Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L09933g40840216290.0
YOR042W (CUE5)4113406836e-86
Scas_699.454503466613e-82
KLLA0F15994g4273624476e-51
Kwal_55.215874643744322e-48
ACR083C3753342774e-27
YDR273W (DON1)365541581e-11
CAGL0M08580g197611072e-05
Scas_615.8d581461031e-04
Kwal_55.1991232765730.53
CAGL0E05060g109973701.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L09933g
         (402 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces...   632   0.0  
YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing ...   267   6e-86
Scas_699.45                                                           259   3e-82
KLLA0F15994g complement(1484383..1485666) weakly similar to sgd|...   176   6e-51
Kwal_55.21587                                                         171   2e-48
ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -...   111   4e-27
YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the p...    65   1e-11
CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08...    46   2e-05
Scas_615.8d                                                            44   1e-04
Kwal_55.19912                                                          33   0.53 
CAGL0E05060g complement(493133..496432) similar to sp|P53114 Sac...    32   1.4  

>CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces
           cerevisiae YOR042w, hypothetical start
          Length = 408

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/402 (80%), Positives = 323/402 (80%)

Query: 1   MGKKSQKAEKAEDKPVLEKETGEDLDSKQQEPIEEPXXXXXXXXXXXXXXXXXXXXXXGD 60
           MGKKSQKAEKAEDKPVLEKETGEDLDSKQQEPIEEP                      GD
Sbjct: 1   MGKKSQKAEKAEDKPVLEKETGEDLDSKQQEPIEEPVEVKQDKDEAKEEDLEEVKEDVGD 60

Query: 61  SAXXXXXXXXXXXXVENPLLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPE 120
           SA            VENPLLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPE
Sbjct: 61  SAKKDITEDTTTKKVENPLLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPE 120

Query: 121 SGKDIELPREPVQQNPSLPPRRKQTQLEQDEMLARQLDXXXXXXXXXXXXXXXXXXXXXN 180
           SGKDIELPREPVQQNPSLPPRRKQTQLEQDEMLARQLD                     N
Sbjct: 121 SGKDIELPREPVQQNPSLPPRRKQTQLEQDEMLARQLDKEYNRKRRGERRHHNEREAGRN 180

Query: 181 YERYNNDDLEEDSWSQFVEKDLPEITARAKGSLQETATKVGTWFNGVKKNFIGEGEENDS 240
           YERYNNDDLEEDSWSQFVEKDLPEITARAKGSLQETATKVGTWFNGVKKNFIGEGEENDS
Sbjct: 181 YERYNNDDLEEDSWSQFVEKDLPEITARAKGSLQETATKVGTWFNGVKKNFIGEGEENDS 240

Query: 241 AYYQDDSHGRDLDEDYGTYXXXXXXXXXXXXXDPGYRRGDEQRLNARHRFNSFGASATDD 300
           AYYQDDSHGRDLDEDYGTY             DPGYRRGDEQRLNARHRFNSFGASATDD
Sbjct: 241 AYYQDDSHGRDLDEDYGTYVEQQERRQRRGVQDPGYRRGDEQRLNARHRFNSFGASATDD 300

Query: 301 VEGGISLRXXXXXXXXXXXVPPQLPSRARSNDSKKDSEEVKPQEGKKDKVVAETTYIDTP 360
           VEGGISLR           VPPQLPSRARSNDSKKDSEEVKPQEGKKDKVVAETTYIDTP
Sbjct: 301 VEGGISLRDEEFGEDEDEEVPPQLPSRARSNDSKKDSEEVKPQEGKKDKVVAETTYIDTP 360

Query: 361 ENKEKTKRKWQPLPPEPLNATPTKVNASTKKNKNESEDEFLI 402
           ENKEKTKRKWQPLPPEPLNATPTKVNASTKKNKNESEDEFLI
Sbjct: 361 ENKEKTKRKWQPLPPEPLNATPTKVNASTKKNKNESEDEFLI 402

>YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing a
           CUE domain, has low similarity to uncharacterized C.
           albicans Orf6.1738p [1236 bp, 411 aa]
          Length = 411

 Score =  267 bits (683), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 162/340 (47%), Positives = 198/340 (58%), Gaps = 45/340 (13%)

Query: 76  ENPLLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIELPREPVQQN 135
           ENP+L +LK+AFPN+EE+Y+KAVIIASQG L PAFNALLFLSDPESGKDIELP +PV++N
Sbjct: 98  ENPILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDPESGKDIELPTQPVRKN 157

Query: 136 PSLPPRRKQTQLEQDEMLARQLDXXXXXXXX----------XXXXXXXXXXXXXNYERYN 185
           P  P RR+QTQLEQDE+LARQLD                                 E+++
Sbjct: 158 PEAPARRRQTQLEQDELLARQLDEQFNSSHSRRRNRDRATRSMHEQRRRRHNPNEREQHH 217

Query: 186 NDDLEEDSWSQFVEKDLPEITARAKGSLQETATKVGTWF-NGVKKNFIGEGEENDSAYYQ 244
            D  EEDSWSQFVEKDLPE+T RA  SLQ+TA KV  W  +  ++NF    E+N      
Sbjct: 218 EDSEEEDSWSQFVEKDLPELTDRAGRSLQDTANKVSNWISDAYRRNFASGNEQN------ 271

Query: 245 DDSHGRDLDEDYGTYXXXXXXXXXXXXXDPGYRRGDEQRLNARHRFNSFGASATDDV--E 302
           D+ HG    +++                  G +    Q+   R RFNSFG    DD    
Sbjct: 272 DNQHGHQDQQEWEPEIVDLSQ---------GGKNSRPQQP-ERRRFNSFGVQVGDDSLES 321

Query: 303 GGISLRXXXXXXXXXXXVPPQLPSRARSNDSKKDSEEVKPQEGKKDKVVAETTYIDTPEN 362
            GI+L            VPPQLP+R +S +S               KVVAETTYIDTP+ 
Sbjct: 322 HGITLH-NEDGFEDDEDVPPQLPTRTKSGESTG-------------KVVAETTYIDTPDT 367

Query: 363 KEKTKRKWQPLPPEPLNATPTKVNASTKKNKNESEDEFLI 402
             +TK+KWQPLPPEPL+ TPTKVNA ++  KN  EDEFLI
Sbjct: 368 --ETKKKWQPLPPEPLDTTPTKVNAVSRNKKNPDEDEFLI 405

>Scas_699.45
          Length = 450

 Score =  259 bits (661), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 171/346 (49%), Positives = 202/346 (58%), Gaps = 31/346 (8%)

Query: 76  ENPLLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIELPREPVQQN 135
           ENP+L QLKEAFPNIEE+YVK V+IASQGALDPAF ALLFLSDP S KDIELP +P+  N
Sbjct: 111 ENPILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKDIELPTKPIAAN 170

Query: 136 --PSLPPRRKQTQLEQDEMLARQLDXXXXXX------XXXXXXXXXXXXXXXNYERYNND 187
             P+LP RRK TQLEQD +LARQL+                                N+D
Sbjct: 171 ATPALPQRRKLTQLEQDALLARQLNEEYNKAHDPPRGAVRDNGRRTRPQQQRRQRTANDD 230

Query: 188 DL----EEDSWSQFVEKDLPEITARAKGSLQETATKVGTWFNGVKKNFIGEGEENDSAYY 243
           DL    E+DSW+QFVEKDLP+ITARAKGSLQETA KVG+WF+   KN IGE + N     
Sbjct: 231 DLDFSQEDDSWAQFVEKDLPDITARAKGSLQETAMKVGSWFS---KNVIGEEDPN----- 282

Query: 244 QDDSHGRDLDEDYGTYXXXXXXXXXXXXXDPGYRRGDEQRLNA-RHRFNSFGASATDDV- 301
           Q    G  ++   G                  Y++  +   N  R RFNSFGA   +D  
Sbjct: 283 QPQPQG--MNNRNGNSDFTDEQIKQQQKEWSYYQKQKKGPENPERRRFNSFGAQVGEDSL 340

Query: 302 -EGGISLRXXXXXXXXXXXVPPQLPSRARSNDSKKDSEEVKPQEGKKD--KVVAETTYID 358
              GI+L            VPPQLP+R +S DS   ++E       KD  KVVA+TT+ID
Sbjct: 341 ESHGIALHDNENLSDEDEDVPPQLPTREKSVDSNTQNDETNATATPKDKAKVVAQTTFID 400

Query: 359 TPENKEKTKRKWQPLPPEPLNATPTKVNASTK-KNKNESEDE-FLI 402
           TPE     K KWQP+ PEPLN TPTK+NAS + K KN  EDE FLI
Sbjct: 401 TPEG--SAKPKWQPVAPEPLNGTPTKINASGQAKIKNPDEDEDFLI 444

>KLLA0F15994g complement(1484383..1485666) weakly similar to
           sgd|S0005568 Saccharomyces cerevisiae YOR042w, start by
           similarity
          Length = 427

 Score =  176 bits (447), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 138/362 (38%), Positives = 172/362 (47%), Gaps = 100/362 (27%)

Query: 76  ENPLLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIELPREPVQQN 135
           ENP+L QLKEAFPNIEE+YVKAV+IASQG LDPAFNALLF+SDP+  K+  LP  PVQ  
Sbjct: 91  ENPMLKQLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFISDPDFEKEAPLPTRPVQA- 149

Query: 136 PSLPPRRK-QTQLEQDEMLARQLDX----XXXXXXXXXXXXXXXXXXXXNYER------- 183
           P+   RR+ +TQLEQDE LARQLD                         +YER       
Sbjct: 150 PTRGVRREPKTQLEQDEELARQLDKKFNKHGNSASERTARERRIRQRERDYERRYGAGAI 209

Query: 184 ----------YNN--DDLEEDSWSQFVEKDLPEITARAKGSLQETATKVGTWFNGVKKNF 231
                     Y+N  DD E+D +S FV+K+LP+I      ++QET  K+ TWF+G+ KN 
Sbjct: 210 PPKGRRDSDGYDNFEDDGEDDVFSNFVDKELPQIRENLNRNIQETGKKISTWFSGITKNL 269

Query: 232 IGEGEENDSAYYQDDSHGRDLDEDYGTYXXXXXXXXXXXXXDPGYRRGDEQRLNARHRFN 291
           +    ++D  Y    S  R                       P Y         ++ RFN
Sbjct: 270 V----DDDPNY----SESR-----------------------PKY---------SQSRFN 289

Query: 292 SFG---ASATDDVEG-------GISLRXXXXXXXXXXXVPPQLPSRARSNDSKKDSEEVK 341
           SFG       D+V+G       GISL            +PPQLPSRA+            
Sbjct: 290 SFGDRYRDGNDNVDGQTKLQNAGISLHNDDLDFGSDDDIPPQLPSRAK------------ 337

Query: 342 PQEGKKDKVVAETTYIDTPE-----NKEKTKRKWQPLPPEPLNATPT-KVNASTKKNKNE 395
                  KVVAETTYIDTPE     N     +   P    P  +TPT K+N ST K  + 
Sbjct: 338 -------KVVAETTYIDTPEQVRGKNNRSPLKTLAPHSESPTRSTPTSKLNTSTDKTAST 390

Query: 396 SE 397
            E
Sbjct: 391 EE 392

>Kwal_55.21587
          Length = 464

 Score =  171 bits (432), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 133/374 (35%), Positives = 169/374 (45%), Gaps = 75/374 (20%)

Query: 76  ENPLLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIELPREPVQQN 135
           ENP+L QL EAFP I+ +YVKAV+IASQGALDPAFNALLFLSDP    +  +P    Q +
Sbjct: 113 ENPILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSDPSFEAEATVPTAVPQSS 172

Query: 136 PSLPPRRKQ--TQLEQDEMLARQLDXXXXXXXXXXXXXXXXX------------------ 175
            S   R     +QL+QDE+LARQLD                                   
Sbjct: 173 QSGNSRSPTAVSQLQQDEILARQLDAQFNKGHARRGAPRSMDDERRARERRIRERQREFE 232

Query: 176 ------------XXXXNYERYNNDDLEE-DSWSQFVEKDLPEITARAKGSLQETATKVGT 222
                            YER   +D E+ D  SQ V+KDLPE+  +    +QET  KV  
Sbjct: 233 RRTAHGAGPLSPEEQRRYERMEAEDQEDNDFLSQLVDKDLPELREKVGRQVQETGRKVND 292

Query: 223 WFNGVKKNFIGEGEENDSAYYQDDSHGRDLDEDYGTYXXXXXXXXXXXXXDPGYRRGDEQ 282
           W +G +KN+  +      +    +   R   +   T               P +R     
Sbjct: 293 WLSGFRKNWAQDQSSQQQSSQYPEFSDRQQSQRRDTSSRRSSDSEFEDYTRPEHRTA--- 349

Query: 283 RLNARHRFNSFGASATDD--------VEGGISLRXX---XXXXXXXXXVPPQLPSRARSN 331
                 RFNSFGA   DD           GISL               + PQLPSR ++ 
Sbjct: 350 ------RFNSFGAKVGDDSTTSSAKLASHGISLYNKGDKDVEDESDADIAPQLPSRNKAK 403

Query: 332 DSKKDSEEVKPQEGKKDKVVAETTYIDTPENKEKTKRKWQPLPPEPLNATPTKVNASTKK 391
           D       ++P          ETTYIDTPE    T++KWQPLPPEP+N TP+KVNA+  K
Sbjct: 404 D-------IQP----------ETTYIDTPE--AGTRKKWQPLPPEPINVTPSKVNATASK 444

Query: 392 NKNES---EDEFLI 402
           NK  S   +D+FLI
Sbjct: 445 NKRNSDVNDDDFLI 458

>ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -
           SH] (505794..506921) [1128 bp, 375 aa]
          Length = 375

 Score =  111 bits (277), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 106/334 (31%), Positives = 141/334 (42%), Gaps = 70/334 (20%)

Query: 76  ENPLLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIELPREPVQQN 135
           EN +L +LK AFPN+EE+ VKAVIIASQG LDPAF+ALLFLSDP   ++  LP +     
Sbjct: 99  ENSILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSDPTFEEEAALPTQAAPAA 158

Query: 136 PSLPPRRKQTQLEQDEMLARQLDXXXXXXXXXXXXXXXXXXXXXNYERYNNDD--LEEDS 193
            +  P    +QL+QDEMLARQLD                       E +      L  + 
Sbjct: 159 QATVP---ISQLQQDEMLARQLDEQFNKKDLRAERAARERRIREREEEFQRKQQRLRSEY 215

Query: 194 WSQFVEKDLPEITARAKGSLQETATKVGTWFNGVKKNFIGEGEENDSAYYQDDSHGRDLD 253
                E D   I    +G LQET+ KVG W++G+KKNF  E +  D+         R   
Sbjct: 216 GGYGSEDDEDFIDVLNRG-LQETSKKVGKWWDGIKKNFNEELDGPDARASAGPPRAR--- 271

Query: 254 EDYGTYXXXXXXXXXXXXXDPGYRRGDEQRLNARHRFNSFGASATDDVEGGISLRXXXXX 313
                                            + RFNSFGA   +       LR     
Sbjct: 272 ---------------------------------QQRFNSFGARDDETYPTEQQLRGVSLH 298

Query: 314 XXXXXXVPPQLPSRARSNDSKKDSEEVKPQEGKKDKVVAETTYIDTPENKEKTKRKWQPL 373
                   P+LP R  S           P   + D    E             +++WQPL
Sbjct: 299 DEHDDEPAPRLPPRRTS---------TGPLPARPDGPNVE-------------RKRWQPL 336

Query: 374 PPEPLNATPTKVNASTK-----KNKNESEDEFLI 402
           PPEP++A PTKV A  +     K ++  +D++LI
Sbjct: 337 PPEPVSA-PTKVTAGGRNHAQNKKRDPDQDDYLI 369

>YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the
           prospore membrane [1098 bp, 365 aa]
          Length = 365

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 40/54 (74%)

Query: 79  LLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIELPREPV 132
           +L +LK AFP +++  +KA++IASQG L+PAFN+LL+ S PE   D  LP +P+
Sbjct: 86  VLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSSPEENTDFALPMKPI 139

>CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08412
           Saccharomyces cerevisiae YOR042w, hypothetical start
          Length = 197

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%), Gaps = 13/61 (21%)

Query: 82  QLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIELPREPVQQNPSLPPR 141
           +L +AFP +++  ++A+++A++G L PAFNALL L    +G+DI+L          LP R
Sbjct: 33  KLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSL----TGEDIQL---------GLPMR 79

Query: 142 R 142
           R
Sbjct: 80  R 80

>Scas_615.8d
          Length = 581

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 35/46 (76%)

Query: 82  QLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIEL 127
           +L +AFP+++   +K+++ AS+G + PAF+ALLFL++ ++ + I +
Sbjct: 286 ELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTNQQNLETITI 331

>Kwal_55.19912
          Length = 327

 Score = 32.7 bits (73), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 181 YERYNNDDLEEDSWSQFVEKDLPEITARAKGSLQETATKVGTWFNGVKKNFIGEGEE--N 238
           YE +  D    D+++QF E D P ++   + SL++ A KV     GV +N++G G E   
Sbjct: 206 YELFQRDPAVGDAFAQFAEIDAPFLS--FEFSLKDEAGKV---MGGVDRNWVGLGRELFT 260

Query: 239 DSAYY 243
           D+  Y
Sbjct: 261 DTGVY 265

>CAGL0E05060g complement(493133..496432) similar to sp|P53114
           Saccharomyces cerevisiae YGL151w NUT1 negative
           transcription regulator, start by similarity
          Length = 1099

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 11/73 (15%)

Query: 188 DLEEDSWSQFVEKDLPEITARAKGSLQETATKVGTWFNGVKKNFIGEGEENDSAYYQDDS 247
           +L E  W  F+ K LP +  +       TA  +G   +G+    I       SAYYQ++ 
Sbjct: 361 NLLERKWILFLSKILPLLVYKNSS---RTAHVIGNALDGIDDKVIKAI----SAYYQEND 413

Query: 248 HGR----DLDEDY 256
            GR    DL +DY
Sbjct: 414 DGRSRNDDLFDDY 426

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.306    0.128    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,225,535
Number of extensions: 495388
Number of successful extensions: 1692
Number of sequences better than 10.0: 39
Number of HSP's gapped: 1665
Number of HSP's successfully gapped: 42
Length of query: 402
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 298
Effective length of database: 12,995,837
Effective search space: 3872759426
Effective search space used: 3872759426
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 63 (28.9 bits)