Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L09867g26025612940.0
Kwal_14.8682822238771e-119
Scas_685.92001918631e-118
Sklu_2380.52892258661e-117
YKL024C (URA6)2041927901e-107
KLLA0E08030g3022237771e-104
ACR170C2892237751e-103
CAGL0K11418g2222212072e-19
Scas_721.822212152002e-18
AGR187W2772132004e-18
Kwal_56.234892251891904e-17
KLLA0F13376g2272131905e-17
Scas_681.182481941898e-17
CAGL0L11902g2511931882e-16
YDR226W (ADK1)2222141818e-16
AGR115C2512071821e-15
Kwal_27.116072272131783e-15
Sklu_2123.22281881722e-14
KLLA0C17754g2271881685e-14
YER170W (ADK2)2251851582e-12
Sklu_2063.3208141890.002
ACL150W219140790.033
YDL166C (FAP7)197141780.037
Scas_706.32222365710.50
AFL110C547109681.1
YDR235W (PRP42)54468671.7
KLLA0E01430g21744624.6
ADR282C22144625.2
Scas_617.742064617.2
AAR041W51455617.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L09867g
         (256 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L09867g 1054344..1055126 some similarities with sp|P15700 S...   503   0.0  
Kwal_14.868                                                           342   e-119
Scas_685.9                                                            337   e-118
Sklu_2380.5 YKL024C, Contig c2380 11212-12081                         338   e-117
YKL024C (URA6) [3231] chr11 complement(392169..392783) Uridine-m...   308   e-107
KLLA0E08030g complement(724562..725470) some similarities with s...   303   e-104
ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH] (653511..65...   303   e-103
CAGL0K11418g complement(1109653..1110321) highly similar to sp|P...    84   2e-19
Scas_721.82                                                            82   2e-18
AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH] complement(...    82   4e-18
Kwal_56.23489                                                          78   4e-17
KLLA0F13376g 1234589..1235272 highly similar to sp|P07170 Saccha...    78   5e-17
Scas_681.18                                                            77   8e-17
CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces...    77   2e-16
YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase (GT...    74   8e-16
AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH] (959464..96...    75   1e-15
Kwal_27.11607                                                          73   3e-15
Sklu_2123.2 YDR226W, Contig c2123 4210-4896                            71   2e-14
KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces...    69   5e-14
YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase (GT...    65   2e-12
Sklu_2063.3 YDL166C, Contig c2063 1224-1850                            39   0.002
ACL150W [899] [Homologous to ScYDL166C (FAP7) - SH] complement(8...    35   0.033
YDL166C (FAP7) [705] chr4 complement(163450..164043) Essential p...    35   0.037
Scas_706.32                                                            32   0.50 
AFL110C [3085] [Homologous to ScYPL214C (THI6) - SH] (232458..23...    31   1.1  
YDR235W (PRP42) [1070] chr4 (933496..935130) U1 snRNA-associated...    30   1.7  
KLLA0E01430g complement(141256..141909) similar to sp|Q03798 Sac...    28   4.6  
ADR282C [2023] [Homologous to ScYMR157C - SH] (1182869..1183534)...    28   5.2  
Scas_617.7                                                             28   7.2  
AAR041W [227] [Homologous to ScYPR088C (SRP54) - SH] complement(...    28   7.4  

>CAGL0L09867g 1054344..1055126 some similarities with sp|P15700
           Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase, hypothetical start
          Length = 260

 Score =  503 bits (1294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/256 (95%), Positives = 245/256 (95%)

Query: 1   MRMQSTVPPPQRSNVNVKKWXXXXXXXXXXXTTIYSVSNEKGEPKEFLEAEKRAGKQEKQ 60
           MRMQSTVPPPQRSNVNVKKW           TTIYSVSNEKGEPKEFLEAEKRAGKQEKQ
Sbjct: 1   MRMQSTVPPPQRSNVNVKKWGLLVLGALAVGTTIYSVSNEKGEPKEFLEAEKRAGKQEKQ 60

Query: 61  AGPAFSEDQVSVIFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELI 120
           AGPAFSEDQVSVIFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELI
Sbjct: 61  AGPAFSEDQVSVIFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELI 120

Query: 121 KHYIKEGLIVPQEITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIVPSKFTL 180
           KHYIKEGLIVPQEITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIVPSKFTL
Sbjct: 121 KHYIKEGLIVPQEITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIVPSKFTL 180

Query: 181 FFECPEQVMLERLLERGKTSGRADDNIESIKKRFRTFEETSMPVVRYFDSQDKVVKVRCD 240
           FFECPEQVMLERLLERGKTSGRADDNIESIKKRFRTFEETSMPVVRYFDSQDKVVKVRCD
Sbjct: 181 FFECPEQVMLERLLERGKTSGRADDNIESIKKRFRTFEETSMPVVRYFDSQDKVVKVRCD 240

Query: 241 HPVEDVYNQVKQALTA 256
           HPVEDVYNQVKQALTA
Sbjct: 241 HPVEDVYNQVKQALTA 256

>Kwal_14.868
          Length = 282

 Score =  342 bits (877), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 192/223 (86%), Gaps = 4/223 (1%)

Query: 32  TTIYSVSNEKGEPKEFLEAEKRAGKQEKQAGPAFSEDQVSVIFVLGGPGAGKGTQCAKLV 91
           +T+ S+S +K  P EF+E E      +   GPAFS+  VSVIFVLGGPGAGKGTQCA LV
Sbjct: 59  STLVSISYQKNGPVEFVEEEN----SKASTGPAFSDKDVSVIFVLGGPGAGKGTQCANLV 114

Query: 92  NDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQEITLSLLQKAIKENYEKNY 151
            DY+FVHLSAGDLLRAEQNREGS++G LIKHYIKEGLIVPQE+T++LLQ+AI++NY++ +
Sbjct: 115 RDYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEVTVALLQQAIQDNYDQGH 174

Query: 152 TKFLVDGFPRKMDQALSFEKQIVPSKFTLFFECPEQVMLERLLERGKTSGRADDNIESIK 211
            +FLVDGFPRKMDQA++FE+QIVPSKFTLFF+CPE+VML+RLLERGKTSGR+DDN+ESIK
Sbjct: 175 KRFLVDGFPRKMDQAITFEEQIVPSKFTLFFDCPEKVMLQRLLERGKTSGRSDDNVESIK 234

Query: 212 KRFRTFEETSMPVVRYFDSQDKVVKVRCDHPVEDVYNQVKQAL 254
           KRF+TF ETSMPVV YF+ QDKVV V CDH VE VY QVK A+
Sbjct: 235 KRFKTFIETSMPVVEYFEKQDKVVSVSCDHSVEKVYEQVKAAV 277

>Scas_685.9
          Length = 200

 Score =  337 bits (863), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 174/191 (91%)

Query: 64  AFSEDQVSVIFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKHY 123
           AF+ DQVSVIFVLGGPGAGKGTQCAKLV DY FVHLSAGDLLRAEQNREGSEFG LIKHY
Sbjct: 5   AFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHY 64

Query: 124 IKEGLIVPQEITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIVPSKFTLFFE 183
           I EGLIVPQEITL+LL+ AI+ENY+K   KFLVDGFPRKMDQALSFE+QIVPSKF LFF+
Sbjct: 65  ITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFILFFD 124

Query: 184 CPEQVMLERLLERGKTSGRADDNIESIKKRFRTFEETSMPVVRYFDSQDKVVKVRCDHPV 243
           CPE VMLERLL+RGKTSGR DDNIESIKKRF+TFEETSMPVV+YF+ Q KV+K+RCD PV
Sbjct: 125 CPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRCDSPV 184

Query: 244 EDVYNQVKQAL 254
           +DVY QVK A+
Sbjct: 185 DDVYKQVKAAV 195

>Sklu_2380.5 YKL024C, Contig c2380 11212-12081
          Length = 289

 Score =  338 bits (866), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 189/225 (84%), Gaps = 6/225 (2%)

Query: 32  TTIYSVSNEKGEPKEFLEAEKRAGKQEKQAGPAFSEDQVSVIFVLGGPGAGKGTQCAKLV 91
           +T++S+S +K  P EF+E         +  GPAFS + VSV+FVLGGPGAGKGTQC KLV
Sbjct: 67  STLFSISYQKNPPVEFME------NAPEDKGPAFSPEDVSVVFVLGGPGAGKGTQCTKLV 120

Query: 92  NDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQEITLSLLQKAIKENYEKNY 151
            DY FVHLSAGDLLRAEQNR+GSE+G LIKHYIKEGLIVPQE+T++LLQ AI+EN+E   
Sbjct: 121 KDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVTVALLQNAIRENFEDGK 180

Query: 152 TKFLVDGFPRKMDQALSFEKQIVPSKFTLFFECPEQVMLERLLERGKTSGRADDNIESIK 211
            +FLVDGFPRKMDQA++FEKQIVPSKFTLFF+CPE VMLERLLERGKTSGR DDNIESIK
Sbjct: 181 KRFLVDGFPRKMDQAITFEKQIVPSKFTLFFDCPETVMLERLLERGKTSGRTDDNIESIK 240

Query: 212 KRFRTFEETSMPVVRYFDSQDKVVKVRCDHPVEDVYNQVKQALTA 256
           KRFRTF ETSMPVV YF+ Q+KV+KV CD P+++VY +V+ A+ A
Sbjct: 241 KRFRTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVEA 285

>YKL024C (URA6) [3231] chr11 complement(392169..392783)
           Uridine-monophosphate kinase (uridylate kinase),
           catalyzes the conversion of ATP and UMP to ADP and UDP
           [615 bp, 204 aa]
          Length = 204

 Score =  308 bits (790), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 145/192 (75%), Positives = 166/192 (86%)

Query: 63  PAFSEDQVSVIFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKH 122
           PAFS DQVSVIFVLGGPGAGKGTQC KLV DY FVHLSAGDLLRAEQ R GS++GELIK+
Sbjct: 9   PAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKN 68

Query: 123 YIKEGLIVPQEITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIVPSKFTLFF 182
            IKEG IVPQEITL+LL+ AI +N + N  KFL+DGFPRKMDQA+SFE+ IV SKF LFF
Sbjct: 69  CIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFF 128

Query: 183 ECPEQVMLERLLERGKTSGRADDNIESIKKRFRTFEETSMPVVRYFDSQDKVVKVRCDHP 242
           +CPE +MLERLLERGKTSGR+DDNIESIKKRF TF+ETSMPV+ YF+++ KVV+VRCD  
Sbjct: 129 DCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRS 188

Query: 243 VEDVYNQVKQAL 254
           VEDVY  V+ A+
Sbjct: 189 VEDVYKDVQDAI 200

>KLLA0E08030g complement(724562..725470) some similarities with
           sp|P15700 Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase singleton, hypothetical
           start
          Length = 302

 Score =  303 bits (777), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 144/223 (64%), Positives = 181/223 (81%), Gaps = 3/223 (1%)

Query: 32  TTIYSVSNEKGEPKEFLEAEKRAGKQEKQAGPAFSEDQVSVIFVLGGPGAGKGTQCAKLV 91
           +++ S+S +K  P  F   E+     +K+  PAFS+D V V+FVLGGPGAGKGTQCAKLV
Sbjct: 77  SSVVSLSYQKNPPVAF---EEGPVSDDKKKTPAFSKDDVLVVFVLGGPGAGKGTQCAKLV 133

Query: 92  NDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQEITLSLLQKAIKENYEKNY 151
            D+ FVHLSAGDLLRAEQ REGS++GELIK  IK+G IVPQE+T++LL+ AI  NY  + 
Sbjct: 134 KDFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVTVALLKNAITSNYNSSN 193

Query: 152 TKFLVDGFPRKMDQALSFEKQIVPSKFTLFFECPEQVMLERLLERGKTSGRADDNIESIK 211
            KFLVDGFPRKMDQA++FE++IVPS  TLFF+CPE++MLERLL+RGKTSGR DDNIESI+
Sbjct: 194 KKFLVDGFPRKMDQAITFEEEIVPSTMTLFFDCPEKIMLERLLQRGKTSGRIDDNIESIQ 253

Query: 212 KRFRTFEETSMPVVRYFDSQDKVVKVRCDHPVEDVYNQVKQAL 254
           KRF+TF ETS+PVV YF+ Q+KVVKV C+ PV++VY  V +A+
Sbjct: 254 KRFKTFVETSVPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAI 296

>ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH]
           (653511..654380) [870 bp, 289 aa]
          Length = 289

 Score =  303 bits (775), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 144/223 (64%), Positives = 181/223 (81%), Gaps = 8/223 (3%)

Query: 32  TTIYSVSNEKGEPKEFLEAEKRAGKQEKQAGPAFSEDQVSVIFVLGGPGAGKGTQCAKLV 91
           TT+YS+  +K  P+E  EAE      ++ A P  ++   SV+FVLGGPG+GKGTQC++LV
Sbjct: 68  TTLYSIMYQKAPPRELREAE------DESARPLPAD--ASVVFVLGGPGSGKGTQCSRLV 119

Query: 92  NDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQEITLSLLQKAIKENYEKNY 151
              +FVH+ AGDLLR EQNR GS++GELIKH+IKEGLIVPQE+T++LL++AI+E+Y    
Sbjct: 120 ERMQFVHVGAGDLLRDEQNRPGSQYGELIKHHIKEGLIVPQEVTVALLRRAIEEHYRAGR 179

Query: 152 TKFLVDGFPRKMDQALSFEKQIVPSKFTLFFECPEQVMLERLLERGKTSGRADDNIESIK 211
            KFLVDGFPRKMDQA +FEK +VPSKF LFF+CPE+VMLERLL RG+TSGR+DDNIESIK
Sbjct: 180 RKFLVDGFPRKMDQAFTFEKTVVPSKFVLFFDCPERVMLERLLTRGQTSGRSDDNIESIK 239

Query: 212 KRFRTFEETSMPVVRYFDSQDKVVKVRCDHPVEDVYNQVKQAL 254
           KRFRT+ ETSMPVV +F  QDKVV++ CD PVE+VY QV+ A+
Sbjct: 240 KRFRTYVETSMPVVEHFAQQDKVVRLSCDQPVEEVYKQVEAAV 282

>CAGL0K11418g complement(1109653..1110321) highly similar to
           sp|P07170 Saccharomyces cerevisiae YDR226w ADK1
           adenylate kinase, start by similarity
          Length = 222

 Score = 84.3 bits (207), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 106/221 (47%), Gaps = 36/221 (16%)

Query: 66  SEDQVSVIFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIK 125
           S D + ++ + G PGAGKGTQ   LV  +   HL+ GD+LR+ Q  +G+E G   K  + 
Sbjct: 3   SSDSIRMVLI-GPPGAGKGTQAPNLVERFHAAHLATGDMLRS-QISKGTELGLQAKKIMD 60

Query: 126 EGLIVPQEITLSLLQKAIKENYE-KNYTKFLVDGFPRKMDQALSFEKQI----VPSKFTL 180
           +G +V  +I +++++  +  N   KN   F++DGFPR + QA   +  +     P +  +
Sbjct: 61  QGGLVSDDIMVNMIKDELTNNPACKN--GFILDGFPRTIPQAEKLDNMLKERGTPLEKAV 118

Query: 181 FFECPEQVMLERLLER--GKTSG-------------------------RADDNIESIKKR 213
             +  +++++ R+  R     SG                         R+DDN +++KKR
Sbjct: 119 ELKIDDELLVARITGRLIHPASGRSYHKLFNPPKEDMKDDVTGEPLVQRSDDNEDALKKR 178

Query: 214 FRTFEETSMPVVRYFDSQDKVVKVRCDHPVEDVYNQVKQAL 254
              + + + P+V ++        V    P E V++ + +AL
Sbjct: 179 LGAYHDQTEPIVDFYKKTGIWADVDASQPPETVWSAILKAL 219

>Scas_721.82
          Length = 221

 Score = 81.6 bits (200), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 103/215 (47%), Gaps = 35/215 (16%)

Query: 73  IFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQ 132
           + ++G PGAGKGTQ   LV  +   HLS GD+LR+ Q  + +E G+  K  + +G +V  
Sbjct: 8   MVLIGPPGAGKGTQAPNLVEKFHACHLSTGDMLRS-QIAKNTELGQEAKKIMDQGGLVSD 66

Query: 133 EITLSLLQKAIKENYE-KNYTKFLVDGFPRKMDQALSFEKQI----VPSKFTLFFECPEQ 187
           EI +++++  +  N   KN   F++DGFPR + QA   ++ +     P +  +  +  + 
Sbjct: 67  EIMVNMIKDELTNNPACKN--GFILDGFPRTIPQAEKLDQMLAERGTPLQRAVELQVDDD 124

Query: 188 VMLERLLER--GKTSG-------------------------RADDNIESIKKRFRTFEET 220
           +++ R+  R     SG                         R+DDN +++KKR   +   
Sbjct: 125 LLVARITGRLIHPASGRSYHKLFNPPKVDMVDDVTGEPLIQRSDDNADALKKRLAGYHAQ 184

Query: 221 SMPVVRYFDSQDKVVKVRCDHPVEDVYNQVKQALT 255
           + P+V ++        V    P   V++++ ++L+
Sbjct: 185 TEPIVDFYKKTGIWSGVDASQPPATVWDEILKSLS 219

>AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH]
           complement(1102660..1103493) [834 bp, 277 aa]
          Length = 277

 Score = 81.6 bits (200), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 102/213 (47%), Gaps = 33/213 (15%)

Query: 73  IFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQ 132
           + ++G PGAGKGTQ  KL   +   HL+ GD+LR++  ++ +  G   K  + +G +V  
Sbjct: 65  MVLIGPPGAGKGTQAPKLKEKFCVCHLATGDMLRSQVAKQ-TALGVQAKKIMDQGGLVSD 123

Query: 133 EITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIV----PSKFTLFFECPEQV 188
           EI +++++  ++ N E     F++DGFPR + QA   ++ +V    P    +  +  +++
Sbjct: 124 EIMVNMIKDELRSNPE-CANGFILDGFPRTIPQAQKLDEMLVAQGKPLDRAVELKIDDEL 182

Query: 189 MLERLLER--GKTSG-------------------------RADDNIESIKKRFRTFEETS 221
           ++ R+  R     SG                         R+DDN +++KKR   +   +
Sbjct: 183 LVARITGRLVHPASGRSYHKLFNPPKVAMTDDVTGDPLVQRSDDNADALKKRLDAYHAQT 242

Query: 222 MPVVRYFDSQDKVVKVRCDHPVEDVYNQVKQAL 254
            P+V ++        V    P + V++ + +AL
Sbjct: 243 EPIVDFYKKTGIWAGVDASQPPKTVWSDILKAL 275

>Kwal_56.23489
          Length = 225

 Score = 77.8 bits (190), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 92/189 (48%), Gaps = 34/189 (17%)

Query: 73  IFVLGGPGAGKGTQCAKLVNDYKFVH-LSAGDLLRAEQNREGSEFGELIKHYIKEGLIVP 131
           I +LG PG+GKGTQ +KL++ +K++  +S+GDLLR E  ++ +  G L   YI +G ++P
Sbjct: 6   ILLLGAPGSGKGTQTSKLLSHFKYIRSISSGDLLRQEIQKK-THLGSLASEYISQGKLLP 64

Query: 132 QEITLSLLQKAIK-ENYEKNYTKFLVDGFPRKMDQALSFEKQIVP--SKFTLFFE--CPE 186
             +   L+   +       + + FL+DGFPR +DQA S   ++ P  S   L  E   P 
Sbjct: 65  DSLVTELVTNELTARGLLSSDSSFLLDGFPRTLDQAKSLRSKLAPHGSPLNLVVELDVPS 124

Query: 187 QVMLERLLER--------------------GK-------TSGRADDNIESIKKRFRTFEE 219
            V+LER+  R                    GK        + R DD  E   KR   + +
Sbjct: 125 SVILERIENRYVHVPSGRVYNLTYNPPLVAGKDDVTGEPLTKRPDDTAEVFGKRLENYAQ 184

Query: 220 TSMPVVRYF 228
           T  P+ +++
Sbjct: 185 TVEPLKQFY 193

>KLLA0F13376g 1234589..1235272 highly similar to sp|P07170
           Saccharomyces cerevisiae YDR226w ADK1 adenylate kinase,
           cytosolic, start by similarity
          Length = 227

 Score = 77.8 bits (190), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 102/213 (47%), Gaps = 33/213 (15%)

Query: 73  IFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQ 132
           + ++G PGAGKGTQ   L   +   HL+ GD+LR++  ++ +  G   K  + +G +V  
Sbjct: 14  MVLIGPPGAGKGTQAPNLTERFCACHLATGDMLRSQVAKQ-TPLGIEAKKIMDDGKLVSD 72

Query: 133 EITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIV----PSKFTLFFECPEQV 188
           EI +++++  +  N +     F++DGFPR + QA   ++ +     P +  +  +  +++
Sbjct: 73  EIMINMIKDELTNNQDCK-KGFILDGFPRTIPQAEKLDEMLAQQGRPLEKAVELKIDDEL 131

Query: 189 MLERLLER--GKTSG-------------------------RADDNIESIKKRFRTFEETS 221
           ++ R+  R     SG                         R+DDN+E++KKR  ++ + +
Sbjct: 132 LVSRITGRLVHPASGRSYHKVFNPPKTEMKDDITGEDLVQRSDDNVEALKKRLTSYHKQT 191

Query: 222 MPVVRYFDSQDKVVKVRCDHPVEDVYNQVKQAL 254
            P+V ++        V    P + V++ + + L
Sbjct: 192 EPIVDFYKKTGIWAGVDASQPPKTVWSDILKCL 224

>Scas_681.18
          Length = 248

 Score = 77.4 bits (189), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 99/194 (51%), Gaps = 36/194 (18%)

Query: 73  IFVLGGPGAGKGTQCAKLVNDYKFVH-LSAGDLLRAEQNREGSEFGELIKHYIKEGLIVP 131
           +  LG PG+GKGTQ ++L+     V+ +S+GD+LR E   E ++ G+L   +I +G ++P
Sbjct: 10  LVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAE-TKLGQLASQFIAQGKLIP 68

Query: 132 QEITLSLLQKAIKE-NYEKNYTK--FLVDGFPRKMDQALSFEKQIVPS----KFTLFFEC 184
            ++   LL   ++E N+    +K  +++DGFPR + QA  F++ +          +  + 
Sbjct: 69  DDLIDKLLISKLQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELDV 128

Query: 185 PEQVMLERLLER--------------------GK--TSG-----RADDNIESIKKRFRTF 217
           P +V+LER+  R                    GK   +G     R+DD+  + KKR + +
Sbjct: 129 PTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQEY 188

Query: 218 EETSMPVVRYFDSQ 231
            ET  P+  Y+ SQ
Sbjct: 189 HETLGPLKEYYQSQ 202

>CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w KAD2, hypothetical start
          Length = 251

 Score = 77.0 bits (188), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 95/193 (49%), Gaps = 34/193 (17%)

Query: 81  AGKGTQCAKLVNDY-KFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQE-ITLSL 138
           +GKGTQ +KL+    +   +S+GD+LR E  + G+E G L   YI +G ++P + IT  L
Sbjct: 19  SGKGTQTSKLLKVLPELKSVSSGDILRHEL-KSGTELGVLAAKYIAQGKLIPDKVITQVL 77

Query: 139 LQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIVP--SKFTLFFE--CPEQVMLERLL 194
           +    KE +    + +L+DGFPR   QA S +  +    +K  L  E   PE+V+LER+ 
Sbjct: 78  IAHLSKEKWLNPQSSWLLDGFPRTERQAFSLDSTLGENNAKLNLVVELDVPEEVILERID 137

Query: 195 ER----------------GKTSG-----------RADDNIESIKKRFRTFEETSMPVVRY 227
            R                 K +G           R+DDN++  KKR + +++T  P+  +
Sbjct: 138 NRYIHVGSGRVYNLQYNPPKVAGKDDVTGEPLVKRSDDNVQVFKKRMKEYKKTLGPIKEH 197

Query: 228 FDSQDKVVKVRCD 240
           +  Q  +  +  D
Sbjct: 198 YAKQGILATISGD 210

>YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase
           (GTP:AMP phosphotransferase), cytoplasmic and
           mitochondrial [669 bp, 222 aa]
          Length = 222

 Score = 74.3 bits (181), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 98/214 (45%), Gaps = 35/214 (16%)

Query: 73  IFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQ 132
           + ++G PGAGKGTQ   L   +   HL+ GD+LR+ Q  +G++ G   K  + +G +V  
Sbjct: 9   MVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRS-QIAKGTQLGLEAKKIMDQGGLVSD 67

Query: 133 EITLSLLQKAIKENYE-KNYTKFLVDGFPRKMDQALSFEK----QIVPSKFTLFFECPEQ 187
           +I +++++  +  N   KN   F++DGFPR + QA   ++    Q  P +  +  +  ++
Sbjct: 68  DIMVNMIKDELTNNPACKN--GFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDE 125

Query: 188 VMLERLLER--GKTSG-------------------------RADDNIESIKKRFRTFEET 220
           +++ R+  R     SG                         R+DDN +++KKR   +   
Sbjct: 126 LLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQ 185

Query: 221 SMPVVRYFDSQDKVVKVRCDHPVEDVYNQVKQAL 254
           + P+V ++        V    P   V+  +   L
Sbjct: 186 TEPIVDFYKKTGIWAGVDASQPPATVWADILNKL 219

>AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH]
           (959464..960219) [756 bp, 251 aa]
          Length = 251

 Score = 74.7 bits (182), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 94/207 (45%), Gaps = 36/207 (17%)

Query: 73  IFVLGGPGAGKGTQCAKLVNDYKFVH-LSAGDLLRAEQNREGSEFGELIKHYIKEGLIVP 131
           + +LG PGAGKGTQ  +L+  +  +  +++GDLLR E    GS  GE    +I  G ++P
Sbjct: 33  LLLLGAPGAGKGTQMGRLLQRFPGLQAVASGDLLRREIA-AGSPLGEQAAAHIAAGRLLP 91

Query: 132 QEITLS-LLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQI--VPSKFTLFFE--CPE 186
             +  S +L +  +  +      +L+DGFPR + QA   +  +    +  TL  E   PE
Sbjct: 92  DALVSSAILDELARRRWLHGGASWLLDGFPRTVAQAQELDAALERADAALTLVVEVAVPE 151

Query: 187 QVMLERLLER------GKT---------------------SGRADDNIESIKKRFRTFEE 219
            V+L+R+ +R      G+                      S R DD  E   KR + +  
Sbjct: 152 DVILDRIQKRFVHVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAA 211

Query: 220 TSMPVVRYFDSQDKVVKVRCDHPVEDV 246
           T+ P+  ++  Q  +  VR   P  D+
Sbjct: 212 TAGPLKEHYARQGILRTVRG--PTSDI 236

>Kwal_27.11607
          Length = 227

 Score = 73.2 bits (178), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 99/213 (46%), Gaps = 33/213 (15%)

Query: 73  IFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQ 132
           + ++G PGAGKGTQ   L   +   HL+ GD+LR+ Q  + +E G   K  + +G +V  
Sbjct: 14  MVLIGPPGAGKGTQAPNLKERFCACHLATGDMLRS-QVAQKTELGLEAKKIMDQGGLVSD 72

Query: 133 EITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIV----PSKFTLFFECPEQV 188
           +I + +++  +  N E   + F++DGFPR + QA   ++ +     P +  +  +  +++
Sbjct: 73  DIMVKMIKHELITNPECK-SGFILDGFPRTIPQAEKLDQMLTEQGRPLEKAIELKIDDEL 131

Query: 189 MLERLLER--GKTSG-------------------------RADDNIESIKKRFRTFEETS 221
           ++ R+  R     SG                         R+DDN +++KKR   + + +
Sbjct: 132 LVSRITGRLVHPASGRSYHKIFNPPKKEMTDDVTGEALVQRSDDNADALKKRLGAYHQQT 191

Query: 222 MPVVRYFDSQDKVVKVRCDHPVEDVYNQVKQAL 254
            P+V ++        V    P + V+  + + L
Sbjct: 192 EPIVDFYKKTGIWSGVDASQPPKTVWADILKCL 224

>Sklu_2123.2 YDR226W, Contig c2123 4210-4896
          Length = 228

 Score = 70.9 bits (172), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 94/188 (50%), Gaps = 35/188 (18%)

Query: 73  IFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQ 132
           + ++G PGAGKGTQ   L   +   HL+ GD+LR++  ++ +  G   K  + +G +V  
Sbjct: 15  MVLIGPPGAGKGTQAPNLKERFCACHLATGDMLRSQVAKK-TALGLEAKKIMDQGGLVSD 73

Query: 133 EITLSLLQKAIKENYE-KNYTKFLVDGFPRKMDQALSFEKQIV----PSKFTLFFECPEQ 187
           +I ++++++ +  N E KN   F++DGFPR + QA   ++ +     P +  +  +  ++
Sbjct: 74  DIMVNMIKEELATNPECKN--GFILDGFPRTIPQAEKLDEMLAEQGKPLERAIELKIDDE 131

Query: 188 VMLERLLER--GKTSG-------------------------RADDNIESIKKRFRTFEET 220
           +++ R+  R     SG                         R+DDN +++KKR   + + 
Sbjct: 132 LLVARITGRLVHPASGRSYHKLFNPPKVDMKDDVTGEPLVQRSDDNADALKKRLNAYHQQ 191

Query: 221 SMPVVRYF 228
           + P+V ++
Sbjct: 192 TEPIVDFY 199

>KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w ADK2 adenylate kinase, mitochondrial,
           start by similarity
          Length = 227

 Score = 69.3 bits (168), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 88/188 (46%), Gaps = 34/188 (18%)

Query: 77  GGPGAGKGTQCAKLVNDYKFVH-LSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQEIT 135
           G PG+GKGTQ +KL+ ++  +  +S+GDLLR +Q   G+  G     YI++G ++P ++ 
Sbjct: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLR-KQIEHGTPLGLSASSYIEKGQLLPDDLI 71

Query: 136 LSLLQKAIKE-NYEKNYTKFLVDGFPRKMDQALSFEKQIVPSKFTLF----FECPEQVML 190
             ++   +K   +      +L+DGFPR + QA   +K ++    +L      + P +V+L
Sbjct: 72  TGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVIL 131

Query: 191 ERLLER--------------------GK-------TSGRADDNIESIKKRFRTFEETSMP 223
           ER+  R                    GK        + R DD  E   KR   + +T  P
Sbjct: 132 ERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTP 191

Query: 224 VVRYFDSQ 231
           +  ++  Q
Sbjct: 192 LKEHYLKQ 199

>YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase
           (GTP:AMP phosphotransferase), mitochondrial [678 bp, 225
           aa]
          Length = 225

 Score = 65.5 bits (158), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 83/185 (44%), Gaps = 34/185 (18%)

Query: 77  GGPGAGKGTQCAKLVNDY-KFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQEIT 135
           G PG+GKGTQ ++L+    +   +S+GD+LR E   E S  G     YI +G ++P ++ 
Sbjct: 21  GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSE-STLGREATTYIAQGKLLPDDLI 79

Query: 136 LSLLQKAIKE-NYEKNYTKFLVDGFPRKMDQALSFEKQI----VPSKFTLFFECPEQVML 190
             L+   +    + K    +L+DGFPR   QA + ++ +          +  + PE  +L
Sbjct: 80  TRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTIL 139

Query: 191 ERLLER------GKT---------------------SGRADDNIESIKKRFRTFEETSMP 223
           ER+  R      G+                      + R DD  E  KKR   +++T+ P
Sbjct: 140 ERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEP 199

Query: 224 VVRYF 228
           +  Y+
Sbjct: 200 LKDYY 204

>Sklu_2063.3 YDL166C, Contig c2063 1224-1850
          Length = 208

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 64/141 (45%), Gaps = 27/141 (19%)

Query: 73  IFVLGGPGAGKGTQCAKLV---NDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLI 129
           I V G PG GK T C  LV   +DY + ++S  D  R  +  +G  + E+ K +     I
Sbjct: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDG--YDEVRKSH-----I 60

Query: 130 VPQEITLSLLQKAIKENYEKNYTKFLV-DGFPRKMDQALSFEKQIVPSKFTLFFECPEQV 188
           V ++  L  L+  +++   K+   + V D FP ++                +   C   +
Sbjct: 61  VDEDKLLDELEPLLRKG--KSIVDWHVNDVFPERL------------IDLVVVLRCDNSI 106

Query: 189 MLERLLERGKTSGRADDNIES 209
           + +RL +RG    + ++N+++
Sbjct: 107 LYDRLHKRGYHDSKIEENLDA 127

>ACL150W [899] [Homologous to ScYDL166C (FAP7) - SH]
           complement(87745..88404) [660 bp, 219 aa]
          Length = 219

 Score = 35.0 bits (79), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 59/140 (42%), Gaps = 25/140 (17%)

Query: 73  IFVLGGPGAGKGTQCAKL---VNDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLI 129
           I V G PG GK T C  L   + DY++ ++S  D  R     +G  + E  K +I +   
Sbjct: 10  ILVSGTPGCGKSTTCELLQRHLPDYQYFNIS--DFAREHNCYDG--YDEARKSHIVDEDR 65

Query: 130 VPQEITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIVPSKFTLFFECPEQVM 189
           +  E+   L +     ++  N      D FP ++                +   C   ++
Sbjct: 66  LLDELEPLLRRGGAIVDWHVN------DIFPERL------------IDLVVVLRCDNAIL 107

Query: 190 LERLLERGKTSGRADDNIES 209
            +RL +RG  S + ++NI++
Sbjct: 108 HDRLQKRGYHSSKIEENIDA 127

>YDL166C (FAP7) [705] chr4 complement(163450..164043) Essential
           protein important for Skn7p-dependent transcription of
           target genes during oxidative stress [594 bp, 197 aa]
          Length = 197

 Score = 34.7 bits (78), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 59/141 (41%), Gaps = 27/141 (19%)

Query: 73  IFVLGGPGAGKGTQCAKLVN---DYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLI 129
           I V G PG GK + C  L N   DYK+ ++S  D  +     EG + G       ++  I
Sbjct: 10  IIVTGTPGCGKSSTCEFLKNKLKDYKYYNIS--DFAKDNDCFEGYDEG-------RKSHI 60

Query: 130 VPQEITLSLLQKAIKENYEKNYTKFLV-DGFPRKMDQALSFEKQIVPSKFTLFFECPEQV 188
           V ++  L +L+  +++    +   + V D FP ++                +   C    
Sbjct: 61  VDEDKLLDMLEPLLRQG--NSIVDWHVNDVFPERL------------IDLVVVLRCDNSN 106

Query: 189 MLERLLERGKTSGRADDNIES 209
           +  RL  RG    + ++N+++
Sbjct: 107 LYSRLHARGYHDSKIEENLDA 127

>Scas_706.32
          Length = 2223

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%)

Query: 73   IFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQ 132
            +F+L  P   K  +  K +N    V L++ +L   + N +G    +++ H +  G  V  
Sbjct: 1594 LFLLQSPYPKKIMKSVKYLNQIPVVELASNELALPQLNWQGVLIKKIVNHLLSCGSWVSH 1653

Query: 133  EITLS 137
             ITLS
Sbjct: 1654 LITLS 1658

>AFL110C [3085] [Homologous to ScYPL214C (THI6) - SH]
           (232458..234101) [1644 bp, 547 aa]
          Length = 547

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 46/109 (42%), Gaps = 10/109 (9%)

Query: 32  TTIYSVSNEKGEPKEFLEAEKRAGKQEKQAG-PAFSEDQVSVIFVLGGPGAGKGTQ---- 86
            T+  +  +  +  +F+EA  R  +   +   P    D+V V   +   G   G Q    
Sbjct: 35  ATLVQLREKDADGCDFVEAALRVKRICAEFNVPLLINDRVDVALAVDADGVHVGQQDIPP 94

Query: 87  --CAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQE 133
               KLV   K V  S G   R E+ ++ +E+G+    YI  G+I P E
Sbjct: 95  PLVRKLVGPSKIVGWSVG---RPEEVQQLAEWGQGCVDYIGVGMIFPTE 140

>YDR235W (PRP42) [1070] chr4 (933496..935130) U1 snRNA-associated
           protein required for pre-mRNA splicing and U1 snRNP
           biogenesis [1635 bp, 544 aa]
          Length = 544

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 10/68 (14%)

Query: 172 QIVPSKFTLFFECPEQVMLERLLERGKTSGRADDNIESIKK--------RFRTFEETSMP 223
           +I+   +++  +  E V+L  LLE+ ++S    DN+E++          +F+TF + S+ 
Sbjct: 346 EIIKLLYSVICKLNEYVLLRNLLEKIESS--YSDNVENVDDFEIFWDYLQFKTFCQNSLY 403

Query: 224 VVRYFDSQ 231
             RY DSQ
Sbjct: 404 SSRYSDSQ 411

>KLLA0E01430g complement(141256..141909) similar to sp|Q03798
           Saccharomyces cerevisiae YMR157c hypothetical protein
           singleton, hypothetical start
          Length = 217

 Score = 28.5 bits (62), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 130 VPQEITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQI 173
           +P  +++ L+ K +KE  +K  T +L+D FP  +  A+ FE ++
Sbjct: 145 LPTGLSVVLIGKYMKEKCQKGDTVYLLD-FPDNIKDAIKFENEV 187

>ADR282C [2023] [Homologous to ScYMR157C - SH] (1182869..1183534)
           [666 bp, 221 aa]
          Length = 221

 Score = 28.5 bits (62), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 130 VPQEITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQI 173
           +P+   ++L+ + +KE  +   +  L+ GFPR M +A+ FE ++
Sbjct: 149 LPKGALVALMGRYLKEVCQAGDSVVLL-GFPRNMQEAIQFESEV 191

>Scas_617.7
          Length = 420

 Score = 28.1 bits (61), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%)

Query: 96  FVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQEITLSLLQKAIKENYEKNYTKFL 155
           F H+  G L +AE  +      + I+   KE +++  EITL +     +E  +     F+
Sbjct: 238 FSHIELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFI 297

Query: 156 VDGF 159
            +GF
Sbjct: 298 EEGF 301

>AAR041W [227] [Homologous to ScYPR088C (SRP54) - SH]
           complement(414310..415854) [1545 bp, 514 aa]
          Length = 514

 Score = 28.1 bits (61), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 71  SVIFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIK 125
           +V+  +G  GAGK T C+KL   Y       G L+ A+  R G+ F +L ++ IK
Sbjct: 106 NVVMFVGLQGAGKSTSCSKLAVYYSKRGFKVG-LVCADTFRAGA-FDQLKQNAIK 158

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,951,767
Number of extensions: 336174
Number of successful extensions: 1141
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1112
Number of HSP's successfully gapped: 37
Length of query: 256
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 157
Effective length of database: 13,168,927
Effective search space: 2067521539
Effective search space used: 2067521539
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)