Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L11704g33631811351e-156
YER161C (SPT2)3332863476e-38
Scas_576.23493083181e-33
Kwal_56.234133152912258e-21
AGR161C3373051852e-15
KLLA0F14487g30221840.017
KLLA0C16797g98066663.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L11704g
         (331 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L11704g complement(1248417..1249427) similar to sp|P06843 S...   441   e-156
YER161C (SPT2) [1589] chr5 complement(499342..500343) HMG-like c...   138   6e-38
Scas_576.2                                                            127   1e-33
Kwal_56.23413                                                          91   8e-21
AGR161C [4472] [Homologous to ScYER161C (SPT2) - SH] (1048663..1...    76   2e-15
KLLA0F14487g 1344298..1345206 weakly similar to sp|P06843 Saccha...    37   0.017
KLLA0C16797g 1466983..1469925 similar to sp|P38713 Saccharomyces...    30   3.1  

>CAGL0L11704g complement(1248417..1249427) similar to sp|P06843
           Saccharomyces cerevisiae YER161c SPT2 multifunctional
           HMG-like chromatin protein, start by similarity
          Length = 336

 Score =  441 bits (1135), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 235/318 (73%), Positives = 235/318 (73%)

Query: 1   MSFLSKLSELKKTKPKTVISPPQKANKQEEISLLPKNYVREEDPAVTXXXXXXXXXXXXN 60
           MSFLSKLSELKKTKPKTVISPPQKANKQEEISLLPKNYVREEDPAVT            N
Sbjct: 1   MSFLSKLSELKKTKPKTVISPPQKANKQEEISLLPKNYVREEDPAVTRLKELRRQELLKN 60

Query: 61  PELAKKKQKQVRKTPSSSKASTGKKDKNGDDNMLVSRFKRKVGSDXXXXXXXXXXXXXXX 120
           PELAKKKQKQVRKTPSSSKASTGKKDKNGDDNMLVSRFKRKVGSD               
Sbjct: 61  PELAKKKQKQVRKTPSSSKASTGKKDKNGDDNMLVSRFKRKVGSDKPAVPIQVKKKPQPI 120

Query: 121 XXLSFEELMKQAENNQTIPVSKDTQSNGAGEKIKGSAKLNKPGFKTSRPKSLSPTTHINK 180
             LSFEELMKQAENNQTIPVSKDTQSNGAGEKIKGSAKLNKPGFKTSRPKSLSPTTHINK
Sbjct: 121 KKLSFEELMKQAENNQTIPVSKDTQSNGAGEKIKGSAKLNKPGFKTSRPKSLSPTTHINK 180

Query: 181 TDHGKDKSTAKEKSEPVVKIGIPKFAQPNERLKKKLEMRQRVNKSRRYXXXXXXXXXXXX 240
           TDHGKDKSTAKEKSEPVVKIGIPKFAQPNERLKKKLEMRQRVNKSRRY            
Sbjct: 181 TDHGKDKSTAKEKSEPVVKIGIPKFAQPNERLKKKLEMRQRVNKSRRYEDEEDDMDDFIE 240

Query: 241 XXXXXYSSYRTTSKDPGYDRDEIWAMFNKGRKRSXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                YSSYRTTSKDPGYDRDEIWAMFNKGRKRS                          
Sbjct: 241 DDEEEYSSYRTTSKDPGYDRDEIWAMFNKGRKRSYNEYMDYEEEDDFDAMEANEMEILEE 300

Query: 301 XXXXXXXXXXXDKREEAW 318
                      DKREEAW
Sbjct: 301 EEEAARMARLEDKREEAW 318

>YER161C (SPT2) [1589] chr5 complement(499342..500343) HMG-like
           chromatin protein that interacts with Snf1p through a
           conserved domain, negative regulator of HO gene
           transcription [1002 bp, 333 aa]
          Length = 333

 Score =  138 bits (347), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 142/286 (49%), Gaps = 21/286 (7%)

Query: 1   MSFLSKLSELKK--TKPKTVISPPQKANKQEEISLLPKNYVREEDPAVTXXXXXXXXXXX 58
           MSFLSKLS+++K  T  K  +  P      EE SLLPKNY+R+EDPAV            
Sbjct: 1   MSFLSKLSQIRKSTTASKAQVQDPLPKKNDEEYSLLPKNYIRDEDPAVKRLKELRRQELL 60

Query: 59  XNPELAKKKQKQVRKTPSSSKASTGKKDKNGDD-NMLVSRFKRKVGSDXXXXXXXXXXXX 117
            N  LAKK   + RK  +SS +   K ++N DD   L  RFKR +G+             
Sbjct: 61  KNGALAKKSGVK-RKRGTSSGSEKKKIERNDDDEGGLGIRFKRSIGASHAPLKPVVRKKP 119

Query: 118 XXXXXLSFEELMKQAENNQTIPVSKDTQSNGAGEKIKGSAKLNKPGFKTS-RP-KSLSPT 175
                +SFEELMKQAENN+  P    +      E+       NKPGFK+S RP K  SP 
Sbjct: 120 EPIKKMSFEELMKQAENNEKQPPKVKSSEPVTKER----PHFNKPGFKSSKRPQKKASPG 175

Query: 176 THINKTDHGKDKSTAKEKSEPVVKIGIPK--FAQPNERLKKKLEMRQRVNKSRRYX---- 229
             +     G +   + +  +P VK+ +P   FAQPN RLK+KLE R++ +   RY     
Sbjct: 176 ATLRGVSSGGNSIKSSDSPKP-VKLNLPTNGFAQPNRRLKEKLESRKQKS---RYQDDYD 231

Query: 230 -XXXXXXXXXXXXXXXXYSSYRTTSKDPGYDRDEIWAMFNKGRKRS 274
                            Y S    S  PGYDRDEIWAMFN+G+KRS
Sbjct: 232 EEDNDMDDFIEDDEDEGYHSKSKHSNGPGYDRDEIWAMFNRGKKRS 277

>Scas_576.2
          Length = 349

 Score =  127 bits (318), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 116/308 (37%), Positives = 151/308 (49%), Gaps = 46/308 (14%)

Query: 1   MSFLSKLSELKKT-------KPKTVISPPQKANKQEEI-SLLPKNYVREEDPAVTXXXXX 52
           MSFLSKLS+LKK        K  +  S P+K + +E+I SLLP NY+R+EDPAV      
Sbjct: 1   MSFLSKLSQLKKASTTNTSMKNTSKESIPRKKSIEEDIPSLLPTNYIRDEDPAVRRLKEL 60

Query: 53  XXXXXXXNPELAKKKQKQVRKTPSSSKASTGKKDKNGDDNMLV---SRFKRKVGSDXXXX 109
                  N E AKK +K     PS+   +T +K K  DDN+     SRFK+K+GS     
Sbjct: 61  RRKEQIKNGEFAKKHKKT---NPST---TTKRKSKKDDDNLAADGYSRFKKKLGSTHTRP 114

Query: 110 XXXXXXXXXXX--XXLSFEELMKQAENNQTIPVSKDTQSNGAGEKIKGSA---KLNKPGF 164
                          +SF+ELMKQAENN     S    S G  +K   SA    L+KPGF
Sbjct: 115 TPVRTLTRKMEPIKKISFDELMKQAENN----ASSKESSEGISKKESPSASRPHLHKPGF 170

Query: 165 KTSRPKSL--SPTTHINKTDHGKDKSTAKEKSEP------VVKIGIPKFAQPNERLKKKL 216
           +++R ++    P  H   T   K  S +  ++ P       +KI +P  AQPN+RLK++L
Sbjct: 171 RSARDRNRVSKPVKH-QTTLPRKKMSLSPIRNRPGSRDATPIKISLP-VAQPNQRLKQRL 228

Query: 217 EM-RQRVNKSRRY---------XXXXXXXXXXXXXXXXXYSSYRTTSKDPGYDRDEIWAM 266
           E  RQR +   RY                          +   +    DPGYDRDEIWAM
Sbjct: 229 ESKRQRPSGRDRYGRPEYDYDDEDDMDDFIEDDEEDSEVHRRMKLHRDDPGYDRDEIWAM 288

Query: 267 FNKGRKRS 274
           FNKGRKRS
Sbjct: 289 FNKGRKRS 296

>Kwal_56.23413
          Length = 315

 Score = 91.3 bits (225), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 86/291 (29%), Positives = 136/291 (46%), Gaps = 49/291 (16%)

Query: 1   MSFLSKLSELKK------------TKPKTVISPPQKANKQEEISLLPKNYVREEDPAVTX 48
           MSFL+K S+L+K             K ++ ++  Q+   ++E SLLP+ YVREEDPA+  
Sbjct: 1   MSFLAKFSQLRKKPAAGNDARGSEQKRQSKLNESQEDPLRDESSLLPQKYVREEDPAIRR 60

Query: 49  XXXXXXXXXXXNPELAKKKQKQVRKTPSSSKASTGKKDKNGDDNMLVSRFKRKVGSDXXX 108
                        EL +K+Q  ++  P +  A+  +K K+ +     ++F+RKVG     
Sbjct: 61  LK-----------ELRRKEQ--LKNAPKNKPAAPSRKRKDENSANTETKFRRKVGESLQS 107

Query: 109 XXXXXXXXXXXXXXLSFEELMKQAE----NNQTIPVSKDTQSNGAGEKIKGSAKLNKPGF 164
                         LSF+ELMK+AE    N  T P+  D+ S     +     +L +PGF
Sbjct: 108 RKPVAPVKRTPLKKLSFDELMKEAEEKSKNPSTDPI--DSTSRSKALQNNPPVRLQRPGF 165

Query: 165 KTSRPKSLSPTTHINKTDHGKDKSTAKEKSEPVVKIGIPK--FAQPNERLKKKLEMRQRV 222
           K++  +   P +    T   K KS      E + ++  P+   AQP  +LK+KLE  ++ 
Sbjct: 166 KSAARRDRKPLSTPKIT---KQKSPV----ESLQRLPAPRPSIAQPGAKLKRKLENLKKH 218

Query: 223 NKSRRYXXXXXXXXXXXXXXXXXYSSYRTTSKDPGYDRDEIWAMFNKGRKR 273
            ++ RY                         ++ G++RDEIWAMFNKG+KR
Sbjct: 219 RQTDRYRSSEEEDM---------DDFIEDDEEEQGFNRDEIWAMFNKGKKR 260

>AGR161C [4472] [Homologous to ScYER161C (SPT2) - SH]
           (1048663..1049676) [1014 bp, 337 aa]
          Length = 337

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 129/305 (42%), Gaps = 57/305 (18%)

Query: 1   MSFLSKLSELKKTKPKTVISPPQ-KANKQEE-------ISLLPKNYVREEDPAVTXXXXX 52
           MSFL+KLS+LKK+   +  +    KA K+E+         +LP+ YVR+EDPA+      
Sbjct: 1   MSFLAKLSQLKKSTTSSTDTGSGSKATKKEDNPSLDFKSPILPEYYVRKEDPAIRRLKE- 59

Query: 53  XXXXXXXNPELAKKKQKQVRKTPSSSKASTGKKDKNGDDNMLVSRFKRKVGSDX------ 106
                       K++Q+Q+RK      +S  +   NG +  + S   R+ GS        
Sbjct: 60  ------------KRRQEQLRKGTLKKASSQRRSKANGGE--VASGGVRQEGSTRWKLPRP 105

Query: 107 XXXXXXXXXXXXXXXXLSFEELMKQAENNQTIPVSKDTQSNGAGEKIKGSAKLNKPGFKT 166
                           LSFEELMKQAE     P +   ++  AG     +  ++KPGFK 
Sbjct: 106 KSTVVAAAAPAPPLKKLSFEELMKQAEEKAKSPAASGKRTAPAGPS---APAVSKPGFK- 161

Query: 167 SRPKSLSPTTHINKTDHGKDK---------------STAKEKSEPVVKIGIPK---FAQP 208
             P+S S    +     G DK               S    K++  + I +P     A+P
Sbjct: 162 --PRSNSGAAVVGGKVAGADKGARNGGADRTAHAPNSARGMKAKQAIAIDLPSGGGLAKP 219

Query: 209 NERLKKKLEMRQRVNKSRRYXXXXXXXXXXXXXXXXXYSSYRTTSKDPGYDRDEIWAMFN 268
           NE+L++ LE ++R    R+                             GYD++EIW++FN
Sbjct: 220 NEKLRRILEKQER----RKRSAGEYEEDDSDLDDFIADDDGEEEGGSYGYDKEEIWSIFN 275

Query: 269 KGRKR 273
           KGR+R
Sbjct: 276 KGRRR 280

>KLLA0F14487g 1344298..1345206 weakly similar to sp|P06843
           Saccharomyces cerevisiae YER161c SPT2 multifunctional
           HMG-like chromatin protein singleton, start by
           similarity
          Length = 302

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 17/21 (80%)

Query: 253 SKDPGYDRDEIWAMFNKGRKR 273
           SK   YDRDEIW++FNKG KR
Sbjct: 227 SKSQPYDRDEIWSIFNKGSKR 247

>KLLA0C16797g 1466983..1469925 similar to sp|P38713 Saccharomyces
           cerevisiae YHR073w OSH3, start by similarity
          Length = 980

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 163 GFKTSRPKSLSPTTHINKTDHGKDKSTAKEKSEPVVKIGI---PKFAQPNERLKKKLEMR 219
           GF   R    S TT +++T+HG  K+++   + P+++I     P  A  +    K + ++
Sbjct: 36  GFGIYRRFGGSSTTDLSETNHGSVKASSNSNTNPLIRISTDAKPNVALADHEKDKNVPLQ 95

Query: 220 QRVNKS 225
            R+ +S
Sbjct: 96  TRLAQS 101

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.306    0.124    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,303,987
Number of extensions: 299697
Number of successful extensions: 959
Number of sequences better than 10.0: 20
Number of HSP's gapped: 936
Number of HSP's successfully gapped: 21
Length of query: 331
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 229
Effective length of database: 13,065,073
Effective search space: 2991901717
Effective search space used: 2991901717
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 62 (28.5 bits)