R+
Sbjct: 409 LQQWIDEIDLHINKKVSDFKVFHYEGFEKTRN 440

>Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement
          Length = 1006

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 52/108 (48%), Gaps = 21/108 (19%)

Query: 386 IKGGELRDFQLT---------GINWMAFLWSKND-NGILADEMGLGKTVQTVAFISWLIF 435
           I+G EL   +LT         G++W+  +   N   G+LAD+MGLGKTVQ +A    L+ 
Sbjct: 871 IEGEELTPEELTVNLLKHQRRGLHWLLNVEKSNKRGGLLADDMGLGKTVQAIA----LMI 926

Query: 436 ARRQN----GPHLVVVPLSTMPAW---IETFEKWAPDIDVICYMGNQK 476
           A R        +L+V P++ +  W   I+T  K         Y GN K
Sbjct: 927 ANRSELESCKTNLIVAPVAVLRVWQAEIQTKIKKNATFKAFIYGGNNK 974

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 17/102 (16%)

Query: 768  AIDHFNAPGSDDF--------------VFLLSTRAGGLGINLMTADTVIIFDSDWNPQAD 813
            +I HFN     D                 L++ +    G+ L  A  VI+ +     +  
Sbjct: 1324 SISHFNTEFGQDLAKEAELFKRDSSITCLLMNPKWCSRGLKLTNATHVILMEPMSEGRIQ 1383

Query: 814  LQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 855
             QA+ R HRIGQ     V+ L++++T EE  L   + +M+LE
Sbjct: 1384 EQAVERIHRIGQGKDTFVWHLMTRNTAEESTL---KYRMLLE 1422

>CAGL0L03047g 350035..352182 similar to sp|P36120 Saccharomyces
           cerevisiae YKR024c DBP7 RNA helicase, start by
           similarity
          Length = 715

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 47/112 (41%), Gaps = 4/112 (3%)

Query: 726 GHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSD---DFVF 782
           G  V + S+  +IL  + D   + GI   +L G++    R + + HF           + 
Sbjct: 439 GDSVRVLSKGNKILPSIKDE-ELPGIICYKLHGSLSQQMRTMTLKHFATDSEQTKGKHLI 497

Query: 783 LLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRL 834
           L  T     G++L    TVI FD  +  +  L  + R  R G+    +++ L
Sbjct: 498 LFCTDVASRGLDLPDVSTVIEFDPPFAVEDHLHRIGRTARAGRSGEALLFLL 549

>Scas_588.3
          Length = 502

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 63/142 (44%), Gaps = 16/142 (11%)

Query: 726 GHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLS 785
           G   +IF++     + +    ++   N   L G +  NQR  A+D F A        L++
Sbjct: 322 GKTTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKS---ILVA 378

Query: 786 TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVE---- 841
           T     G+++ + D VI +D   + ++ +  + R  R G+    +   LVS+  +E    
Sbjct: 379 TDVAARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSI--SLVSQYDLELILR 436

Query: 842 -EEVL------ERARKKMILEY 856
            EEVL      E   K+MIL +
Sbjct: 437 IEEVLGKKLPKESVDKEMILHF 458

>Kwal_56.24760
          Length = 433

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 51/124 (41%), Gaps = 5/124 (4%)

Query: 730 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAG 789
           +IF       +IL   L    +    L   +P  +R  ++  F A  +     L++T   
Sbjct: 259 IIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAAR---VLIATDVA 315

Query: 790 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL-ERA 848
             G+++ T   V+ +D   NP   +    R  R G+K   + + +  +D    + + ER 
Sbjct: 316 SRGLDIPTVQLVVNYDISANPDTFIHRAGRTARAGRKGESICF-VAQRDVSRIQAIEERI 374

Query: 849 RKKM 852
            KKM
Sbjct: 375 NKKM 378

>Scas_415.2
          Length = 433

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 198 VITHRIKEGSDKEHLAKIVPELNVCKENYEFQIKWTDQSHLHNTWETYESLAGV 251
           ++T R++E S+KEH  K  P   VC      +I++ D++H+  T+   +++  V
Sbjct: 265 LLTKRLREKSEKEHSLKRTPP-KVC----TLRIRFPDRTHIEATFNADDTMVSV 313

>CAGL0J10912g 1061476..1062957 highly similar to sp|P38712
           Saccharomyces cerevisiae YHR065c RRP3, start by
           similarity
          Length = 493

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 63/139 (45%), Gaps = 10/139 (7%)

Query: 726 GHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLS 785
           G  V+IF++     + L    ++   +   L G +  NQR  A+D F A        L++
Sbjct: 313 GKTVIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRS---ILVA 369

Query: 786 TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVE---- 841
           T     G+++ + D VI +D   + ++ +  + R  R G+    +   LVS+  +E    
Sbjct: 370 TDVAARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSI--SLVSQYDLELILR 427

Query: 842 -EEVLERARKKMILEYAII 859
            EEVL +   K  ++  II
Sbjct: 428 IEEVLGKKLPKESVDKNII 446

>CAGL0E05698g complement(566932..568731) similar to tr|Q08961
           Saccharomyces cerevisiae YPL208w, start by similarity
          Length = 599

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 215 IVPELNVCKENYEFQIKWTDQSHLHNTWETYESLAGVKGIKRLDN 259
           ++P L++   NY  +++W  + H + T   Y+ LA +K    LDN
Sbjct: 234 LLPILDLMNHNYNSKVQWFPKEHQNGTSFCYQCLADMKAGDELDN 278

>AFR474W [3666] [Homologous to ScYGL033W (HOP2) - SH]
           complement(1292544..1292814,1292878..1293530) [924 bp,
           307 aa]
          Length = 307

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 18/78 (23%)

Query: 264 YIIQEQQVRLDPYITPEDIEIMDMEHER---------------RLDEL-QEFTNPERI-- 305
           Y  +EQQ++L P +T E+I I  +E  R               +L++L ++ TN E I  
Sbjct: 148 YCCKEQQLQLPPNVTEEEITIEALEQLREECNALNSDINEWQTQLNQLTRDPTNIELIEQ 207

Query: 306 IDSQRVELEDGTSQLQYL 323
           I+ ++VELE+  ++L+ L
Sbjct: 208 INQRKVELEETKTRLEAL 225

>ADL273C [1468] [Homologous to ScYOR204W (DED1) - SH; ScYPL119C
           (DBP1) - SH] (225070..226941) [1872 bp, 623 aa]
          Length = 623

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 59/131 (45%), Gaps = 6/131 (4%)

Query: 725 DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLL 784
           DG   L+F +  R+ D L D+L ++ ++   + G     +R  A+  F    ++    L+
Sbjct: 401 DGGLTLVFVETKRMADALTDFLIMQNLSATAIHGDRTQAERERALAFFRTGRAN---VLV 457

Query: 785 STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKN-HVMVYRLVSKDTVEE- 842
           +T     G+++     VI +D   +    +  + R  R G        +   +K+ V+E 
Sbjct: 458 ATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGLATAFFNRGNKNVVKEL 517

Query: 843 -EVLERARKKM 852
            ++LE A +++
Sbjct: 518 VDILEEANQEV 528

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 43,127,881
Number of extensions: 1834832
Number of successful extensions: 6902
Number of sequences better than 10.0: 133
Number of HSP's gapped: 6676
Number of HSP's successfully gapped: 203
Length of query: 1453
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1339
Effective length of database: 12,649,657
Effective search space: 16937890723
Effective search space used: 16937890723
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)