Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L09845g38838213200.0
KLLA0C07733g98366639.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L09845g
         (382 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L09845g complement(1052846..1054012) some similarities with...   513   0.0  
KLLA0C07733g 676715..679666 weakly similar to sp|P40048 Saccharo...    29   9.8  

>CAGL0L09845g complement(1052846..1054012) some similarities with
           sp|Q12114 Saccharomyces cerevisiae YLR330w CHS5,
           hypothetical start
          Length = 388

 Score =  513 bits (1320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/382 (72%), Positives = 277/382 (72%)

Query: 1   MDDDELVNFLLSDDIVQKASKREKKSRWLRDSNAAADLVDTNNASPAVEGKSENVRNGND 60
           MDDDELVNFLLSDDIVQKASKREKKSRWLRDSNAAADLVDTNNASPAVEGKSENVRNGND
Sbjct: 1   MDDDELVNFLLSDDIVQKASKREKKSRWLRDSNAAADLVDTNNASPAVEGKSENVRNGND 60

Query: 61  TLEVDELEVDLDNLILSSGTAHGTKSKRPKRTRLKETTENSNKDFLKLLNEIIDKEVKEE 120
           TLEVDELEVDLDNLILSSGTAHGTKSKRPKRTRLKETTENSNKDFLKLLNEIIDKEVKEE
Sbjct: 61  TLEVDELEVDLDNLILSSGTAHGTKSKRPKRTRLKETTENSNKDFLKLLNEIIDKEVKEE 120

Query: 121 RLIVGNGGSSPTDSDXXXXXXXXXXXXXXXXXGRKTVETNAKDDDRPFEKVMDMFLKDEN 180
           RLIVGNGGSSPTDSD                 GRKTVETNAKDDDRPFEKVMDMFLKDEN
Sbjct: 121 RLIVGNGGSSPTDSDLTLKKKKKNKNKKTKNTGRKTVETNAKDDDRPFEKVMDMFLKDEN 180

Query: 181 GIQTELPKAEGNSTNDSXXXXXXXXXXXXXXXXXQITVEEIPETPQQTQNAIHNSDEXXX 240
           GIQTELPKAEGNSTNDS                 QITVEEIPETPQQTQNAIHNSDE   
Sbjct: 181 GIQTELPKAEGNSTNDSKELKAKRKKSKKKKPTKQITVEEIPETPQQTQNAIHNSDEDSK 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXGEGNENHDETSDXXXXXXXXXXXXXHDEDQLKHI 300
                                     GEGNENHDETSD             HDEDQLKHI
Sbjct: 241 IIIQRRKKDKKSKKKKKEKSHIDIGKGEGNENHDETSDKTFKKEKKLKAKKHDEDQLKHI 300

Query: 301 ETNMKIHNAEDDINNVTNSNSTSHPXXXXXXXXXXXXXIETDEHHDKPEISIEKENGGSX 360
           ETNMKIHNAEDDINNVTNSNSTSHP             IETDEHHDKPEISIEKENGGS 
Sbjct: 301 ETNMKIHNAEDDINNVTNSNSTSHPSLSKKSKKKKKKLIETDEHHDKPEISIEKENGGSS 360

Query: 361 XXXXXXXXXXXXXXXHVNTESA 382
                          HVNTESA
Sbjct: 361 IKSKKNRTKQKSKRSHVNTESA 382

>KLLA0C07733g 676715..679666 weakly similar to sp|P40048
           Saccharomyces cerevisiae YER075c PTP3 protein tyrosine
           phosphatase, start by similarity
          Length = 983

 Score = 28.9 bits (63), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 22  REKKSRWLRDSNAAADLVDTNNASPAVEGKSENVRNGNDTLEVDELEVDLDNLILSSGTA 81
           R++  R L  S++A+ +V T + S  V G    V +G+  ++ D+ E +L ++ +SSG  
Sbjct: 526 RKRLQRLLGPSSSAS-IVSTQSRS-TVAGNDRCVEDGHYDVDEDDAEENLQSITISSGVE 583

Query: 82  HGTKSK 87
            GTK++
Sbjct: 584 FGTKNR 589

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.302    0.124    0.332 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,728,589
Number of extensions: 427153
Number of successful extensions: 1074
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1068
Number of HSP's successfully gapped: 31
Length of query: 382
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 279
Effective length of database: 13,030,455
Effective search space: 3635496945
Effective search space used: 3635496945
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.7 bits)
S2: 62 (28.5 bits)