Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L09999g1341326211e-84
YOR044W157581557e-14
Scas_699.46d188531491e-12
YDR275W (BSC2)23523680.27
AEL160C79341660.55
ACR081C9627601.3
Kwal_55.2160316418602.6
YDR389W (SAC7)65447594.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L09999g
         (132 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L09999g 1072123..1072527 some similarities with tr|Q08416 S...   243   1e-84
YOR044W (YOR044W) [4855] chr15 (413006..413479) Protein of unkno...    64   7e-14
Scas_699.46d                                                           62   1e-12
YDR275W (BSC2) [1105] chr4 (1012244..1012951) Protein of unknown...    31   0.27 
AEL160C [2346] [Homologous to ScYBR276C (PPS1) - SH] (330423..33...    30   0.55 
ACR081C [1128] [Homologous to ScYOR044W - SH] (503388..503678) [...    28   1.3  
Kwal_55.21603                                                          28   2.6  
YDR389W (SAC7) [1217] chr4 (1252525..1254489) GTPase-activating ...    27   4.0  

>CAGL0L09999g 1072123..1072527 some similarities with tr|Q08416
           Saccharomyces cerevisiae YOR044w, start by similarity
          Length = 134

 Score =  243 bits (621), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 120/132 (90%), Positives = 120/132 (90%)

Query: 1   MVKDYXXXXXXXXXXXXQYSCYAAVALLLIPFLGLYAFDLFLYVYRLVDYSVRLITYRKK 60
           MVKDY            QYSCYAAVALLLIPFLGLYAFDLFLYVYRLVDYSVRLITYRKK
Sbjct: 1   MVKDYLLLLFRSFVLVVQYSCYAAVALLLIPFLGLYAFDLFLYVYRLVDYSVRLITYRKK 60

Query: 61  LTNREQQASTSSREHLTTEAGTQSTQKISRESGWGSKGLGAGKLFLFYDVGTRVVRHAIN 120
           LTNREQQASTSSREHLTTEAGTQSTQKISRESGWGSKGLGAGKLFLFYDVGTRVVRHAIN
Sbjct: 61  LTNREQQASTSSREHLTTEAGTQSTQKISRESGWGSKGLGAGKLFLFYDVGTRVVRHAIN 120

Query: 121 SIEGPKHSRTTK 132
           SIEGPKHSRTTK
Sbjct: 121 SIEGPKHSRTTK 132

>YOR044W (YOR044W) [4855] chr15 (413006..413479) Protein of
          unknown function [474 bp, 157 aa]
          Length = 157

 Score = 64.3 bits (155), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 41/58 (70%), Gaps = 4/58 (6%)

Query: 18 QYSCYAAVALLLIPFLGLYAFDLFLYVYRLVDYSVRLITYRKKLTNREQQASTSSREH 75
          QY C   +A LLIPFLGLYAFDLFLYVYR++ Y  ++  Y++KL     ++ T++R H
Sbjct: 17 QYICRTCIAFLLIPFLGLYAFDLFLYVYRMILYLSQMFNYKRKL----GRSKTNNRPH 70

>Scas_699.46d
          Length = 188

 Score = 62.0 bits (149), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%)

Query: 18 QYSCYAAVALLLIPFLGLYAFDLFLYVYRLVDYSVRLITYRKKLTNREQQAST 70
          QY CY  + +LLIPF+G Y+FDLFLY+YRL+ Y +  + Y++    R  +  T
Sbjct: 21 QYCCYIGIVILLIPFVGFYSFDLFLYIYRLLQYFIECLIYKRNQNKRLGKEET 73

>YDR275W (BSC2) [1105] chr4 (1012244..1012951) Protein of unknown
           function [708 bp, 235 aa]
          Length = 235

 Score = 30.8 bits (68), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 37  AFDLFLYVYRLVDYSVRLITYRK 59
           A DLFLY+ RL+DY  +L  Y +
Sbjct: 91  AIDLFLYMCRLLDYGCKLFHYNR 113

>AEL160C [2346] [Homologous to ScYBR276C (PPS1) - SH]
           (330423..332804) [2382 bp, 793 aa]
          Length = 793

 Score = 30.0 bits (66), Expect = 0.55,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 4/41 (9%)

Query: 64  REQQASTSSREHLTTEAGTQSTQKISRESGWGSKGLGAGKL 104
           R+QQ    SRE L    G   ++K+  E  WGS  + AG+L
Sbjct: 6   RKQQKRQKSREQL----GELESKKMEGEGVWGSGTIRAGRL 42

>ACR081C [1128] [Homologous to ScYOR044W - SH] (503388..503678)
          [291 bp, 96 aa]
          Length = 96

 Score = 27.7 bits (60), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 21 CYAAVALLLIPFLGLYAFDLFLYVYRL 47
          C     LLL P + +YA+D  LYV RL
Sbjct: 26 CKVLAWLLLGPLVAVYAYDFCLYVLRL 52

>Kwal_55.21603
          Length = 164

 Score = 27.7 bits (60), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 14/18 (77%)

Query: 31 PFLGLYAFDLFLYVYRLV 48
          P + LYA+D  LY++R+V
Sbjct: 36 PVIALYAYDFGLYMWRVV 53

>YDR389W (SAC7) [1217] chr4 (1252525..1254489) GTPase-activating
           protein for Rho1p [1965 bp, 654 aa]
          Length = 654

 Score = 27.3 bits (59), Expect = 4.0,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 42  LYVYRLVDYSVRLITYRKKLTNREQQASTSSREHLTTEAGTQSTQKI 88
           L V  L++YS +L+ +  KL  REQQ   S+ E+       Q T  I
Sbjct: 380 LVVEFLIEYSYKLLPHLLKLAKREQQERLST-ENKKNNGDKQKTDPI 425

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,268,361
Number of extensions: 106699
Number of successful extensions: 378
Number of sequences better than 10.0: 9
Number of HSP's gapped: 375
Number of HSP's successfully gapped: 9
Length of query: 132
Length of database: 16,596,109
Length adjustment: 90
Effective length of query: 42
Effective length of database: 13,480,489
Effective search space: 566180538
Effective search space used: 566180538
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)