Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L11748g23623312561e-178
Scas_576.42372297166e-96
YER163C2322377122e-95
Sklu_879.22332356341e-83
KLLA0C11649g2382396115e-80
AFR184C2182334672e-58
CAGL0L03652g80752690.78
CAGL0L09152g30675633.3
YPL259C (APM1)47571633.5
Scas_712.9380116615.9
CAGL0K09438g77586608.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L11748g
         (233 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L11748g complement(1252608..1253318) similar to sp|P32656 S...   488   e-178
Scas_576.4                                                            280   6e-96
YER163C (YER163C) [1591] chr5 complement(503079..503777) Member ...   278   2e-95
Sklu_879.2 YER163C, Contig c879 312-1013 reverse complement           248   1e-83
KLLA0C11649g complement(1005591..1006307) similar to sp|P32656 S...   239   5e-80
AFR184C [3376] [Homologous to ScYER163C - NSH] (772555..773211) ...   184   2e-58
CAGL0L03652g complement(417877..420300) similar to sp|P39677 Sac...    31   0.78 
CAGL0L09152g 993428..994348 highly similar to sp|P43588 Saccharo...    29   3.3  
YPL259C (APM1) [5191] chr16 complement(51244..52671) Medium subu...    29   3.5  
Scas_712.9                                                             28   5.9  
CAGL0K09438g complement(931680..934007) similar to tr|Q12050 Sac...    28   8.6  

>CAGL0L11748g complement(1252608..1253318) similar to sp|P32656
           Saccharomyces cerevisiae YER163c, start by similarity
          Length = 236

 Score =  488 bits (1256), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 233/233 (100%), Positives = 233/233 (100%)

Query: 1   MTVEKCGIWVLGYGSLIYKPPPHYTHRIPAVIYGFMRRFWQSSVDHRGTPDSPGRVVTLI 60
           MTVEKCGIWVLGYGSLIYKPPPHYTHRIPAVIYGFMRRFWQSSVDHRGTPDSPGRVVTLI
Sbjct: 1   MTVEKCGIWVLGYGSLIYKPPPHYTHRIPAVIYGFMRRFWQSSVDHRGTPDSPGRVVTLI 60

Query: 61  PHDEIMKTPRFLQDYVKYENHGNPITNLQPNDLHTIGVVYYIPADRADEVREYLDVREQN 120
           PHDEIMKTPRFLQDYVKYENHGNPITNLQPNDLHTIGVVYYIPADRADEVREYLDVREQN
Sbjct: 61  PHDEIMKTPRFLQDYVKYENHGNPITNLQPNDLHTIGVVYYIPADRADEVREYLDVREQN 120

Query: 121 GYTLHEVEVHLDLTESDSSDQELMAAIHQLPEHETTGKKVLTTNVYIGTVSNEAFVGPET 180
           GYTLHEVEVHLDLTESDSSDQELMAAIHQLPEHETTGKKVLTTNVYIGTVSNEAFVGPET
Sbjct: 121 GYTLHEVEVHLDLTESDSSDQELMAAIHQLPEHETTGKKVLTTNVYIGTVSNEAFVGPET 180

Query: 181 IEQTASVIATNVGPSGTNFDYLRMLCESMASMKTCEETDKYLEHLFKEVNRIR 233
           IEQTASVIATNVGPSGTNFDYLRMLCESMASMKTCEETDKYLEHLFKEVNRIR
Sbjct: 181 IEQTASVIATNVGPSGTNFDYLRMLCESMASMKTCEETDKYLEHLFKEVNRIR 233

>Scas_576.4
          Length = 237

 Score =  280 bits (716), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 141/229 (61%), Positives = 171/229 (74%), Gaps = 7/229 (3%)

Query: 7   GIWVLGYGSLIYKPPPHYTHRIPAVIYGFMRRFWQSSVDHRGTPDSPGRVVTLIPHDEIM 66
           G+WVLGYGSLIYKPPPHY +RIPA IYGFMRRFWQSS+DHRGTPDSPGRVVTLIP+DEI+
Sbjct: 11  GLWVLGYGSLIYKPPPHYKYRIPATIYGFMRRFWQSSIDHRGTPDSPGRVVTLIPYDEIV 70

Query: 67  KTPRFLQDYVKYENHGNPITNLQPNDLHTIGVVYYIPADRADEVREYLDVREQNGYTLHE 126
             P F QD   Y  + + I     NDL T+GVVYYIP + AD+VREYLDVREQNGYTLHE
Sbjct: 71  SRPEFSQDLKLYSPNFDDIKG--ANDLTTLGVVYYIPTEFADQVREYLDVREQNGYTLHE 128

Query: 127 VEVHLDLTESDSSDQELMAAIHQLPEHETTGKKVLTTNVYIGTVSNEAFVGPETIEQTAS 186
           VEVHL+ T     ++ L   + +LP H  T K++L TNVYIGTV+NEAFVGPE I  TA 
Sbjct: 129 VEVHLNTT--GEQERALKHVLCKLPFHNETKKRILKTNVYIGTVTNEAFVGPEAIHDTAK 186

Query: 187 VIATNVGPSGTNFDYLRMLCESMASMKTCE---ETDKYLEHLFKEVNRI 232
           VI+T+ GPSG N +YL++L +S+  M   E    +D YL  L ++V++I
Sbjct: 187 VISTSRGPSGPNIEYLKLLHDSIEFMSDNELLPTSDIYLNKLLRQVDKI 235

>YER163C (YER163C) [1591] chr5 complement(503079..503777) Member of
           the ChaC-like protein family, has moderate similarity to
           uncharacterized C. albicans Orf6.7p [699 bp, 232 aa]
          Length = 232

 Score =  278 bits (712), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 176/237 (74%), Gaps = 9/237 (3%)

Query: 1   MTVEKCGIWVLGYGSLIYKPPPHYTHRIPAVIYGFMRRFWQSSVDHRGTPDSPGRVVTLI 60
           MT +  GIWVLGYGSLIYKPP HYTHRIPA+I+GF RRFWQSS DHRGTP +PGRV TLI
Sbjct: 1   MTNDNSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLI 60

Query: 61  PHDEIMKTPRFLQDYVKYENHGNPITNLQPNDLHTIGVVYYIPADRADEVREYLDVREQN 120
           P+++I++   FL++ V   +   PI +  P+DL TIGVVYYIP + A EVREYL+VREQN
Sbjct: 61  PYEDIIRQTAFLKN-VNLYSESAPIQD--PDDLVTIGVVYYIPPEHAQEVREYLNVREQN 117

Query: 121 GYTLHEVEVHLDLTESDSSDQELMAAIHQLPEHETTGKKVLTTNVYIGTVSNEAFVGPET 180
           GYTLHEVEVHL+      +  EL  A+ QLP H  +GK+VL T+VYIGT+ NEAFVGPET
Sbjct: 118 GYTLHEVEVHLETNREHEA--ELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPET 175

Query: 181 IEQTASVIATNVGPSGTNFDYLRMLCESMASMKTCEE----TDKYLEHLFKEVNRIR 233
           +++TA VIA + GPSG+N++YL  L +++A M   +E    TD YL  L + VN+ R
Sbjct: 176 VDETAKVIAVSHGPSGSNYEYLAKLEQALAQMPIMKERGRITDHYLTALLETVNKYR 232

>Sklu_879.2 YER163C, Contig c879 312-1013 reverse complement
          Length = 233

 Score =  248 bits (634), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 129/235 (54%), Positives = 162/235 (68%), Gaps = 13/235 (5%)

Query: 1   MTVEKCGIWVLGYGSLIYKPPPHYTHRIPAVIYGFMRRFWQSSVDHRGTPDSPGRVVTLI 60
           MT +K GIWVLGYGSLIYKPPPHY HRIP +IYGF RRFWQSS DHRGTP SPGRV TLI
Sbjct: 1   MTQDK-GIWVLGYGSLIYKPPPHYRHRIPGIIYGFKRRFWQSSSDHRGTPQSPGRVATLI 59

Query: 61  PHDEIMKTPRFLQDYVKYENHGNPITNLQPNDLHTIGVVYYIPADRADEVREYLDVREQN 120
            +D+I+K P+FL+D   Y+         +  DL   GV YYIP   A EV +YL+VREQ+
Sbjct: 60  AYDDIVKHPKFLKDLYHYKKSKVE----KAEDLSIFGVAYYIPPQYAQEVTDYLNVREQD 115

Query: 121 GYTLHEVEVHLDLTESDSSDQELMAAIHQLPEHETTGKKVLTTNVYIGTVSNEAFVGPET 180
           GY++H VE+HL+ T   S +QEL  ++H LP H  T K VL + VYIGTV NE+FVGPE 
Sbjct: 116 GYSVHCVEIHLETTL--SQEQELRDSLHLLPRHHITNKYVLRSIVYIGTVDNESFVGPED 173

Query: 181 IEQTASVIATNVGPSGTNFDYLRMLCESMASM------KTCEETDKYLEHLFKEV 229
           I+ TAS+IA + GPSG N++YL++L +S+  +      K  +  D YL+ L   V
Sbjct: 174 IKTTASIIADSHGPSGPNYEYLKLLHDSLTEVACSLGHKLSDVEDTYLDSLLDHV 228

>KLLA0C11649g complement(1005591..1006307) similar to sp|P32656
           Saccharomyces cerevisiae YER163c singleton, start by
           similarity
          Length = 238

 Score =  239 bits (611), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 121/239 (50%), Positives = 160/239 (66%), Gaps = 12/239 (5%)

Query: 1   MTVEKCGIWVLGYGSLIYKPPPHYTHRIPAVIYGFMRRFWQSSVDHRGTPDSPGRVVTLI 60
           MT    GIWV+GYGSLIYKPPPH+ +++  ++YGF RRFWQSS+DHRGTPDSPGRV TLI
Sbjct: 1   MTKGSEGIWVVGYGSLIYKPPPHWKYKVNGIVYGFKRRFWQSSIDHRGTPDSPGRVATLI 60

Query: 61  PHDEIMKTPRFLQDYVKYENHGNPITNLQPNDLHTIGVVYYIPADRADEVREYLDVREQN 120
           P D I     F +D   +    N     + +DL  + V YYIP + A  V E+LDVRE+N
Sbjct: 61  PFDGITNNAEFEKDLRTW----NSKVVAKQDDLKLLAVAYYIPPEHAQFVTEHLDVREKN 116

Query: 121 GYTLHEVEVHLDLTESDSSDQELMAAIHQLPEHETTGKKVLTTNVYIGTVSNEAFVGPET 180
           GYT H + +HL   +S+    EL A +H+LP HETTGK +L + VYIGT  NEAF+GPE 
Sbjct: 117 GYTAHRIFIHLQPPKSEP--LELQALLHKLPVHETTGKHILDSLVYIGTSDNEAFIGPED 174

Query: 181 IEQTASVIATNVGPSGTNFDYLRMLCESMASM-----KTCEET-DKYLEHLFKEVNRIR 233
           I  TA VI+ N+GPSG N++YL++L +S+  M     ++ EE  D YL+ L K+  ++R
Sbjct: 175 INVTAKVISHNLGPSGPNYEYLKLLHDSLTEMADELGQSLEEIEDSYLDSLLKQTEQLR 233

>AFR184C [3376] [Homologous to ScYER163C - NSH] (772555..773211)
           [657 bp, 218 aa]
          Length = 218

 Score =  184 bits (467), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 99/233 (42%), Positives = 130/233 (55%), Gaps = 36/233 (15%)

Query: 7   GIWVLGYGSLIYKPPPHYTHRIPAVIYGFMRRFWQSSVDHRGTPDSPGRVVTLIPHDEIM 66
           G WV+GYGSLIYKPPPHY+ R+  V++GF RRFWQSS DHRGTP+ PGRV TL+P     
Sbjct: 7   GAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSSDHRGTPELPGRVATLVPA---- 62

Query: 67  KTPRFLQDYVKYENHGNPITNLQPNDLHTIGVVYYIPADRADEVREYLDVREQNGYTLHE 126
                                    D   + V Y+IPA     V  YLDVREQ+GY    
Sbjct: 63  ------------------------ADARLLVVAYFIPAAHVAAVTAYLDVREQDGYLPQT 98

Query: 127 VEVHLDLTESDSSDQELMAAIHQLPEHETTGKKVLTTNVYIGTVSNEAFVGPETIEQTAS 186
           V VHL          EL  A+  LP    +G  V+ + +YIG      FVGPE +++TA+
Sbjct: 99  VPVHL--VAPPQPPHELRDALDALPCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTAA 156

Query: 187 VIATNVGPSGTNFDYLRMLCESMASM------KTCEETDKYLEHLFKEVNRIR 233
           VIA N GPSG N++YL++L  ++ S+      + CE  D YL+ L + V+R+R
Sbjct: 157 VIAHNHGPSGPNYEYLKLLHSALHSIAETFGARLCELEDHYLDELLEAVDRLR 209

>CAGL0L03652g complement(417877..420300) similar to sp|P39677
           Saccharomyces cerevisiae YJL102w MEF2, hypothetical
           start
          Length = 807

 Score = 31.2 bits (69), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%)

Query: 60  IPHDEIMKTPRFLQDYVKYENHGNPITNLQPNDLHTIGVVYYIPADRADEVR 111
           + HD+I     F++ Y    N GN + N    +   IG +  + AD+A EV+
Sbjct: 357 VTHDQIRGLMVFVRIYSGVLNSGNTVMNTTTGEKFRIGKLVIMQADQAQEVK 408

>CAGL0L09152g 993428..994348 highly similar to sp|P43588
           Saccharomyces cerevisiae YFR004w MPR1 26S proteasome
           regulatory subunit, start by similarity
          Length = 306

 Score = 28.9 bits (63), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 11/75 (14%)

Query: 14  GSLIYKPPPHYT---------HRIPAVIYGFMRRFWQSSVDHRGTPDSPGRVVTLIPHDE 64
           G+LI    P  T           I A+I+G  R ++  ++D+  TP     ++ L  H E
Sbjct: 162 GALINNQEPRQTTSNSGLMNKANIQALIHGLNRHYYSLNIDYHKTPAETKMLLNL--HKE 219

Query: 65  IMKTPRFLQDYVKYE 79
             ++   +QDY + E
Sbjct: 220 QWQSGLKMQDYQEKE 234

>YPL259C (APM1) [5191] chr16 complement(51244..52671) Medium subunit
           of the clathrin-associated protein (AP) complex [1428
           bp, 475 aa]
          Length = 475

 Score = 28.9 bits (63), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 29/71 (40%), Gaps = 8/71 (11%)

Query: 45  DHRGTPDSPGRVVTLIPHDEIMKTPRFLQDYVKYENHGNPITN--------LQPNDLHTI 96
           DH G P    R    IP   I K P  L D  +  N   P  N        +Q NDL+ +
Sbjct: 9   DHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYVV 68

Query: 97  GVVYYIPADRA 107
            +V  + A+ A
Sbjct: 69  AIVTSLSANAA 79

>Scas_712.9
          Length = 380

 Score = 28.1 bits (61), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 50/116 (43%), Gaps = 27/116 (23%)

Query: 28  IPAVIYGFM-RRFWQSSVDHRGTPDSPGRVVTLIPHDEIMKTPRFLQDYVKYENHGNPIT 86
           IP +IYGF    +   +++   T + P     ++  +   K      D +K+  +G    
Sbjct: 269 IPRIIYGFRDENYVLKTIEEYSTDEIP-----ILLKNNNTKMNSMCLDAIKW--YG---- 317

Query: 87  NLQPNDLHTIGVVYYIPADRADEVREYLDVREQNGYTLHEVEVHLDLTESDSSDQE 142
                 L T  ++  IP D+  E+R Y  V E N         HL L+E +S+D+E
Sbjct: 318 ------LFTEWLLKIIPRDQPKEIRPYKLVLENN---------HLKLSEIESTDEE 358

>CAGL0K09438g complement(931680..934007) similar to tr|Q12050
           Saccharomyces cerevisiae YOR144c EFD1, start by
           similarity
          Length = 775

 Score = 27.7 bits (60), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 3/86 (3%)

Query: 93  LHTIGVVYYIPADRADEVREYLDVREQNGYTLHEVEVHLDLTESDSSDQELMAAIHQLPE 152
           L  +   Y   AD+ DE+   +D+ E   Y+    E++  + E    D E+ +   QL E
Sbjct: 678 LDRLSSNYEYSADKEDEI--MMDL-EMYPYSTLSCEINPMIHEIAKRDNEIKSFNRQLFE 734

Query: 153 HETTGKKVLTTNVYIGTVSNEAFVGP 178
            ET G      N  +  ++NE  + P
Sbjct: 735 SETKGLAKEEMNTVVYKLTNEGLLKP 760

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,296,581
Number of extensions: 360052
Number of successful extensions: 1036
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1026
Number of HSP's successfully gapped: 28
Length of query: 233
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 135
Effective length of database: 13,203,545
Effective search space: 1782478575
Effective search space used: 1782478575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)