Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L11726g82581340130.0
YER162C (RAD4)75474219340.0
Scas_576.377982518350.0
Kwal_56.2341772371514820.0
AGR162C76358513601e-177
KLLA0F14465g76775613441e-174
CAGL0H07293g6684721831e-13
YDR314C6922741534e-10
Sklu_2426.26644741373e-08
CAGL0H05753g348174970.001
Kwal_27.1220436889950.003
ABR193W35091920.005
Scas_700.2351165830.073
YPL096W (PNG1)36391800.17
Sklu_2405.1135191740.84
YHR061C (GIC1)314200731.2
Scas_679.1370191721.6
YPL005W60647712.6
CAGL0J00583g817147685.3
ACR009W680170685.4
Kwal_26.9464283138666.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L11726g
         (813 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L11726g complement(1249886..1252363) similar to sp|P14736 S...  1550   0.0  
YER162C (RAD4) [1590] chr5 complement(500625..502889) Component ...   749   0.0  
Scas_576.3                                                            711   0.0  
Kwal_56.23417                                                         575   0.0  
AGR162C [4473] [Homologous to ScYER162C (RAD4) - SH] (1049961..1...   528   e-177
KLLA0F14465g 1341764..1344067 weakly similar to sp|P14736 Saccha...   522   e-174
CAGL0H07293g 713669..715675 similar to tr|Q06665 Saccharomyces c...    75   1e-13
YDR314C (YDR314C) [1142] chr4 complement(1090426..1092504) Membe...    64   4e-10
Sklu_2426.2 YDR314C, Contig c2426 795-2789 reverse complement          57   3e-08
CAGL0H05753g complement(569862..570908) similar to tr|Q02890 Sac...    42   0.001
Kwal_27.12204                                                          41   0.003
ABR193W [787] [Homologous to ScYPL096W (PNG1) - SH] complement(7...    40   0.005
Scas_700.2                                                             37   0.073
YPL096W (PNG1) [5348] chr16 (366922..368013) Peptide:N-glycanase...    35   0.17 
Sklu_2405.11 YPL096W, Contig c2405 21404-22459 reverse complement      33   0.84 
YHR061C (GIC1) [2349] chr8 complement(221535..222479) Putative e...    33   1.2  
Scas_679.1                                                             32   1.6  
YPL005W (AEP3) [5432] chr16 (548481..550301) Protein of unknown ...    32   2.6  
CAGL0J00583g 50462..52915 similar to sp|P18962 Saccharomyces cer...    31   5.3  
ACR009W [1057] [Homologous to ScYEL062W (NPR2) - SH] complement(...    31   5.4  
Kwal_26.9464                                                           30   6.8  

>CAGL0L11726g complement(1249886..1252363) similar to sp|P14736
           Saccharomyces cerevisiae YER162c RAD4 excision repair
           protein, start by similarity
          Length = 825

 Score = 1550 bits (4013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 750/813 (92%), Positives = 750/813 (92%)

Query: 1   MSSDQIPSEYFDLIRDVLKNKGDATQERPLXXXXXXXAVTSELESGYENPQPTEAKIVVN 60
           MSSDQIPSEYFDLIRDVLKNKGDATQERPL       AVTSELESGYENPQPTEAKIVVN
Sbjct: 1   MSSDQIPSEYFDLIRDVLKNKGDATQERPLKRRKRRRAVTSELESGYENPQPTEAKIVVN 60

Query: 61  LDSDPELEDKLGASNTISLVSDGEVQHTXXXXXXXXXXXXXXXXXXXXVSADEMQMPSDN 120
           LDSDPELEDKLGASNTISLVSDGEVQHT                    VSADEMQMPSDN
Sbjct: 61  LDSDPELEDKLGASNTISLVSDGEVQHTEASEDGAESDEAYESEEFEDVSADEMQMPSDN 120

Query: 121 LSVTINVNXXXXXXXXXXXXXXXNMCSNEDRKFRTXXXXXXXXXXXXXXXIINHWLNNSK 180
           LSVTINVN               NMCSNEDRKFRT               IINHWLNNSK
Sbjct: 121 LSVTINVNKKDSQSKKESSKIQKNMCSNEDRKFRTHMHCLYLLCLMCHGHIINHWLNNSK 180

Query: 181 MNRKLSGMIPEKVFDMLHPEKDEELPLRSTRKLLDGLKKAMEIWQKHWRIMQRYKGVNCY 240
           MNRKLSGMIPEKVFDMLHPEKDEELPLRSTRKLLDGLKKAMEIWQKHWRIMQRYKGVNCY
Sbjct: 181 MNRKLSGMIPEKVFDMLHPEKDEELPLRSTRKLLDGLKKAMEIWQKHWRIMQRYKGVNCY 240

Query: 241 MRYWDELQICDKSRKTLTKNDFIKGILKGVGDRDVATQGFVALLRSCNVNARLVMSCQPP 300
           MRYWDELQICDKSRKTLTKNDFIKGILKGVGDRDVATQGFVALLRSCNVNARLVMSCQPP
Sbjct: 241 MRYWDELQICDKSRKTLTKNDFIKGILKGVGDRDVATQGFVALLRSCNVNARLVMSCQPP 300

Query: 301 DFTNLKKSYGTEKKVSYEDMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVRLSSKFEP 360
           DFTNLKKSYGTEKKVSYEDMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVRLSSKFEP
Sbjct: 301 DFTNLKKSYGTEKKVSYEDMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVRLSSKFEP 360

Query: 361 RGVSPCKRNAMRYVIGFDRKEGCRDITRRYCQWFNSKTRKKRITKEAFGERWYERVLASL 420
           RGVSPCKRNAMRYVIGFDRKEGCRDITRRYCQWFNSKTRKKRITKEAFGERWYERVLASL
Sbjct: 361 RGVSPCKRNAMRYVIGFDRKEGCRDITRRYCQWFNSKTRKKRITKEAFGERWYERVLASL 420

Query: 421 HKRKRTKIDDYEDAYFDQRNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLKSGCKECGYL 480
           HKRKRTKIDDYEDAYFDQRNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLKSGCKECGYL
Sbjct: 421 HKRKRTKIDDYEDAYFDQRNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLKSGCKECGYL 480

Query: 481 KLHNKTNQVLKVYSKKDIIDLKSAKQWYMEGRILKTGARALKTVEKKRGRFTDPEEQEEE 540
           KLHNKTNQVLKVYSKKDIIDLKSAKQWYMEGRILKTGARALKTVEKKRGRFTDPEEQEEE
Sbjct: 481 KLHNKTNQVLKVYSKKDIIDLKSAKQWYMEGRILKTGARALKTVEKKRGRFTDPEEQEEE 540

Query: 541 RLYQFDDTELYVAPLATRSGEIETNTFGNIEVFVPSMIPANCCLVESPVAIKAASFIRIK 600
           RLYQFDDTELYVAPLATRSGEIETNTFGNIEVFVPSMIPANCCLVESPVAIKAASFIRIK
Sbjct: 541 RLYQFDDTELYVAPLATRSGEIETNTFGNIEVFVPSMIPANCCLVESPVAIKAASFIRIK 600

Query: 601 FAKAVTAFKFEKGRSVKPSITGVVVALWFRDALVAAIDGITQANAEEKHIEHELEALSYW 660
           FAKAVTAFKFEKGRSVKPSITGVVVALWFRDALVAAIDGITQANAEEKHIEHELEALSYW
Sbjct: 601 FAKAVTAFKFEKGRSVKPSITGVVVALWFRDALVAAIDGITQANAEEKHIEHELEALSYW 660

Query: 661 HNLITKLRIKNKLNSEYGKVNEEESSTVVSQPLIANRFDEETSMTDSGDEFPQGGFLPTD 720
           HNLITKLRIKNKLNSEYGKVNEEESSTVVSQPLIANRFDEETSMTDSGDEFPQGGFLPTD
Sbjct: 661 HNLITKLRIKNKLNSEYGKVNEEESSTVVSQPLIANRFDEETSMTDSGDEFPQGGFLPTD 720

Query: 721 INHDGTSHNETSDNEIEEPGGFVPTXXXXXXANPDADYHDNEIVGNGGFITTRNQSPAGV 780
           INHDGTSHNETSDNEIEEPGGFVPT      ANPDADYHDNEIVGNGGFITTRNQSPAGV
Sbjct: 721 INHDGTSHNETSDNEIEEPGGFVPTNSNSSNANPDADYHDNEIVGNGGFITTRNQSPAGV 780

Query: 781 TEYEEIKEPGDNLEPEDIDNQESHLDEDYKDFM 813
           TEYEEIKEPGDNLEPEDIDNQESHLDEDYKDFM
Sbjct: 781 TEYEEIKEPGDNLEPEDIDNQESHLDEDYKDFM 813

>YER162C (RAD4) [1590] chr5 complement(500625..502889) Component of
           the nucleotide excision repairosome, homolog of human
           XPC xeroderma pigmentosum gene product [2265 bp, 754 aa]
          Length = 754

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/742 (50%), Positives = 489/742 (65%), Gaps = 36/742 (4%)

Query: 3   SDQIPSEYFDLIRDVLKNKGDATQERPLXXXXXXXAVTSELESGYE------NPQPTEAK 56
           ++ +P EYF+LIR  L  K    ++ PL            L    +      N  P E+ 
Sbjct: 2   NEDLPKEYFELIRKALNEK--EAEKAPLSRRRRVRRKNQPLPDAKKKFKTGLNELPRESV 59

Query: 57  IVVNLDSDPELEDKLGASNTISLVSDGEVQHTXXXXXXXXXXXXXXXXXXXXVSADEMQM 116
           + VNLDS  +          +++ +D  V+                      V+  E   
Sbjct: 60  VTVNLDSSDD--------GVVTVPTDDSVEEIQSSEEDYDSEEFEDVTDGNEVAGVE--- 108

Query: 117 PSDNLSVTINVNXXXXXXXXXXXXXXXNMCSNEDRKFRTXXXXXXXXXXXXXXXIINHWL 176
              ++SV I  +               N+CSNE+RK R                I N W+
Sbjct: 109 ---DISVEIKPSSKRNSDARRTSR---NVCSNEERKRRKYFHMLYLVCLMVHGFIRNEWI 162

Query: 177 NNSKMNRKLSGMIPEKVFDMLHPEKDEELPLRSTRKLLDGLKKAMEIWQKHWRIMQRYKG 236
           N+ +++RKLS ++PEKVF++LHP+KDEELPLRSTRKLLDGLKK ME+WQKHW+I ++Y  
Sbjct: 163 NSKRLSRKLSNLVPEKVFELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKITKKYDN 222

Query: 237 VNCYMRYWDELQICDKSR---KTLTKNDFIKGILKGVGDRDVATQGFVALLRSCNVNARL 293
              YMR W E+++   ++   KTL ++DF++ + KG GD D++ QGFVA+LR+CNVNARL
Sbjct: 223 EGLYMRTWKEIEMSANNKRKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRACNVNARL 282

Query: 294 VMSCQPPDFTNLKKSYGTEKKVSYEDMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVR 353
           +MSCQPPDFTN+K         +Y+DM KYP+FWCEVWDKFSKKWIT+DP   KTIEQVR
Sbjct: 283 IMSCQPPDFTNMKIDTSLNGNNAYKDMVKYPIFWCEVWDKFSKKWITVDPVNLKTIEQVR 342

Query: 354 LSSKFEPRGVSPCKRNAMRYVIGFDRKEGCRDITRRYCQWFNSKTRKKRITKEAFGERWY 413
           L SK  P+GV+ C+RN +RYVI +DRK GCRD+TRRY QW NSK RK+RITK+ FGE+W+
Sbjct: 343 LHSKLAPKGVACCERNMLRYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITKDDFGEKWF 402

Query: 414 ERVLASLHKRKRTKIDDYEDAYFDQRNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLKSG 473
            +V+ +LH RKRTKIDDYED YF QR++ EG+PD++QD K HPYYVLE+DI+Q Q++K G
Sbjct: 403 RKVITALHHRKRTKIDDYEDQYFFQRDESEGIPDSVQDLKNHPYYVLEQDIKQTQIVKPG 462

Query: 474 CKECGYLKLHNKTNQVLKVYSKKDIIDLKSAKQWYMEGRILKTGARALKTVEKKRGRFTD 533
           CKECGYLK+H K  +VLKVY+K+DI DLKSA+QWYM GRILKTG+R  K +++  GR   
Sbjct: 463 CKECGYLKVHGKVGKVLKVYAKRDIADLKSARQWYMNGRILKTGSRCKKVIKRTVGRPKG 522

Query: 534 PEEQEEERLYQFDDTELYVAPLATRSGEIETNTFGNIEVFVPSMIPANCCLVESPVAIKA 593
             E+E+ERLY F+DTELY+ PLA+ SGEI  NTFGNIEVF P+MIP NCCLVE+PVAIKA
Sbjct: 523 EAEEEDERLYSFEDTELYIPPLASASGEITKNTFGNIEVFAPTMIPGNCCLVENPVAIKA 582

Query: 594 ASFIRIKFAKAVTAFKFEKGRSVKPSITGVVVALWFRDALVAAIDGITQANAEEKHIEHE 653
           A F+ ++FA AVT+FKFE+G +VKP ++G+VVA W R+A+  AIDGI     ++   EH 
Sbjct: 583 ARFLGVEFAPAVTSFKFERGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQEDDNRKEHL 642

Query: 654 LEALSYWHNLITKLRIKNKLNSEYGKVNEEESSTVVSQPLIANRFDEETSMTDSGDEFPQ 713
           L AL  W+ L+ KLRI++KLNS YGK+ EEE +    Q +  N  + ET        F  
Sbjct: 643 LGALESWNTLLLKLRIRSKLNSTYGKIAEEEPNVTKEQNIADNHDNTET--------FMG 694

Query: 714 GGFLPTDINHDGTSHNETSDNE 735
           GGFLP   NH+   ++E S+ E
Sbjct: 695 GGFLPGIANHEARPYSEPSEPE 716

>Scas_576.3
          Length = 779

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/825 (46%), Positives = 496/825 (60%), Gaps = 70/825 (8%)

Query: 3   SDQIPSEYFDLIRDVLKNKGDATQERPLXXXXXXXAVTSELESGYENPQPTEAKIVVNLD 62
           +D +P EYF+LIR  L+NK D  QE                 +    P+  E +  ++L 
Sbjct: 2   NDDLPKEYFELIRTALRNKKDEPQEE----RQLKKRKRRTRTTATSVPEKHEEQTTLDLS 57

Query: 63  SDPELEDKLGASNTISLVSDGEVQHTXXXXXXXXXXXXXXXXXXXXVSADEMQMPSDNLS 122
           S  +       SNT     + + +H                      ++D+ +  ++N S
Sbjct: 58  SPID-----KYSNTQLKSPERKEEHAGEASNSSNTEIQDEDDDDENYNSDDFEDVTENNS 112

Query: 123 VTINVNX--------XXXXXXXXXXXXXXNMCSNEDRKFRTXXXXXXXXXXXXXXXIINH 174
              N+N                       N+CS EDR  R                + N 
Sbjct: 113 TDENINDISITIEDPTKRNEAKGKTASTRNVCSREDRDRRYAFHMADLLCLMVHGYLRNE 172

Query: 175 WLNNSKMNRKLSGMIPEKVFDMLHPEKDEELPLRSTRKLLDGLKKAMEIWQKHWRIMQRY 234
           WLN+SK   KLS ++PEKVF +LHP KDEELPLRSTRKLLDGLKK ME+W KHW+I+Q+Y
Sbjct: 173 WLNSSKFIVKLSKLVPEKVFQLLHPVKDEELPLRSTRKLLDGLKKTMELWNKHWKILQKY 232

Query: 235 KGVNCYMRYWDELQICDKSRKT--LTKNDFIKGILKGVGDRDVATQGFVALLRSCNVNAR 292
           +GV CYM+ WDE+    K      L+K  FI+ ++KG GDRD+A QG+VALLR+CNVNAR
Sbjct: 233 EGVACYMKSWDEITTSTKPNSPFFLSKKQFIRQVIKGQGDRDIAAQGYVALLRACNVNAR 292

Query: 293 LVMSCQPPDFTNLKKSYGTEKKVSYEDMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQV 352
           L+MSCQPPD T+LK+       + Y+DM KYP+FWCEVWDKF+KKWITID      IEQV
Sbjct: 293 LIMSCQPPDITDLKEK-CKPIDIDYDDMVKYPIFWCEVWDKFAKKWITIDCMNFHIIEQV 351

Query: 353 RLSSKFEPRGVSPCKRNAMRYVIGFDRKEGCRDITRRYCQWFNSKTRKKRITKEAFGERW 412
           +  SK EP GV+ CKRN +RYVIG+DRK GCRD+TRRY +W+N+KTRKKRITKE  GE W
Sbjct: 352 KHRSKLEPHGVACCKRNNLRYVIGYDRKNGCRDVTRRYAEWYNAKTRKKRITKEPKGEEW 411

Query: 413 YERVLASLHKRKRTKIDDYEDAYFDQRNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLKS 472
           + +VL +LH+RKRTKIDDYEDAY +QR+ DE MPDN+QD K HPYY+LE D+R+NQVLK 
Sbjct: 412 FNKVLTTLHRRKRTKIDDYEDAYLEQRDYDEAMPDNLQDLKNHPYYILETDLRRNQVLKP 471

Query: 473 GCKECGYLKLHN----KTNQVLKVYSKKDIIDLKSAKQWYMEGRILKTGARALKTVEKKR 528
           G KE GYL L        N++LKVY +K+I+DLKSA+QWYMEGR+LKTG+R+LKTV+++ 
Sbjct: 472 GSKESGYLHLQGSKSKNKNKLLKVYERKNILDLKSARQWYMEGRVLKTGSRSLKTVKRRA 531

Query: 529 GRFTDPEEQEEERLYQFDDTELYVAPLATRSGEIETNTFGNIEVFVPSMIPANCCLVESP 588
            R +  +E++EERLY  DDT LYV PLAT  GEI  N +GNIEVFVP+MIP NCCL+ESP
Sbjct: 532 MRPSLDDEEDEERLYSIDDTVLYVPPLATSDGEITPNAYGNIEVFVPTMIPGNCCLIESP 591

Query: 589 VAIKAASFIRIKFAKAVTAFKFEKGRSVKPSITGVVVALWFRDALVAAIDGITQANAEEK 648
            AIKAA F+RI + +AVT FKFE+GR+ KP I GVVVA W+RDA+ + IDGI  +   +K
Sbjct: 592 YAIKAAKFLRINYGRAVTGFKFERGRTSKPIIGGVVVANWYRDAVKSCIDGIEYSVDNDK 651

Query: 649 HIEHELEALSYWHNLITKLRIKNKLNSEYGKVNEEESSTVVSQPLIANRFDEETSMTDSG 708
            +E ELE+L  WH L++KLRIK KL+  YG V EE  +       + N  DE+ +     
Sbjct: 652 KLEEELESLRCWHTLLSKLRIKKKLDVIYGTVGEENLN-------LGNVSDEDVA----- 699

Query: 709 DEFPQGGFLPTDINHDGTSHNETSDNEIEEPGGFVPTXXXXXXANPDADYHDNEIVGNGG 768
               +GG                        G FVP        N D+   DNE +   G
Sbjct: 700 ----EGG------------------------GFFVPRTESFPEPN-DSGTDDNEDINTRG 730

Query: 769 FITTRNQSPAGVTEYEEIKEPGDNLEPEDIDNQESHLDEDYKDFM 813
           F+ T  +      E  E  E  D     D       L++DY  FM
Sbjct: 731 FLLTNKRETGDSNESTERNESLDRQSTND-----DELEDDYDKFM 770

>Kwal_56.23417
          Length = 723

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/715 (43%), Positives = 433/715 (60%), Gaps = 54/715 (7%)

Query: 6   IPSEYFDLIRDVLKNKGDATQERPLXXXXXXXAVTSELESGYENPQPTEAKIVVNLDSDP 65
           +P EYFDL+R  +K      ++ P             L     N     A +++NLDSD 
Sbjct: 4   LPQEYFDLVRQAVKED----KQTP-------RRKRRRLPKYESNDISRPADVIINLDSDT 52

Query: 66  ELEDKL---GASNTISLVSDGEV-------QHTXXXXXXXXXXXXXXXXXXXXVSADEMQ 115
           + E K    G S +    S+ ++        +                     VS  ++ 
Sbjct: 53  DNETKFTSEGLSKSFESQSNRDLDDDNEKGSNNGGDYDDDDDDDEFNSDDFEDVSDADVS 112

Query: 116 MPSDNLSVTINVNXXXXXXXXXXXXXXXNMCSNEDRKFRTXXXXXXXXXXXXXXXIINHW 175
             + N  ++I +N               N+ SNE+RK+R                + N W
Sbjct: 113 EQTSNAELSITLNPQKPQKKTGSK----NLVSNEERKYRRYFHLLQLVTLMVHGYVRNQW 168

Query: 176 LNNSKMNRKLSGMIPEKVFDMLHPEKDEELPLRSTRKLLDGLKKAMEIWQKHWRIMQRYK 235
           LN++K+++KLS ++P+ VF++LHP++D+ELPLRSTRKLLDGLK+ MEIW KH+  + R++
Sbjct: 169 LNDAKLHQKLSKLVPDNVFELLHPKRDDELPLRSTRKLLDGLKRCMEIWWKHFDQITRWE 228

Query: 236 GVNCYMRYWDELQ-ICDKSRKTLTKNDFIKGILKGVGDRDVATQGFVALLRSCNVNARLV 294
               YM  WDEL    ++  + +++  F K +  G G  ++A QGFVA+LR+C VNARL+
Sbjct: 229 TPGLYMLDWDELDGPWEQPTRYMSQKLFNKKVAHGKGSSEIAAQGFVAMLRACGVNARLI 288

Query: 295 MSCQPPDFTNLKKSYGTEKKVSYE----------------------DMTKYPVFWCEVWD 332
           M+ QPPDFTN K S     K   E                      D  ++ +FWCEVWD
Sbjct: 289 MNAQPPDFTNNKVSARGSLKTPGEYLDKTDMRPKRRKKAKGGQRDPDAKRHVLFWCEVWD 348

Query: 333 KFSKKWITIDPFCKKTIEQVRLSSKFEPRGVSPCKRNAMRYVIGFDRKEGCRDITRRYCQ 392
           K SKKWIT+DP  ++TIEQ+R  +  +P+G S  + N  RY+I +DRK GCRD+TRRY  
Sbjct: 349 KVSKKWITVDPMGQRTIEQIRYKTALDPQG-SAKRNNLFRYIIAYDRKLGCRDVTRRYTT 407

Query: 393 WFNSKTRKKRITKEAFGERWYERVLASLHKRKRTKIDDYEDAYFDQRNQDEGMPDNMQDF 452
            FNSKTRK+RIT++A GE+W +RVLA LH+RKRT+ DD+EDAYF QR++ EG+PDNMQD 
Sbjct: 408 HFNSKTRKRRITRDAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGIPDNMQDL 467

Query: 453 KGHPYYVLEKDIRQNQVLKSGCKECGYLKLHNKTNQVLKVYSKKDIIDLKSAKQWYMEGR 512
           K HPYYVL+ D + N+VLKSGCKECG+L+  N T+  LKVY ++D++ LK+A+ WY EGR
Sbjct: 468 KNHPYYVLQNDFKWNEVLKSGCKECGFLRTKNNTS--LKVYRREDVLVLKTARTWYTEGR 525

Query: 513 ILKTGARALKTVEKKRGRFTDPEEQEEERLYQFDDTELYVAPLATRSGEIETNTFGNIEV 572
           +LK GA ALKT    + R     E  EERLY FD+TEL++      + E+ TN +GNI++
Sbjct: 526 VLKPGASALKTT---KSRDFKTGEATEERLYAFDETELFIPEDLGPNNEVPTNVYGNIDI 582

Query: 573 FVPSMIPANCCLVESPVAIKAASFIRIKFAKAVTAFKFEKGRSVKPSITGVVVALWFRDA 632
           +  SMIP   CL+ESPVA+KAA+ + I+FAKAVT FKFEK R  KP ITG+VV+  +R+A
Sbjct: 583 YTSSMIPRGSCLIESPVAVKAAACLGIEFAKAVTGFKFEKKRVAKPQITGIVVSQEYREA 642

Query: 633 LVAAIDGITQANAEEKHIEHELEALSYWHNLITKLRIKNKLNSEYGKVNEEESST 687
           + + IDG+  +  E++  E ELEAL +W+  + KLRIK +LN+ +GKV+    ST
Sbjct: 643 VESMIDGVEYSLEEDERQERELEALQHWNLFLAKLRIKQRLNTTHGKVSSATVST 697

>AGR162C [4473] [Homologous to ScYER162C (RAD4) - SH]
           (1049961..1052252) [2292 bp, 763 aa]
          Length = 763

 Score =  528 bits (1360), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 265/585 (45%), Positives = 369/585 (63%), Gaps = 33/585 (5%)

Query: 148 NEDRKFRTXXXXXXXXXXXXXXXIINHWLNNSKMNRKLSGMIPEKVFDMLHPEKDEELPL 207
           +E R FR                + N WLN+ ++  +L+ ++P++V+  +HPE+DE+LPL
Sbjct: 147 SETRAFRRSFHMLHVAALLAHYHVRNTWLNDGRLQSRLAALVPDEVYASMHPERDEQLPL 206

Query: 208 RSTRKLLDGLKKAMEIWQKHW-RIMQRYKGVNCYMRYWDEL-QICDKSRKTLTKNDFIKG 265
           RSTRKLLD L+K M++W+KH  RI+ R  G+  YMR W +L Q        LT+  F + 
Sbjct: 207 RSTRKLLDALRKCMKLWEKHCKRIIGRDGGL--YMRPWAQLGQRYSSGAALLTRKAFNRA 264

Query: 266 ILKGVG-DRDVATQGFVALLRSCNVNARLVMSCQPPDFTNLKKS---YGTEKKVSYEDMT 321
           + KG    R VA +GFVALLR C +NARLV S QPPD T++K +    G++     ED T
Sbjct: 265 LQKGAPMPRSVAQEGFVALLRGCGLNARLVASLQPPDLTDMKPAGDARGSDPPGDSEDDT 324

Query: 322 ---KYPVFWCEVWDKFSKKWITIDPFCKKTIEQVRLSSKFEPRGVSPCKRNAMRYVIGFD 378
              ++P+ WCEVWD++SK WIT+DP CK+ +EQVR  SK EP G    + N MRYV+GFD
Sbjct: 325 DKYEFPLVWCEVWDRYSKAWITVDPLCKQLVEQVRNKSKLEPTGKF-ARFNQMRYVVGFD 383

Query: 379 RKEGCRDITRRYCQWFNSKTRKKRITKEAFGERWYERVLASLHKRKRTKIDDYEDAYFDQ 438
           RK GCRDITRRYC  +N+K R++RIT++  G  WY+ +L +LH+RKR K DDYED YF +
Sbjct: 384 RKMGCRDITRRYCAQYNAKVRRRRITRDTHGAAWYDALLRALHQRKRMKTDDYEDEYFAR 443

Query: 439 RNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLKSGCKECGYLKLHN---KTNQVLKVYSK 495
           R++ EG+P+NM D + HP+YVLEKD+RQ+++L+   ++CGY++           LKV+ +
Sbjct: 444 RDEVEGIPNNMADLRNHPHYVLEKDLRQHEILRPATEQCGYVRFKTTKRSAGSTLKVFRR 503

Query: 496 KDIIDLKSAKQWYMEGRILKTGARALKTVEKKRGRFTDPEEQEEERLYQFDDTELYVAPL 555
            DI+   S + W+++G++L+   RA KTV  K  R     E EEERLY   +TE YV P 
Sbjct: 504 TDIVPCYSGRHWFLQGKVLRKNCRAAKTVIVKDHRTG---ESEEERLYPESETEPYVPPP 560

Query: 556 ATRSGEIETNTFGNIEVFVPSMIPANCCLVESPVAIKAASFIRIKFAKAVTAFKFEKGRS 615
               G I TN+FGNI+++ PSMIPA C L+E+P A++AA+FI + FAKAVT F FE+GR+
Sbjct: 561 VAPDGTIPTNSFGNIDIYKPSMIPAGCVLIENPNAVRAAAFIGVPFAKAVTGFSFERGRT 620

Query: 616 VKPSITGVVVALWFRDALVAAIDGITQANAEEKHIEHELEALSYWHNLITKLRIKNKLNS 675
           VKP  +GVVV   +RDA+ A IDGI     E +  E EL AL  W  L+ +LR+K +L  
Sbjct: 621 VKPKFSGVVVQSCYRDAVCAMIDGIETIGDEARMQERELGALQSWALLLAQLRVKQRLID 680

Query: 676 EYGKVNEEESSTVVSQPLIANRFDEETSMTDSGDEFPQGGFLPTD 720
            +G V+E  S +           D E   +D+      GGF P D
Sbjct: 681 RHGAVSEHTSDS-----------DSEPEASDT----EAGGFFPDD 710

>KLLA0F14465g 1341764..1344067 weakly similar to sp|P14736
           Saccharomyces cerevisiae YER162c RAD4 excision repair
           protein singleton, start by similarity
          Length = 767

 Score =  522 bits (1344), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 302/756 (39%), Positives = 430/756 (56%), Gaps = 54/756 (7%)

Query: 1   MSSDQIPSEYFDLIRDVLKNKGDATQERPLXXXXXXXAVTSELESGYENPQPTEAKIVVN 60
           M+  ++  EYFDLI+D L+ +                    E   G  +  P + + + +
Sbjct: 1   MNDGRLSREYFDLIKDALQEE--------------------EKTGGSGSSSPRKRRKLRS 40

Query: 61  LDSDPELEDKLGASN--TISLVSDGEVQHTXXXXXXXXXXXXXXXXXXXXVSADEMQMPS 118
           L  +PELE +   SN   I++ SD E Q+                        D    P+
Sbjct: 41  LQKEPELESE---SNRVVITIESDDEEQNNYDDDDDDDDDDDEYDSEEFEDVTD---APA 94

Query: 119 DNLSVTINVNXXXXXXXXXXXXXXXNMCSNEDRKFRTXXXXXXXXXXXXXXXIINHWLNN 178
           +N +++I ++               +      ++FR                  N W N+
Sbjct: 95  NNGNISITIDTSAQKKSTKKKKKTEHGLDPAVKEFRKTCHMFMLLTLVCHSYQRNEWCND 154

Query: 179 SKMNRKLSGMIPEKVFDMLHPEKDEELPLRSTRKLLDGLKKAMEIWQKHWRI--MQRYKG 236
            K+ +KL+ ++ + +F+ LHP+KD+E+PLRSTRKLLD L+  M+ W K +++     Y+ 
Sbjct: 155 EKLQKKLAKLVSDDIFNNLHPQKDDEMPLRSTRKLLDALRMLMKHWNKKFKLELTSPYEF 214

Query: 237 VNCYMRYWDELQICDKSRKTLTKNDFIKGILKGVGDRDVATQGFVALLRSCNVNARLVMS 296
            + YM +WD   +     +++T   F K   +  G  +++ QGFV +LR C +NARL+ S
Sbjct: 215 NHLYMVHWD--SVLKHKCESVTFKTFKKFFTRMRGPANISVQGFVTMLRGCGLNARLIHS 272

Query: 297 CQPPDFTNLKKSYGTEKKVSYE-DMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVRLS 355
            QPPDFT+  K Y      S E +  KYP+FWCEVWDKF+K+WITID   ++ IEQVR  
Sbjct: 273 LQPPDFTD-SKIYNKRVVWSLENECLKYPIFWCEVWDKFAKQWITIDIVGQEIIEQVRYK 331

Query: 356 SKFEPRGVSPCKRNAMRYVIGFDRKEGCRDITRRYCQWFNSKTRKKRITKEAFGERWYER 415
           SK EP G      N MRYVI FDRK+GC+D++RRY     +K RKKRIT+EA    W+  
Sbjct: 332 SKLEPIGRINSAFNMMRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWFNS 391

Query: 416 VLASLHKRKRTKIDDYEDAYFDQRNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLKSGCK 475
           ++  L+KR R +IDDYED YFD RN+ EG+PD++QD K HP+YVLEKD+R NQVLK G +
Sbjct: 392 IIKFLNKRNRNRIDDYEDEYFDLRNEHEGIPDSLQDIKNHPFYVLEKDLRANQVLKPGAQ 451

Query: 476 ECGYLKLHNKTNQVLKVYSKKDIIDLKSAKQWYMEGRILKTGARALKTVEKKRGRFTDP- 534
           +CG+L+L NK+N +LKV+ +KD+I   SA+ WYM+GR LK+GA+ L T      +  +P 
Sbjct: 452 QCGFLRLRNKSNSLLKVFPRKDVISCYSARHWYMQGRALKSGAKHLLT-----HKIKNPV 506

Query: 535 -EEQEEERLYQFDDTELYVAPLATRSGEIETNTFGNIEVFVPSMIPANCCLVESPVAIKA 593
            E+++EERLY    TE  +       G+I TN +GNI+++ P MIP  CCLVE+P +IKA
Sbjct: 507 EEDEDEERLYPIGQTEYVIPKQVDADGKIPTNFYGNIDIYKPWMIPIGCCLVENPNSIKA 566

Query: 594 ASFIRIKFAKAVTAFKFEKGRSVKPSITGVVVALWFRDALVAAIDGITQANAEEKHIEHE 653
           ASF+R+ FAKAVT FKFE GR VKP +TGVVV   + DALVA I+ I + N +    E E
Sbjct: 567 ASFLRVPFAKAVTGFKFESGRRVKPKVTGVVVENEYVDALVAVIENIEECNDDAARHELE 626

Query: 654 LEALSYWHNLITKLRIKNKLNSEYGKVNEEESSTVVSQPLIANRFDEETSMTDSGDE--- 710
           LEAL+ W  L+TKLRIK++L  E+G V +E+      +    +  ++  S T    E   
Sbjct: 627 LEALNGWSLLLTKLRIKSRLVEEHGAVADEDGRDYSGER--DSDLEDHESYTGEDTEMGG 684

Query: 711 FPQGGFLPTDINHDG-------TSHNETSDNEIEEP 739
           F QGGFL  D N DG         H E+   ++E P
Sbjct: 685 FEQGGFL-LDSNMDGGFVPEPELQHAESETEQVEHP 719

>CAGL0H07293g 713669..715675 similar to tr|Q06665 Saccharomyces
           cerevisiae YDR314c, hypothetical start
          Length = 668

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 111/472 (23%), Positives = 197/472 (41%), Gaps = 84/472 (17%)

Query: 271 GDRDVATQGFVALLRSC-----NVNARLVMSC-------QPPDFTNLKKSYGTEKKVSYE 318
            +RD  T  F+ +LR         + RL  S         P + T L      +    ++
Sbjct: 219 ANRDYLTLFFITILREILPADQIKSLRLCFSLPLHNFQISPRNITKLASRDAGKVPNRFD 278

Query: 319 DMTKYPVFWCEVW--DKFSKKWITIDPFCKKTIEQVRLSSKF---EPRGV-SPCK----- 367
                P FW E+   D+  K ++ IDP     IE+  +  K+   EP  +  P K     
Sbjct: 279 TDLLQPYFWIELHTIDEPDKLYV-IDPVVH--IEEGNIVKKYNIDEPVDIFEPIKDLNLN 335

Query: 368 -RNAMRYVIGFDRKE-GCRDITRRYC----QWFNSKTRKKRI--TKEAFGERWYERVLAS 419
                +YVI  D K+   RD++ RY       +  +TR   +  T+++    ++ RVL S
Sbjct: 336 VNQWFQYVISCDAKDMTIRDVSARYIPDIYYRYYDRTRGSVLETTRQSKSHHFFMRVLKS 395

Query: 420 LHKRKRTKIDDYEDAYFDQRNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLKSGCKECGY 479
             + +    +D          ++  +P ++ + K  P +   + ++Q++ + S  K  G 
Sbjct: 396 TSRYR----NDNTVLMKTIAAKNYKLPKSISELKRSPNFKGLRILKQSETVSSKAKPVGK 451

Query: 480 LKLHNKTNQVLKVYSKKDIIDLKSAKQWYMEGRILKTGARALKTVE---KKRGRFTDPEE 536
           ++   K +   K+Y   DI+ LK+ + WY+ GR +K  A+ ++T     +KR   +  +E
Sbjct: 452 VQYGGKKD---KIYRISDILPLKTRQHWYLLGRTVKEDAKPIRTKTIPLRKRNAISSAQE 508

Query: 537 QEEER-LYQFDDTEL---YVAPLATRSG--------EIETNTFGNIEVFVPSMIPANCCL 584
               R L+ ++ T+L   Y +      G        +   N + N+E++  S+IP    L
Sbjct: 509 LNFARELFSYEQTDLTPKYPSSYKDVYGIYHVVCDVDFYKNKYKNVEIYSKSVIPTGFRL 568

Query: 585 VES---------PVAIKAASFIR-------IKFAKAVTAFKFEKGRSVKPSITGVVVALW 628
           + +            IK A+  +       IK+   V+ F F KG++       +V  + 
Sbjct: 569 MRTFDKDYKFDLRRLIKNANVEKGKKGQKLIKYLDVVSGFDFRKGQATPIKTHILVNYMD 628

Query: 629 FRDALVAAIDGITQANAEEKHIEHELEALSYWHNLITKLRIKNKLNSEYGKV 680
           +R  L    D I            EL  L  W N IT+L+IK +L  +YGK+
Sbjct: 629 YRKILSLQKDYI------------ELLRLESWSNFITRLKIKCELEDKYGKL 668

>YDR314C (YDR314C) [1142] chr4 complement(1090426..1092504) Member
           of the DNA repair protein Rad4 family, has low
           similarity to uncharacterized C. albicans Orf6.3103p
           [2079 bp, 692 aa]
          Length = 692

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 118/274 (43%), Gaps = 52/274 (18%)

Query: 445 MPDNMQDFKGHPYYVLEKDIRQNQVLKSGCKECGYLKLHNKTNQVLKVYSKKDIIDLKSA 504
           +P ++ + K    +V+   ++ N+VLK+  K+       + + +   ++ ++D+I LKS 
Sbjct: 434 LPKSVTEIKRTDNFVIPSLLKSNEVLKACAKQAATFTKGDNSQE--PIFWRRDVIQLKSK 491

Query: 505 KQWYMEGRILKTGARALKTVEKKRGRFTDPEEQEEERLYQFDDTELYVAPLATRSGEIET 564
           + W + GR +   A+ LK     R ++    E+    L ++   EL+      +S +  +
Sbjct: 492 QHWAILGRSILPNAQPLK-----RKKYLPMRERMVRNLDKYVIKELFSYEQTMKSPKYPS 546

Query: 565 -------------------NTFGNIEVFVPSMIPANCCLVESPVAIKAASFIR------- 598
                              N FGNIE++     P    L+     +     I+       
Sbjct: 547 TYCDHLGQEHVITDLSHYKNKFGNIEIYSKETKPDGFELIPLSKEVDIKCLIKEYNKGKR 606

Query: 599 ----IKFAKAVTAFKFE--KGRSVKPSITGVVVALWFRDALVAAIDGITQANAEEKHIEH 652
               IK+   V+ F F+  KG ++ P I  ++V    ++    A+  + Q          
Sbjct: 607 KMQKIKYLDVVSGFDFKQKKGHAI-PKIESILV----KETDYKAVQLLKQQTKV------ 655

Query: 653 ELEALSYWHNLITKLRIKNKLNSEYGKV-NEEES 685
            L  LS+W  L+ KLR+ ++LN+EYG V N EE+
Sbjct: 656 -LLGLSFWDILLRKLRVNDRLNAEYGNVGNNEET 688

>Sklu_2426.2 YDR314C, Contig c2426 795-2789 reverse complement
          Length = 664

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 91/474 (19%), Positives = 173/474 (36%), Gaps = 85/474 (17%)

Query: 270 VGDRDVATQGFVALLRSC---NVNARLVMSCQPPDFTNLKKSYGTEKKVS-------YED 319
           + +RD     F  +L++      + RL  +   P+F  +     ++ K         Y+ 
Sbjct: 208 MANRDYLVLFFFIILKNLLGDERDLRLCFALPLPEFQIMPAKVASQIKTGVGRVPNRYDT 267

Query: 320 MTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVRLSSKFEPRGVSPCKR----------N 369
               P FW E   K       IDP     ++Q R+  K       P  +           
Sbjct: 268 DLLSPYFWIEC--KVRDDLYIIDPIV--NVDQKRIVMKARADEYVPHIKPLDDLKINYTQ 323

Query: 370 AMRYVIGFDRKEGCRDITRRYC-----QWFNSKT---RKKRITKEAFGERWYERVLASLH 421
              Y++         D++ RY      ++FN+ +      +  K +   R + R   ++ 
Sbjct: 324 RFHYIVSIANDMHMMDVSPRYLDNICYRYFNTPSTVFSSSKPLKSSILFRKFLRKYGTIE 383

Query: 422 KRKRTKIDDYEDAYFDQRNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLKSGCKECGYLK 481
           K K        ++  D   Q+  +P  +   K    + +   ++ N+V+ +  +  G   
Sbjct: 384 KSKEY------NSLVDLALQNYKIPKTLIGMKRSDNFTMPSLLKANEVISASTRPVGTFC 437

Query: 482 LHNKTNQVLKVYSKKDIIDLKSAKQWYMEGRILKTGARALKTVEKKRGRFTDPEEQEEER 541
              +T +   VY KKDI+ LKS + W + GR +K  A     V  K  +    + + E+R
Sbjct: 438 RGQQTEEY--VYWKKDILRLKSRQHWALLGRTVKMDA-----VPMKSKKVHTMKMRREKR 490

Query: 542 LYQFDDTELYVAPLATRSGEIET-------------------NTFGNIEVFVPSMIPANC 582
           LY ++  ELY       + ++                     N  G++E++  ++ P   
Sbjct: 491 LYMYEIRELYAFEQTIATPKMNNTYLTSVGGRGLITDVYHFKNAHGHVEIYNANLKPDG- 549

Query: 583 CLVESPVAIKAASFIRIKFAKAV-TAFKFEKGRSVKPSI--------TGVVVALWFRDAL 633
              E   A K    +  ++ + +     F K + V P +          VV    F+   
Sbjct: 550 --FEMFAATKETKLLIRQYNRDIRKGIGFLKDKYVVPKLQCLEPLKFLDVVSGFDFKQTP 607

Query: 634 VAAIDGITQANAEEKHI---------EHELEALSYWHNLITKLRIKNKLNSEYG 678
             A+  + Q                   EL+ L+YW NL+  L++K +++ +YG
Sbjct: 608 GYAVPVLNQILVNHNDFCRLELLIGQNRELQNLNYWQNLLQALQVKRRIDKQYG 661

>CAGL0H05753g complement(569862..570908) similar to tr|Q02890
           Saccharomyces cerevisiae YPL096w PNG1, hypothetical
           start
          Length = 348

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 80/174 (45%), Gaps = 31/174 (17%)

Query: 302 FTNLKKSYGTEKKVSY--EDMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVRLSSKFE 359
           FT + KS+G E +  +  ED       WCE +  + K+WI +D  C+++ +        E
Sbjct: 184 FTLVLKSFGLESRYIWNREDHV-----WCEYYSPYLKRWIHVDS-CEQSFD--------E 229

Query: 360 PRGVSPCKRNAMRYVIGFDRKEGCRDITRRYCQWFNSKTRKKRITKEAFGERWYERVLAS 419
           P   S     +M Y IGF R  G  D+++RY         + ++ ++   E   + +  +
Sbjct: 230 PFIYSKNWNKSMSYCIGFWRY-GVVDVSKRY-------ILQNQLPRDIIKEDDLQFLCHA 281

Query: 420 LHKRKRTKIDDYEDAYFDQRNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLKSG 473
           L KR RT + D E      R       D+++  + +P     K++++ ++ K+G
Sbjct: 282 LTKRLRTGLSDDESYKMYCR-------DDLEQLELNPSATPTKEMQKLKISKTG 328

>Kwal_27.12204
          Length = 368

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 13/89 (14%)

Query: 302 FTNLKKSYGTEKKVSYEDMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVRLSSKFEPR 361
           FT + KS+G E +  +    +    WCE +  F K+W+ +D  C+++ +        EP 
Sbjct: 204 FTLILKSFGIEARYVW---NREDHVWCEFYSTFLKRWVHVDA-CEQSFD--------EPH 251

Query: 362 GVSPCKRNAMRYVIGFDRKEGCRDITRRY 390
             S      M YVI F+    C D+++RY
Sbjct: 252 IYSVNWNKKMSYVIAFE-PYSCVDVSKRY 279

>ABR193W [787] [Homologous to ScYPL096W (PNG1) - SH]
           complement(768355..769407) [1053 bp, 350 aa]
          Length = 350

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 17/91 (18%)

Query: 302 FTNLKKSYGTEKKVSY--EDMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVRLSSKFE 359
           F  + +S+G E + ++  ED       WCEV+    K+W+ +D  C+K+ +        E
Sbjct: 190 FMLILRSFGIEARYTWNREDHV-----WCEVYSNALKRWVHVDS-CEKSFD--------E 235

Query: 360 PRGVSPCKRNAMRYVIGFDRKEGCRDITRRY 390
           P   S     AM YVI F  +   +D++RRY
Sbjct: 236 PHIYSVNWNKAMSYVIAFSNR-SVKDVSRRY 265

>Scas_700.2
          Length = 351

 Score = 36.6 bits (83), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 72/165 (43%), Gaps = 27/165 (16%)

Query: 302 FTNLKKSYGTEKKVSY--EDMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVRLSSKFE 359
           FT + KS+G E +  +  ED       WCE +  +  +W+ +D  C+++ +Q        
Sbjct: 188 FTLVLKSFGLEARYVWNREDHV-----WCEYYSPYLNRWVHVDS-CEQSFDQ-------- 233

Query: 360 PRGVSPCKRNAMRYVIGFDRKEGCRDITRRYCQWFNSKTRKKRITKEAFGERWYERVLAS 419
           P   S     +M Y I F  K+   D+++RY         K  + ++   E   + +   
Sbjct: 234 PYIYSINWNKSMSYCIAFS-KDDVTDVSKRY-------ILKNELPRDQISELDLQFICTY 285

Query: 420 LHKR-KRTKIDD--YEDAYFDQRNQDEGMPDNMQDFKGHPYYVLE 461
           L KR +R + DD  +E    D+R + E MP   +  +  P   LE
Sbjct: 286 LTKRLRRQRTDDELFELFKRDERERFEWMPKVKKTEQKSPTKTLE 330

>YPL096W (PNG1) [5348] chr16 (366922..368013) Peptide:N-glycanase
           enzyme, may be involved in degradation of misfolded
           glycoproteins [1092 bp, 363 aa]
          Length = 363

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 17/91 (18%)

Query: 302 FTNLKKSYGTEKKVSY--EDMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVRLSSKFE 359
           FT + KS+G + +  +  ED       WCE +  F  +W+ +D  C+++ +Q        
Sbjct: 198 FTLILKSFGLDVRYVWNREDHV-----WCEYFSNFLNRWVHVDS-CEQSFDQ-------- 243

Query: 360 PRGVSPCKRNAMRYVIGFDRKEGCRDITRRY 390
           P   S      M Y I F  K+G  D+++RY
Sbjct: 244 PYIYSINWNKKMSYCIAFG-KDGVVDVSKRY 273

>Sklu_2405.11 YPL096W, Contig c2405 21404-22459 reverse complement
          Length = 351

 Score = 33.1 bits (74), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 17/91 (18%)

Query: 302 FTNLKKSYGTEKKVSY--EDMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVRLSSKFE 359
           F  L K++G E +  +  ED       WCE +    K+W+ +D  C+ + +Q        
Sbjct: 191 FMLLLKTFGVESRYIWNREDHV-----WCEFYSPNLKRWVHLDS-CEMSFDQ-------- 236

Query: 360 PRGVSPCKRNAMRYVIGFDRKEGCRDITRRY 390
           P   S      M YV+ F  K+G  DI++RY
Sbjct: 237 PYIYSINWGKKMSYVVAFG-KDGVADISQRY 266

>YHR061C (GIC1) [2349] chr8 complement(221535..222479) Putative
           effector of Cdc42p, important for bud emergence [945 bp,
           314 aa]
          Length = 314

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 85/200 (42%), Gaps = 28/200 (14%)

Query: 535 EEQEEERLYQFDDTELYVAPLATRSGEIETNTFGNIEVFVPSMIPANCCLVESP------ 588
           E+QE E+LY F   + ++   +T S E      G + V    +   N   ++ P      
Sbjct: 22  EDQEMEKLYGFQVRQRFMNGPSTDSDEDADEDLGIVLVDSKKLALPNKNNIKLPPLPNYM 81

Query: 589 ------------VAIKAASFIRIKFAKAVTAFKFEKGRSVKPSITGVVVALWFRDALVAA 636
                       +  K  +F+ +   K + + +    ++ K S     ++  F    ++ 
Sbjct: 82  TINPNINSNHKSLTNKKKNFLGMFKKKDLLSRRHGSAKTAKQS----SISTPFDFHHISH 137

Query: 637 IDGITQANAEEKHIE-HELEALSYWHNLITKLRIKNKLNSEYGKVNEEESSTVVSQPLIA 695
            +G  + N  E H E H++E+L  + +L  + R  + ++S+Y  V   +SS +VS   IA
Sbjct: 138 ANGKREDNPLESHEEKHDVESLVKFTSLAPQPRPDSNVSSKYSNVVMNDSSRIVSSSTIA 197

Query: 696 NRFDE-----ETSMTDSGDE 710
              D      ET+ T +G++
Sbjct: 198 TTMDSHHDGNETNNTPNGNK 217

>Scas_679.1
          Length = 370

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 81/191 (42%), Gaps = 42/191 (21%)

Query: 175 WLNNSKMNRKLSGMIPEKV---FDMLHPEKDEELPLRSTRKLLDGLKKAMEIW-QKHWRI 230
           W  + ++NR+L   +P+ +   FD    EK  E   +S R LL GL     +W + H++I
Sbjct: 138 WTKDERLNRRLRRSVPKMIHKKFDKWSKEKKPEKRSKSIRTLLIGL----VLWFRNHYQI 193

Query: 231 -----MQRYKGVNCYMRYWDEL-----------QICDKSRKTLTKNDFIKGIL---KGVG 271
                 Q +  +   ++Y DE             I   SR +L KND     L   K + 
Sbjct: 194 NSNGFRQNFNRLQYLVKYRDEQDELYKYILENPNIFYGSRPSL-KNDIDDVRLMAKKKMT 252

Query: 272 DRDVATQGFVALLR---SCNVNARLVMSCQPPDF----TNLKKSYGTEKKVS-----YED 319
            RD+    F  +L+   S + +  L  +   PD+    +N+K  +  E KV+     Y+ 
Sbjct: 253 TRDILVIFFFIILKNMLSLDCHIALCFALPLPDYEVSCSNVK--WQMENKVAVVPNKYDS 310

Query: 320 MTKYPVFWCEV 330
               P FW E+
Sbjct: 311 DLLKPYFWIEL 321

>YPL005W (AEP3) [5432] chr16 (548481..550301) Protein of unknown
           function [1821 bp, 606 aa]
          Length = 606

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%)

Query: 171 IINHWLNNSKMNRKLSGMIPEKVFDMLHPEKDEELPLRSTRKLLDGL 217
           I++H   N + + KL+G++ + +  +LHP     LPLRS +   D +
Sbjct: 182 ILSHTKFNFRSSSKLNGIVRKMLRHLLHPTNKTTLPLRSAQVYNDSI 228

>CAGL0J00583g 50462..52915 similar to sp|P18962 Saccharomyces
           cerevisiae YHR028c DAP2 dipeptidyl aminopeptidase,
           hypothetical start
          Length = 817

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 59/147 (40%), Gaps = 16/147 (10%)

Query: 389 RYCQWFNSKTRKKRIT-KEAFGERWYERVLASLHKRKRTKIDDYEDAYFDQRNQDEGMPD 447
           R    FN+ T+  ++  KE   + W+E    +L   K   +   ED Y D  N D     
Sbjct: 352 RLVLHFNADTKHAKVARKEPADDGWWEITHNTLRIAKDENMGIIEDGYVDVANIDG---- 407

Query: 448 NMQDFKGHPYYVLEKDIRQNQVLKSGCKEC--GYLKLHNKTNQVLKVYSKKDIIDLKSAK 505
                  H  Y    D +  QVL SG  E   G L  ++KT  +  + +++     KS +
Sbjct: 408 -----YNHLVYFSPADSKYPQVLTSGEWEVIDGTLAFNSKTGNLFFIGTREG----KSTE 458

Query: 506 QWYMEGRILKTGARALKTVEKKRGRFT 532
           +  +   I K       T + KRG +T
Sbjct: 459 RHLLYVNINKPKEVHQVTDDSKRGVYT 485

>ACR009W [1057] [Homologous to ScYEL062W (NPR2) - SH]
           complement(371964..374006) [2043 bp, 680 aa]
          Length = 680

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 69/170 (40%), Gaps = 28/170 (16%)

Query: 525 EKKRGRFTDPEEQEEERLYQFDDTELYVAPLATRSGEIETNTFGNIEVFVPSMIPANCCL 584
           E  + RF  P +  E+   +FD  + YV P +    ++ T  FG+              L
Sbjct: 30  EGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKLVTFKFGSYR------------L 77

Query: 585 VESPVAIKAASFIRIKFA-KAVTAFKFEKGRS-VKPSITGVVVALWF------------R 630
           V  PV IKA  + R  F+   V  F ++   S  +P+I  +   L              R
Sbjct: 78  VCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEEQSQMLSKVER 137

Query: 631 DALVAAIDGITQANAEEKHIEHELEALSYWHNLITKLRIKNKLNSEYGKV 680
           D +   +       AE+K  E + +A +  HNL  K R ++   ++Y ++
Sbjct: 138 DPVYYQLKTGETKAAEQKTEESDSKAKT--HNLDKKSRAQHNATTKYHEI 185

>Kwal_26.9464
          Length = 283

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 58/138 (42%), Gaps = 12/138 (8%)

Query: 613 GRSVKPSITGV-VVALWFRDALVAAIDGITQANAEEK-----HIEHELEALSYWHNLITK 666
           G+   PS +G   +A   ++AL AA  G  +  A E      HI+ E EA       +  
Sbjct: 143 GQESIPSFSGSDAIAKKEKEALGAA--GAVETTAVEATEVKGHIQPEFEATVAADEALKA 200

Query: 667 LRIKNKLNSEYGKVNEEESSTVVSQPLIANRFDEETSMTDSGDEFPQGGFLPTDINHDGT 726
               +K+ S+ G ++    +  VS    A  +  E+ +T++     +GG  P + N  G 
Sbjct: 201 KTQDDKMESQAGSID----APAVSPVTPAANYSHESQVTENEGHKEKGGDKPAEANIPGV 256

Query: 727 SHNETSDNEIEEPGGFVP 744
           +  E+   E   P   VP
Sbjct: 257 NDAESHKPEDASPSVIVP 274

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,348,526
Number of extensions: 1174303
Number of successful extensions: 3768
Number of sequences better than 10.0: 36
Number of HSP's gapped: 3842
Number of HSP's successfully gapped: 41
Length of query: 813
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 703
Effective length of database: 12,788,129
Effective search space: 8990054687
Effective search space used: 8990054687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)