Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L09889g71770635590.0
Scas_685.764571914720.0
Sklu_2380.362271813611e-180
Kwal_14.86362850212341e-161
ACR172W61244212311e-161
KLLA0E08085g65671712031e-156
YKL025C (PAN3)6791182382e-20
CAGL0K00693g87686740.91
Sklu_2211.5117539721.7
CAGL0I07513g107693721.7
Scas_715.34115057721.7
YOL100W (PKH2)108192721.8
YBL105C (PKC1)115139721.8
Kwal_27.10581115439721.8
KLLA0E06413g116139711.9
ACR191C114939712.0
Kwal_56.244781296185702.6
CAGL0M09361g114439703.0
Sklu_2351.554165675.6
ACR281C125935675.9
Scas_653.27444202676.2
Kwal_56.2348658750676.4
Sklu_1603.248858666.9
CAGL0K06127g31844667.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L09889g
         (706 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces...  1375   0.0  
Scas_685.7                                                            571   0.0  
Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement        528   e-180
Kwal_14.863                                                           479   e-161
ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH] complement(...   478   e-161
KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces c...   468   e-156
YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component...    96   2e-20
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    33   0.91 
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          32   1.7  
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    32   1.7  
Scas_715.34                                                            32   1.7  
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    32   1.8  
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    32   1.8  
Kwal_27.10581                                                          32   1.8  
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    32   1.9  
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    32   2.0  
Kwal_56.24478                                                          32   2.6  
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    32   3.0  
Sklu_2351.5 YGR009C, Contig c2351 9208-10833                           30   5.6  
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    30   5.9  
Scas_653.27                                                            30   6.2  
Kwal_56.23486                                                          30   6.4  
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         30   6.9  
CAGL0K06127g 596781..597737 weakly similar to tr|Q04110 Saccharo...    30   7.3  

>CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease, start by similarity
          Length = 717

 Score = 1375 bits (3559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/706 (94%), Positives = 667/706 (94%)

Query: 1   MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKHDDDDIATPTSTPKVADTVPAPSGVIQ 60
           MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKHDDDDIATPTSTPKVADTVPAPSGVIQ
Sbjct: 1   MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKHDDDDIATPTSTPKVADTVPAPSGVIQ 60

Query: 61  QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHTGSKSQVPKFNAKASASFTPMSKAADGTQ 120
           Q                             HTGSKSQVPKFNAKASASFTPMSKAADGTQ
Sbjct: 61  QPSKISVSSLPSLNSQPSSTAPTSAPNATAHTGSKSQVPKFNAKASASFTPMSKAADGTQ 120

Query: 121 ETQAPYLESPVAGSPGPILKAGTPVSFMQPNIYSTTPVPSPASMAMPNVVMPPNDMGSPD 180
           ETQAPYLESPVAGSPGPILKAGTPVSFMQPNIYSTTPVPSPASMAMPNVVMPPNDMGSPD
Sbjct: 121 ETQAPYLESPVAGSPGPILKAGTPVSFMQPNIYSTTPVPSPASMAMPNVVMPPNDMGSPD 180

Query: 181 LGLQQQSHMVNLDGSIQQNYQERPNVLMRDSSMPLTMGTSGSRPMLDQQIHSISGLSNTS 240
           LGLQQQSHMVNLDGSIQQNYQERPNVLMRDSSMPLTMGTSGSRPMLDQQIHSISGLSNTS
Sbjct: 181 LGLQQQSHMVNLDGSIQQNYQERPNVLMRDSSMPLTMGTSGSRPMLDQQIHSISGLSNTS 240

Query: 241 GPQPPGLLQSMNGASMDMGLPMNLRYPTIYPPTHSILQYHLYAPDPPPQLEIALKENERT 300
           GPQPPGLLQSMNGASMDMGLPMNLRYPTIYPPTHSILQYHLYAPDPPPQLEIALKENERT
Sbjct: 241 GPQPPGLLQSMNGASMDMGLPMNLRYPTIYPPTHSILQYHLYAPDPPPQLEIALKENERT 300

Query: 301 PRMLFIPNDLREELVKRNLASLQLFPSGGNLPHIVKDYFGLVPLDFHQRSSVKDRYKKHK 360
           PRMLFIPNDLREELVKRNLASLQLFPSGGNLPHIVKDYFGLVPLDFHQRSSVKDRYKKHK
Sbjct: 301 PRMLFIPNDLREELVKRNLASLQLFPSGGNLPHIVKDYFGLVPLDFHQRSSVKDRYKKHK 360

Query: 361 NSLYKVFSNVDGRIYLLRRIHDVNISDPTIISKTFQKWSKIDSSNVVALKDLFLTTAFGD 420
           NSLYKVFSNVDGRIYLLRRIHDVNISDPTIISKTFQKWSKIDSSNVVALKDLFLTTAFGD
Sbjct: 361 NSLYKVFSNVDGRIYLLRRIHDVNISDPTIISKTFQKWSKIDSSNVVALKDLFLTTAFGD 420

Query: 421 SSLGIVYDYYPNATSLYEAHFVNYPTVEVTEDLLWSYAVQILNGLREIHNTNGVNIGDLD 480
           SSLGIVYDYYPNATSLYEAHFVNYPTVEVTEDLLWSYAVQILNGLREIHNTNGVNIGDLD
Sbjct: 421 SSLGIVYDYYPNATSLYEAHFVNYPTVEVTEDLLWSYAVQILNGLREIHNTNGVNIGDLD 480

Query: 481 CDKIILTGKGRIKISAGAEYDIMNMCCPXXXXXXXXXXKLRKRNFVDLGEILFKLASKMC 540
           CDKIILTGKGRIKISAGAEYDIMNMCCP          KLRKRNFVDLGEILFKLASKMC
Sbjct: 481 CDKIILTGKGRIKISAGAEYDIMNMCCPEDNEDDDNEEKLRKRNFVDLGEILFKLASKMC 540

Query: 541 NCHGKDVANLAQVSEKLKNLIKSLAFEQLHDYVNVATIIEKYIGLDVVFKVMEAQQTYSE 600
           NCHGKDVANLAQVSEKLKNLIKSLAFEQLHDYVNVATIIEKYIGLDVVFKVMEAQQTYSE
Sbjct: 541 NCHGKDVANLAQVSEKLKNLIKSLAFEQLHDYVNVATIIEKYIGLDVVFKVMEAQQTYSE 600

Query: 601 YAENVLSRELENGRLFRLICKLNFIFGRVENRLDINWSEPGDKFVIVLFYDYVFHQIDPN 660
           YAENVLSRELENGRLFRLICKLNFIFGRVENRLDINWSEPGDKFVIVLFYDYVFHQIDPN
Sbjct: 601 YAENVLSRELENGRLFRLICKLNFIFGRVENRLDINWSEPGDKFVIVLFYDYVFHQIDPN 660

Query: 661 TGKPVTDLTHVLRCLNKLDAGVEENILLVTPDELNTAVVSYKKVKE 706
           TGKPVTDLTHVLRCLNKLDAGVEENILLVTPDELNTAVVSYKKVKE
Sbjct: 661 TGKPVTDLTHVLRCLNKLDAGVEENILLVTPDELNTAVVSYKKVKE 706

>Scas_685.7
          Length = 645

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/719 (45%), Positives = 431/719 (59%), Gaps = 98/719 (13%)

Query: 1   MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKHDDDDIATPTSTPKVADTVPAPSGVIQ 60
           MDKIN +WA+D+PCRNV IYG+CKK  +GCPFKH + D       P      P P   +Q
Sbjct: 1   MDKINAEWAKDIPCRNVTIYGYCKKIKDGCPFKHSETD------EPAAEIQEPVP---VQ 51

Query: 61  QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHTGSKSQVPKFNAKASASFTPMSK-----A 115
           Q                                      KFN K+SASFTPMS      A
Sbjct: 52  QSPVAPVPSFSR---------------------------KFNPKSSASFTPMSSKTPELA 84

Query: 116 ADGTQETQAPYLESPVAGSP-----GPILKAGTPVSFMQPNIYSTTPVPSPASMAMPNVV 170
           A  + E  +         S       P+    +  SF  P  + + P  S     + N +
Sbjct: 85  AVSSFERSSNPSSPAPPASIPKPMNSPLASQSSNASF-PPQPFYSYPASSSNGTLLNNTI 143

Query: 171 MPPN-DMGSPDLGLQQQSHMVNLDGSIQQNYQERPNVLMRDSSMPLTMGTSGSRPMLDQQ 229
           +P    +  P   L Q      +D ++  N    PN  +  +++PL   +S +  +  Q 
Sbjct: 144 LPDGISLHDPAFPLTQ------IDKTMLAN---DPN--LPSANVPLQFSSSPASNIHQQM 192

Query: 230 IHSISGLSNTSGPQPPGLLQSMNGASMDMGLPMNLRYPTIYPPTHSILQYHLYAPDPPPQ 289
           ++  +  +N S                        RYP+IYPP HSILQYHLYAPDPPPQ
Sbjct: 193 LNENNINNNNS------------------------RYPSIYPPPHSILQYHLYAPDPPPQ 228

Query: 290 LEIALKENERTPRMLFIPNDLREELVKRNLASLQLFPSGGNLPHIVKDYFGLVPLDFHQR 349
           L + LK NERTP  LFIPNDLRE+LVK+NLASLQ+FPSGG +P IV+DYFGLVPLDFHQ+
Sbjct: 229 LRLPLKPNERTPETLFIPNDLREQLVKKNLASLQIFPSGGAIPDIVQDYFGLVPLDFHQK 288

Query: 350 SSVKDRYKKHKNSLYKVFSNVDGRIYLLRRIHDVNISDPTIISKTFQKWSKIDSSNVVAL 409
              KDRY+ HKNSLYKVFSN+DG++Y+LRRIHDV I DP  I+K FQKW+ ++ + +V L
Sbjct: 289 EVTKDRYQGHKNSLYKVFSNLDGKVYILRRIHDVQIMDPQQIAKPFQKWNNLECNQIVKL 348

Query: 410 KDLFLTTAFGDSSLGIVYDYYPNATSLYEAHFVNYPTVEVTEDLLWSYAVQILNGLREIH 469
           +DLFLTT FGDSSL +VYD+YP A SLYE HF N+P V +T+D LW+Y VQ+ N +  +H
Sbjct: 349 RDLFLTTKFGDSSLCLVYDFYPQANSLYEHHFTNFPLVPITQDYLWTYLVQLTNAINVVH 408

Query: 470 NTNGVNIGDLDCDKIILTGK-GRIKISAGAEYDIMNMCCPXXXXXXXXXXKLRKRNFVDL 528
            + G  IG +D DKII+TG  GRIK+S     D++                 ++ +F +L
Sbjct: 409 -SKGFYIGLIDWDKIIVTGDPGRIKLSGCGAIDVLG------ANEELDLHSKQQMDFENL 461

Query: 529 GEILFKLASKMCNCHGKDVANLAQVSEKLKNLIKSLAFEQLHDYVNVATIIE-KYIGLDV 587
           G++LFKLASK+ N     +  L+ V ++ K +++ L    L+D  +  TI E   + +D 
Sbjct: 462 GQLLFKLASKIGNNANAKIDELS-VDDQFKTVLQYL----LNDTNDRKTINELSQLFIDK 516

Query: 588 VFKVMEAQQTYSEYAENVLSRELENGRLFRLICKLNFIFGRVENRLDINWSEPGDKFVIV 647
           +   +E+ Q Y+EY E +LSRELENGRLFRLICKLNFIFG++E+R+DINWSE G+KF I+
Sbjct: 517 ILSNVESSQGYAEYTEGILSRELENGRLFRLICKLNFIFGKIESRVDINWSESGEKFPII 576

Query: 648 LFYDYVFHQIDPNTGKPVTDLTHVLRCLNKLDAGVEENILLVTPDELNTAVVSYKKVKE 706
           LFYD+VFHQ+D  TGK V DLTHVLRCLNKLDAG  E ++L TPDE+N  ++SYK++K+
Sbjct: 577 LFYDFVFHQVD-ETGKSVMDLTHVLRCLNKLDAGAPEKLILATPDEMNCIIISYKELKD 634

>Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement
          Length = 622

 Score =  528 bits (1361), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 297/718 (41%), Positives = 408/718 (56%), Gaps = 119/718 (16%)

Query: 1   MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKHDDDDIATPTSTPKVADTVPAPSGVIQ 60
           MDK N +WA+D+PC+N+ I+GFCK + +GC F H      T  +TP              
Sbjct: 1   MDKANTEWAKDIPCKNITIHGFCKFENDGCIFNHGSSGTKTGVNTP-------------- 46

Query: 61  QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHTGSKSQVPKFNAKASASFTP-------MS 113
                                          TG  +   KFNAK ++SFTP        +
Sbjct: 47  -------------------------------TGIMNSASKFNAKTASSFTPSKITSSDFN 75

Query: 114 KAADGTQETQAPYLESPVAGSPGPILKAGTPVSFMQPNIYSTTPVPSPASMAMPNV---V 170
             +  T +  A    +PVA S   ++ + T  +   P +  +      A ++ P+     
Sbjct: 76  GVSGFTSDKSATVTTAPVAAS---VVNSPTFATNFNPYVADSFTPSGSAGVSSPSFNPYS 132

Query: 171 MPPNDMGSPDLGLQQQSHMVNLDGSIQQNYQERPNVLMRDSSMPLTMGTSGSRPMLDQQI 230
            P    G+       Q+  V         + +RP                          
Sbjct: 133 APSGIGGASSTATHTQTAPVT-------GFTQRP-------------------------- 159

Query: 231 HSISGLSNTSGPQPPGLLQSMNGASMDMGLPMNLRYPTIYPPTHSILQYHLYAPDPPPQL 290
                      P P   L S  G      +     +PTIYPP HSILQYHLYAPDPPP L
Sbjct: 160 -----------PDPRSSLTSA-GPIASSRVSATQNFPTIYPPPHSILQYHLYAPDPPPHL 207

Query: 291 EIALKENERTPRMLFIPNDLREELVKRNLASLQLFPSGGNLPHIVKDYFGLVPLDFHQRS 350
           ++ LK NERTP  LFIPNDLREELVK+N ++LQ+FPSGG+LP IV DYFGLVPL+FH R+
Sbjct: 208 KVPLKPNERTPETLFIPNDLREELVKKNQSALQVFPSGGSLPEIVGDYFGLVPLEFHSRA 267

Query: 351 SVKDRYKKHKNSLYKVFSNVDGRIYLLRRIHDVNISDPTIISKTFQKWSKIDSSNVVALK 410
           S K RY  H+NSLYKVFSN DG+IY++RRIHDVNI++ T +S+ FQ W K+  +NVV +K
Sbjct: 268 SYKQRYMGHQNSLYKVFSNSDGKIYIMRRIHDVNITEATQVSRPFQMWQKVSCANVVKIK 327

Query: 411 DLFLTTAFGDSSLGIVYDYYPNATSLYEAHFVNYPTVEVTEDLLWSYAVQILNGLREIHN 470
           D F+T AF DSSL +V++Y+P ++SLYE HFVN+    +T+D LW+Y VQ+ N L+E+H+
Sbjct: 328 DAFITRAFNDSSLCVVHEYFPQSSSLYETHFVNFTLTPITQDYLWAYLVQLTNALKEVHS 387

Query: 471 TNGVNIGDLDCDKIILTGK-GRIKISAGAEYDIMNMCCPXXXXXXXXXXKLRKRNFVDLG 529
            N ++I  L  DK+I+TG+ GRIK+S    YDI++              + ++++F +LG
Sbjct: 388 QN-LSINILGWDKVIVTGEPGRIKVSDCGVYDILH------SLESRDIEEEQQKDFEELG 440

Query: 530 EILFKLASKMCNCHGKDVANLAQVSEKLKNLIKSLAFEQLHDY-VNVATIIEKYIGLDVV 588
           ++L  L +K+ +       +L +V    K ++  L    L+D+  NV  +   +   D +
Sbjct: 441 KLLNGLVTKIASSKDTSTQDL-KVDSDFKIVLDYLL---LNDHKKNVRELASLFT--DRI 494

Query: 589 FKVMEAQQTYSEYAENVLSRELENGRLFRLICKLNFIFGRVENRLDINWSEPGDKFVIVL 648
             V+ + QT+ E  E  LSRELENGRLFRL+CKLNFIFGR E+R+DINWSE G+KF I+L
Sbjct: 495 LSVVSSLQTHVECTEAYLSRELENGRLFRLMCKLNFIFGRTESRVDINWSESGEKFPIIL 554

Query: 649 FYDYVFHQIDPNTGKPVTDLTHVLRCLNKLDAGVEENILLVTPDELNTAVVSYKKVKE 706
           FYDYVFHQ+D   GK + DLTHVLRCLNKLDAGV E I+LVTPDE+N  ++SYK++K+
Sbjct: 555 FYDYVFHQVD-EAGKSIMDLTHVLRCLNKLDAGVTEKIMLVTPDEMNCIIISYKELKD 611

>Kwal_14.863
          Length = 628

 Score =  479 bits (1234), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 247/502 (49%), Positives = 336/502 (66%), Gaps = 26/502 (5%)

Query: 216 TMGTSGSRPMLDQQIHSISGLSNTSGPQPPGLLQSMNGASMDMGLPM---------NLRY 266
           + GTS   P    +  S +  S  +G   PG      GAS   G P             +
Sbjct: 131 SAGTSTPPPAAASRT-SFNPYSAPAGMTTPGEAPLQPGASFIPGSPAPYAQDAPGRYTNF 189

Query: 267 PTIYPPTHSILQYHLYAPDPPPQLEIALKENERTPRMLFIPNDLREELVKRNLASLQLFP 326
           P+IYPP+HSILQYHLYAPDPP  L++ LK NERTP  LFIPN++REEL+K+N A+LQ+FP
Sbjct: 190 PSIYPPSHSILQYHLYAPDPPLHLKVPLKANERTPETLFIPNNMREELLKKNHAALQVFP 249

Query: 327 SGGNLPHIVKDYFGLVPLDFHQRSSVKDRYKKHKNSLYKVFSNVDGRIYLLRRIHDVNIS 386
           SGGNLP IV DYFGLVPL+FH R S KDRY+ H+NSLYKVFSN DG++Y++RRIHDV + 
Sbjct: 250 SGGNLPEIVGDYFGLVPLEFHNRVSNKDRYQGHQNSLYKVFSNFDGKVYIMRRIHDVKMK 309

Query: 387 DPTIISKTFQKWSKIDSSNVVALKDLFLTTAFGDSSLGIVYDYYPNATSLYEAHFVNYPT 446
           +   + K FQ W K+ +SNVV  KD F+T AF D+SL +V++Y+P ++SLYE HFV++  
Sbjct: 310 ESVQLFKPFQDWKKVVNSNVVETKDAFITRAFNDASLCVVHEYFPQSSSLYETHFVSFSP 369

Query: 447 VEVTEDLLWSYAVQILNGLREIHNTNGVNIGDLDCDKIILTGK-GRIKISAGAEYDIMNM 505
             +T+DLLWSY VQ+ + ++  H  N +   ++  DK+I+TG  GR+KI     +DI+  
Sbjct: 370 TPITQDLLWSYLVQLCSAIQAAHTRN-LAFNNICLDKVIVTGNPGRVKIGDSCVHDILYF 428

Query: 506 CCPXXXXXXXXXXKLRKRNFVDLGEILFKLASKMCNCHGKDVANLAQVSEKLKNLIKSLA 565
                        K +K +F DLG +L  LA+K+       V +LA V +  K ++  L 
Sbjct: 429 ------QDERDVLKEQKHDFADLGGLLKDLAAKLVGSQDNTVDSLA-VDDDFKQVLNYLL 481

Query: 566 FEQLHDYVNVATIIE-KYIGLDVVFKVMEAQQTYSEYAENVLSRELENGRLFRLICKLNF 624
                D  ++ T+ E   +    +  ++ + QT++EY E++L+RELEN RLFRL+CK+NF
Sbjct: 482 -----DPKSLKTLPELMALFSHKILPIISSLQTFTEYTESILARELENARLFRLMCKMNF 536

Query: 625 IFGRVENRLDINWSEPGDKFVIVLFYDYVFHQIDPNTGKPVTDLTHVLRCLNKLDAGVEE 684
           IFGR+E+R+DINWSE G+KF I+LFYDYVFHQ D  TGKPV DLTHVLRCLNKLDAG+ E
Sbjct: 537 IFGRIESRIDINWSESGEKFPIILFYDYVFHQAD-ETGKPVMDLTHVLRCLNKLDAGIGE 595

Query: 685 NILLVTPDELNTAVVSYKKVKE 706
            ++LVTPDE+N  ++SYK++K+
Sbjct: 596 KLMLVTPDEMNCIIISYKELKD 617

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 21/34 (61%), Positives = 27/34 (79%)

Query: 1  MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKH 34
          MDK N +WA+D+PC+N+ IYGFCK + EGC F H
Sbjct: 15 MDKANAEWAKDIPCKNITIYGFCKYENEGCIFNH 48

>ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH]
           complement(655564..657402) [1839 bp, 612 aa]
          Length = 612

 Score =  478 bits (1231), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 236/442 (53%), Positives = 309/442 (69%), Gaps = 15/442 (3%)

Query: 266 YPTIYPPTHSILQYHLYAPDPPPQLEIALKENERTPRMLFIPNDLREELVKRNLASLQLF 325
           +PT+YPP+HSILQYHLYAPDPPP L++ LK NERTP  LFIPN+LRE L+KRNL++LQ+F
Sbjct: 174 FPTVYPPSHSILQYHLYAPDPPPHLQVPLKANERTPETLFIPNNLREHLLKRNLSALQVF 233

Query: 326 PSGGNLPHIVKDYFGLVPLDFHQRSSVKDRYKKHKNSLYKVFSNVDGRIYLLRRIHDVNI 385
           PS GNLP IV DYFGLVPL+FH R + K RY  H+NSLYKVFSN DG++Y++RRIHDV  
Sbjct: 234 PSDGNLPDIVGDYFGLVPLEFHNRQTGKGRYLGHQNSLYKVFSNFDGKVYIIRRIHDVKT 293

Query: 386 SDPTIISKTFQKWSKIDSSNVVALKDLFLTTAFGDSSLGIVYDYYPNATSLYEAHFVNYP 445
           +D   IS  F+KW K+   NVV +KD F T AFGDSSL +V+DYYP + SLYE H  NY 
Sbjct: 294 TDVGQISLPFRKWQKVSCPNVVKVKDAFTTLAFGDSSLCVVHDYYPQSNSLYETHVANYT 353

Query: 446 TVEVTEDLLWSYAVQILNGLREIHNTNGVNIGDLDCDKIILTGK-GRIKISAGAEYDIMN 504
            V VT+  LWSY VQ+ N L E+H  +G+++ ++  DK+I+TG  GRIK+   A +DI+ 
Sbjct: 354 VVPVTQKYLWSYLVQLSNALNEVHR-HGLSMNNISLDKVIVTGDPGRIKVGDSAVHDILA 412

Query: 505 MCCPXXXXXXXXXXKLRKRNFVDLGEILFKLASKMCNCHGKDVANLAQVSEKLKNLIKSL 564
                         K ++ ++  +G +L  LA +M     + + ++  +    K ++  L
Sbjct: 413 F------DEGRDIAKEQQADYSAVGALLMDLAQRMLGTRDQPLDSM-DIDPLFKRVLAYL 465

Query: 565 AFEQLHDYVNVATIIEKYIGLDVVFKVMEAQQTYSEYAENVLSRELENGRLFRLICKLNF 624
             ++         +    + LD++     + QTYSEY E  LSRELENGRLFRL+CKLNF
Sbjct: 466 LSDEKKTIAEFTALFSHKM-LDII----SSSQTYSEYIEQHLSRELENGRLFRLMCKLNF 520

Query: 625 IFGRVENRLDINWSEPGDKFVIVLFYDYVFHQIDPNTGKPVTDLTHVLRCLNKLDAGVEE 684
           IFGR+E+ +DI+WSE GDKF I+LFYDYVFHQ+D N GK V DLTHVLRCLNKLD GV E
Sbjct: 521 IFGRMESSMDIHWSEAGDKFPIILFYDYVFHQVDEN-GKSVMDLTHVLRCLNKLDTGVSE 579

Query: 685 NILLVTPDELNTAVVSYKKVKE 706
            I+LVTPDE+N  ++SYK++K+
Sbjct: 580 KIILVTPDEMNCIIISYKELKD 601

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 25/34 (73%)

Query: 1  MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKH 34
          M+K   DWA+D PC+N+ IYG+CK + +GC F H
Sbjct: 3  MNKSKTDWAKDTPCKNITIYGYCKYENDGCIFNH 36

>KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease singleton, start by similarity
          Length = 656

 Score =  468 bits (1203), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 291/717 (40%), Positives = 399/717 (55%), Gaps = 100/717 (13%)

Query: 6   PDWARDVPCRNVIIYGFCKKKTEGCPFKHDDDDIATPTSTPKVADTVPAPSGVIQQXXXX 65
           PD  +   CRN+II+G+CK + EGC F H +    +  +  +  D VP            
Sbjct: 13  PDSFKGTQCRNIIIHGYCKFENEGCQFNHGN----SKETEGQTTDEVPT----------- 57

Query: 66  XXXXXXXXXXXXXXXXXXXXXXXXXHTGSKSQVP---KFNAKASASFTPMSKAADGTQET 122
                                        +S  P   KFNAK S+SFTP    A      
Sbjct: 58  ----------------------------QRSMTPLNVKFNAKTSSSFTPGKSPA-----V 84

Query: 123 QAPYLESPVAGSPG------PILKAGTPVS-FMQPNIYSTTPVPSPASMAMPNVVMPPND 175
           ++P   S  A  PG      P+L  G  +S  M P++ +     S A+   P+     ++
Sbjct: 85  RSPDFSSLPAFQPGAPVNDQPMLADGPQISGTMSPSLMN-----SNATAFAPSFNPYASE 139

Query: 176 MGSPDLGLQQQSHMVNLDGSIQQNYQERPNVLMRDSSMPLTMGTSGSRPMLDQQIHSISG 235
             +P +          L G++  +    P      S +P       S P ++       G
Sbjct: 140 SFTPSVSAGGIPSSQELAGTLHGSNPSIP------SPVP-------SNPYVNSAGLPSGG 186

Query: 236 LSNTSGPQPPGLLQSMNGASMDMGLPMN--LRYPTIYPPTHSILQYHLYAPDPPPQLEIA 293
           +     P     +Q +        LP+N   ++PT+YPPTHS+LQYHLYAPDPPP L+I 
Sbjct: 187 MLGVGHP-----MQGLPPPPPPGALPVNPITQFPTVYPPTHSVLQYHLYAPDPPPHLKIP 241

Query: 294 LKENERTPRMLFIPNDLREELVKRNLASLQLFPSGGNLPHIVKDYFGLVPLDFHQRSSVK 353
           LK NERTP  LFI N LR+ LVK N  +LQ+FP G +LP IV DYFGLVP+DFH R+S K
Sbjct: 242 LKPNERTPETLFINNHLRDRLVKNNQTALQVFPRG-SLPDIVGDYFGLVPMDFHNRTSDK 300

Query: 354 DRYKKHKNSLYKVFSNVDGRIYLLRRIHDVNISDPTIISKTFQKWSKIDSSNVVALKDLF 413
            RY  HKNSLYKVFSN+DG+IY +RRIHDV I+D   +SK FQ WS + S+N+  LKD F
Sbjct: 301 KRYNGHKNSLYKVFSNLDGKIYFMRRIHDVKITDSAQVSKPFQTWSHLRSANITVLKDSF 360

Query: 414 LTTAFGDSSLGIVYDYYPNATSLYEAHFVNYPTVEVTEDLLWSYAVQILNGLREIHNTNG 473
           +T+AF DSSL +V+DYYP + SLYE + +     E+ ++ LW++ VQ+   L+E+H +NG
Sbjct: 361 VTSAFNDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVH-SNG 419

Query: 474 VNIGDLDCDKIILTGK-GRIKISAGAEYDIMNMCCPXXXXXXXXXXKLRKRNFVDLGEIL 532
           + + DLD  K+I+TG+ GRIK++    YD +N                +++N++ L E+L
Sbjct: 420 LALNDLDWKKVIVTGEPGRIKVTDIGVYDTLNY-----HQEGRMLHTEQQQNYLSLAELL 474

Query: 533 FKLASKMCNCHGK-DVANLAQVSEKLKNLIKSLAFEQLHDYVNVATIIEKYIGL--DVVF 589
             L  ++C   G  D      +    K  I     + L D  N    IE +  L    V 
Sbjct: 475 LNLVQRLCGASGPLDDVKSYHIDPLFKKCI-----QYLQDTSNNNKNIEDFTKLFSHKVL 529

Query: 590 KVMEAQQTYSEYAENVLSRELENGRLFRLICKLNFIFGRVENRLDINWSEPGDKFVIVLF 649
            V+ + Q  SEY E  LSRELEN RLFRL+CKLN I+GR+E+R+DINW+E G+KF I+LF
Sbjct: 530 SVVNSLQYNSEYLEQQLSRELENARLFRLMCKLNAIYGRLESRIDINWAESGEKFPIILF 589

Query: 650 YDYVFHQIDPNTGKPVTDLTHVLRCLNKLDAGVEENILLVTPDELNTAVVSYKKVKE 706
           +DYVFHQ D +TGK V DLTHVLRCLNKLDAGV E ++LVTPDE+N  ++SYK++K+
Sbjct: 590 FDYVFHQKD-DTGKNVMDLTHVLRCLNKLDAGVSERLMLVTPDEMNCIIISYKELKD 645

>YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component of
           Pab1p-stimulated poly(A) ribonuclease [2040 bp, 679 aa]
          Length = 679

 Score = 96.3 bits (238), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 62/118 (52%), Gaps = 35/118 (29%)

Query: 1   MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKHDDDDIATPTSTPKVADTVPAPSGVIQ 60
           MDKINPDWA+D+PCRN+ IYG+CKK+ EGCPFKH D+  AT        + VP P  V +
Sbjct: 1   MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTAT------TINDVPPPIDVGE 54

Query: 61  QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHTGSKSQVPKFNAKASASFTPMSKAADG 118
                                          T + + VPKFNAK SASFTPM+  +D 
Sbjct: 55  AT-----------------------------TPTMTSVPKFNAKVSASFTPMTVGSDS 83

>CAGL0K00693g complement(74637..77267) similar to sp|P32944
           Saccharomyces cerevisiae YJL187c, hypothetical start
          Length = 876

 Score = 33.1 bits (74), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 4/86 (4%)

Query: 411 DLFLTTAFGDSSLGIVYDYYPNAT--SLYEAHFVNYPTVEVTEDLLWSYAVQILNGLREI 468
           D   +  +GDS   I+ D+Y N +     +   V+  T ++ +  +W   V+I  GLR I
Sbjct: 571 DYITSWKYGDSYY-IMTDFYENGSLDKFLQEQVVSKKT-KLEDWRIWKIMVEICLGLRFI 628

Query: 469 HNTNGVNIGDLDCDKIILTGKGRIKI 494
           H++  V   DL    I +T +G +KI
Sbjct: 629 HDSCQVVHLDLKPANIFITFEGNLKI 654

>Sklu_2211.5 YBL105C, Contig c2211 10237-13764
          Length = 1175

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 457 YAVQILNGLREIHNTNGVNIGDLDCDKIILTGKGRIKIS 495
           YA ++L  L+  H+ NGV   DL  + I+LT +G IKI+
Sbjct: 953 YAAEVLLALKYFHD-NGVVYRDLKLENILLTPEGHIKIA 990

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 8/93 (8%)

Query: 404 SNVVALKDLFLTTAFGD-SSLGIVYDYYPNATSLYEAHFVNYPTVEVTEDLLWSYAVQIL 462
           +N   +  LF T  F D SSL  + +Y PN   L     V      ++ED    Y+ QI+
Sbjct: 238 NNSRGIVKLFFT--FQDESSLYFLLEYAPNGDFLS----VMKKYGSLSEDCTRYYSAQII 291

Query: 463 NGLREIHNTNGVNIGDLDCDKIILTGKGRIKIS 495
           +G++ +H + G+   D+  + I+L    ++KI+
Sbjct: 292 DGIKYLH-SKGIIHRDIKPENILLDKDMKVKIT 323

>Scas_715.34
          Length = 1150

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 14/57 (24%)

Query: 452 DLLWS-------------YAVQILNGLREIHNTNGVNIGDLDCDKIILTGKGRIKIS 495
           DL+W              YA ++L  L+  H+ NGV   DL  + I+LT +G IKI+
Sbjct: 910 DLMWHVQNQRLSVRRAKFYAAEVLLALKYFHD-NGVIYRDLKLENILLTPQGHIKIA 965

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 48/92 (52%), Gaps = 6/92 (6%)

Query: 414 LTTAFGD-SSLGIVYDYYPNATSLYEAHFVNYPTVEVTEDLLWSYAVQILNGLREIHNTN 472
           L + F D SSL  + +Y PN   L  +    Y +++  E     YA QI++ +  +H +N
Sbjct: 243 LFSTFQDESSLYFLLEYAPNGDFL--SLMKKYGSLD--ETCARYYAAQIIDAIDYLH-SN 297

Query: 473 GVNIGDLDCDKIILTGKGRIKISAGAEYDIMN 504
           G+   D+  + I+L G+ +IK++      ++N
Sbjct: 298 GIIHRDIKPENILLDGEMKIKLTDFGTAKLLN 329

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
           regulates MAP kinase cascade involved in regulating cell
           wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 457 YAVQILNGLREIHNTNGVNIGDLDCDKIILTGKGRIKIS 495
           YA ++L  L+  H+ NGV   DL  + I+LT +G IKI+
Sbjct: 929 YAAEVLLALKYFHD-NGVIYRDLKLENILLTPEGHIKIA 966

>Kwal_27.10581
          Length = 1154

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 457 YAVQILNGLREIHNTNGVNIGDLDCDKIILTGKGRIKIS 495
           YA ++L  L+  H+ NGV   DL  + I+LT +G IKI+
Sbjct: 932 YAAEVLLALKYFHD-NGVIYRDLKLENILLTPEGHIKIA 969

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
           Kluyveromyces lactis protein kinase C, start by
           similarity
          Length = 1161

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 457 YAVQILNGLREIHNTNGVNIGDLDCDKIILTGKGRIKIS 495
           YA ++L  L+  H+ NGV   DL  + I+LT +G IKI+
Sbjct: 939 YAAEVLLSLKYFHD-NGVIYRDLKLENILLTPEGHIKIA 976

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH]
           (680398..683847) [3450 bp, 1149 aa]
          Length = 1149

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 457 YAVQILNGLREIHNTNGVNIGDLDCDKIILTGKGRIKIS 495
           YA ++L  L+  H+ NG+   DL  + I+LT +G IKI+
Sbjct: 927 YAAEVLLALKYFHD-NGIIYRDLKLENILLTLEGHIKIA 964

>Kwal_56.24478
          Length = 1296

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 72/185 (38%), Gaps = 15/185 (8%)

Query: 93   GSKSQVPKFNAKASASFTPMSKAADGTQETQAPYLESPVAGSPGPILKAGTPVSFMQPNI 152
            G  +  P  NAK+ +++TP + AA        PY   P A + G    +    SF QP  
Sbjct: 850  GPHAAAPPMNAKSQSTYTPQASAAGHVPAN--PYAP-PNASANGGAYGSFAQPSFSQP-F 905

Query: 153  YSTTPVPSPASMAMPNVVMPPNDMGSPDLGLQQQSHMVNLDG--SIQQNYQERPNVLMRD 210
                 V +  +  + + V PP  + S   G     + +  DG   +  + +E+P      
Sbjct: 906  KPVANVIAAGTSGINDAVQPPTSLSSAASGQTPHLNRMANDGWNDLPLSVKEKPTRAKAV 965

Query: 211  SSMPLTMGTSGSRPMLDQQIHSISGLSNTSGPQPPGLLQSMNGASMDMGLPMNLRYPTIY 270
            S  P ++  S + P       +I          PP L +  + AS+   +P  +   T  
Sbjct: 966  SVAPASVSASPAVPGPQVNFGAIP---------PPPLSRVTSSASLQTPVPQRVPSKTYA 1016

Query: 271  PPTHS 275
            PPT S
Sbjct: 1017 PPTGS 1021

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
           Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
           kinase, start by similarity
          Length = 1144

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 457 YAVQILNGLREIHNTNGVNIGDLDCDKIILTGKGRIKIS 495
           YA ++L  L+  H+ NGV   DL  + I+LT +G IKI+
Sbjct: 922 YAAEVLLALKFFHD-NGVIYRDLKLENILLTPEGHIKIA 959

>Sklu_2351.5 YGR009C, Contig c2351 9208-10833
          Length = 541

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 99  PKFNAKASASFTPMSKAADGTQETQAPYLESPVAGSPGPILKAGTPVSFMQPNIYSTTPV 158
           P  +A   + F P ++   G +ET +PY  +P   +      A +P    QPN+Y     
Sbjct: 89  PYMSAPPKSDFDPYARNNSGNRET-SPYSANPYERNSNSPYGANSPPYGQQPNVYDAQRT 147

Query: 159 PSPAS 163
            +PA+
Sbjct: 148 SAPAT 152

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 460  QILNGLREIHNTNGVNIGDLDCDKIILTGKGRIKI 494
            Q+ +GLR +H  NG+   D+  + +I+  +GR+KI
Sbjct: 1116 QVASGLRHLHE-NGIVHRDIKDENVIVDNRGRVKI 1149

>Scas_653.27
          Length = 444

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 90/202 (44%), Gaps = 30/202 (14%)

Query: 296 ENERTPRMLFIPNDLREELVKRNLASLQLFPSGG--NLPHIVKDYFGLVPLDFHQRSS-- 351
           E ER P   ++ N LR + + +N  +L L P  G  +LP+ + + F    +D  + S+  
Sbjct: 213 ECERKPLTQYMKNQLRYDTLSKN--TLVLVPGAGVGHLPYFIANEFPTFDVDSIELSTLM 270

Query: 352 -VKDRYKKHKNSLYKV--FS-NVDGRIYLLRRIHDVNISDPTI--------ISKTFQKW- 398
            + + +  H +   K+  F+ +  G++   ++   + +   TI        + + F+K+ 
Sbjct: 271 YICNEFALHSSKDVKIRPFNLSYSGQVDTEKQCRSIELKLSTIKQPKNLRVLLEDFRKYS 330

Query: 399 -SKIDSSNVVALKDLFLTTAFGDSSLGIVYDYYPNATSLYE----AHFVNYPTVEVTEDL 453
            SK+   N+V   + F+ TA        +++Y+     L +     H++N   ++     
Sbjct: 331 PSKVRYENIVVCSEYFIDTAEN------MFEYFEAIEHLKKYCDHLHWINVGPLKYGTRP 384

Query: 454 LWSYAVQILNGLREIHNTNGVN 475
           L  + V+ L  LRE+     V+
Sbjct: 385 LVQFTVEELTKLRELRGWKDVH 406

>Kwal_56.23486
          Length = 587

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 11/50 (22%)

Query: 142 GTPVSFMQPNIYSTTP-------VPSPASMA----MPNVVMPPNDMGSPD 180
           G P  FMQP  Y   P        P+P  MA    MP   +PP   G P+
Sbjct: 433 GMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNGVPPQQFGRPN 482

>Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement
          Length = 488

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 437 YEAHFVNYPTVEVTEDLLWSYAVQILNGLREIHNTNGVNIGDLDCDKIILTGKGRIKI 494
           Y+   V + +V+++E  + S+  QIL GL+ IH+ + ++  DL    I+ T  G +KI
Sbjct: 210 YDLARVIHSSVQLSEFHIKSFLYQILCGLKYIHSADVIH-RDLKPGNILCTIHGNLKI 266

>CAGL0K06127g 596781..597737 weakly similar to tr|Q04110
           Saccharomyces cerevisiae YDR446w involved in cell wall
           biogenesis and architecture, hypothetical start
          Length = 318

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 135 PGPILKAGTPVSFMQPNIYSTTPVPSPASMAMPNVVMPPNDMGS 178
           PG +  A  P  F+ P +   TP+    ++++P++ +PP++M S
Sbjct: 81  PGQLDGASDPAKFV-PGLGLKTPIKDEGNISLPSINLPPSEMRS 123

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,437,110
Number of extensions: 1061444
Number of successful extensions: 3205
Number of sequences better than 10.0: 56
Number of HSP's gapped: 3291
Number of HSP's successfully gapped: 63
Length of query: 706
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 597
Effective length of database: 12,822,747
Effective search space: 7655179959
Effective search space used: 7655179959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)