Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L09823g74373135230.0
Kwal_14.87472270116360.0
Scas_685.1076069016340.0
Sklu_2380.677471416050.0
YKL022C (CDC16)84059015910.0
KLLA0E07986g72157414730.0
ACR168W70755214410.0
AGL294W6562431472e-09
YBR112C (SSN6)9662261185e-06
KLLA0B09262g9412511186e-06
YHR166C (CDC23)6262201142e-05
Scas_599.58091821123e-05
Kwal_27.107406282581097e-05
ADL344W9102011042e-04
CAGL0I02288g6392711034e-04
Scas_680.356312141024e-04
CAGL0D01364g11482171016e-04
KLLA0A05258g632198980.001
Kwal_23.3670802221980.001
Scas_705.55907254980.002
AEL281C1390151970.002
YBL084C (CDC27)758153930.006
ABR206W682240860.032
KLLA0E20933g71093860.035
Scas_672.2430054840.042
Kwal_56.24750619112750.63
YOR080W (DIA2)746106750.69
CAGL0C01903g769240750.70
Kwal_33.134281052134750.83
ACR173W285118730.98
ACL058W81768741.1
AFL103C614134731.3
YOR027W (STI1)58996721.5
Scas_721.64578120721.6
Kwal_23.5408141070721.7
KLLA0A07062g58182721.7
ABR131W59481711.9
CAGL0L04048g58779702.6
KLLA0D01155g33559692.9
KLLA0B09966g370136693.2
YHR117W (TOM71)63983693.2
CAGL0L12936g60042693.9
Scas_585.491883694.1
KLLA0E00979g77495684.8
CAGL0E01573g90459684.8
Scas_666.23596104675.5
KLLA0F04191g88589675.9
CAGL0G10087g1411242676.1
CAGL0K11209g59082676.4
CAGL0J09570g54970676.8
CAGL0I07755g105395668.3
YDL238C489137659.5
CAGL0A03630g1062134669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L09823g
         (731 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L09823g 1050447..1052678 some similarities with sp|P09798 S...  1361   0.0  
Kwal_14.874                                                           634   0.0  
Scas_685.10                                                           634   0.0  
Sklu_2380.6 YKL022C, Contig c2380 14352-16676 reverse complement      622   0.0  
YKL022C (CDC16) [3233] chr11 complement(394369..396891) Componen...   617   0.0  
KLLA0E07986g 720700..722865 similar to sp|P09798 Saccharomyces c...   572   0.0  
ACR168W [1215] [Homologous to ScYKL022C (CDC16) - SH] complement...   559   0.0  
AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH] complement...    61   2e-09
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    50   5e-06
KLLA0B09262g 814303..817128 some similarities with sp|P14922 Sac...    50   6e-06
YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component...    49   2e-05
Scas_599.5                                                             48   3e-05
Kwal_27.10740                                                          47   7e-05
ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH] complement(...    45   2e-04
CAGL0I02288g complement(203605..205524) similar to sp|P16522 Sac...    44   4e-04
Scas_680.35                                                            44   4e-04
CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces c...    44   6e-04
KLLA0A05258g 466776..468674 similar to sp|P16522 Saccharomyces c...    42   0.001
Kwal_23.3670                                                           42   0.001
Scas_705.55                                                            42   0.002
AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH] (111535..11...    42   0.002
YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of...    40   0.006
ABR206W [800] [Homologous to ScYHR166C (CDC23) - SH] complement(...    38   0.032
KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042 Saccha...    38   0.035
Scas_672.24                                                            37   0.042
Kwal_56.24750                                                          33   0.63 
YOR080W (DIA2) [4887] chr15 (474553..476793) Protein involved in...    33   0.69 
CAGL0C01903g complement(199487..201796) similar to sp|P38042 Sac...    33   0.70 
Kwal_33.13428                                                          33   0.83 
ACR173W [1220] [Homologous to ScYJR088C - SH] complement(657718....    33   0.98 
ACL058W [991] [Homologous to NOHBY] complement(261723..264176) [...    33   1.1  
AFL103C [3092] [Homologous to ScYPL210C (SRP72) - SH] (245331..2...    33   1.3  
YOR027W (STI1) [4840] chr15 (381052..382821) Stress-induced prot...    32   1.5  
Scas_721.64                                                            32   1.6  
Kwal_23.5408                                                           32   1.7  
KLLA0A07062g complement(636546..638291) similar to sp|P15705 Sac...    32   1.7  
ABR131W [723] [Homologous to ScYNL121C (TOM70) - SH; ScYHR117W (...    32   1.9  
CAGL0L04048g 474410..476173 similar to sp|P07213 Saccharomyces c...    32   2.6  
KLLA0D01155g complement(104847..105854) similar to sgd|S0005533 ...    31   2.9  
KLLA0B09966g complement(872760..873872) similar to sp|P33313 Sac...    31   3.2  
YHR117W (TOM71) [2405] chr8 (342351..344270) Minor import recept...    31   3.2  
CAGL0L12936g 1380327..1382129 similar to sp|P07213 Saccharomyces...    31   3.9  
Scas_585.4                                                             31   4.1  
KLLA0E00979g 104991..107315 some similarities with sp|Q01477 Sac...    31   4.8  
CAGL0E01573g complement(148847..151561) similar to sp|P42842 Sac...    31   4.8  
Scas_666.23                                                            30   5.5  
KLLA0F04191g 397611..400268 weakly similar to sp|P19735 Saccharo...    30   5.9  
CAGL0G10087g 962823..967058 similar to sp|P17883 Saccharomyces c...    30   6.1  
CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces...    30   6.4  
CAGL0J09570g complement(939447..941096) some similarities with s...    30   6.8  
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    30   8.3  
YDL238C (YDL238C) [638] chr4 complement(28985..30454) Putative g...    30   9.5  
CAGL0A03630g complement(364712..367900) similar to sp|P33339 Sac...    30   9.9  

>CAGL0L09823g 1050447..1052678 some similarities with sp|P09798
           Saccharomyces cerevisiae YKL022c CDC16, hypothetical
           start
          Length = 743

 Score = 1361 bits (3523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/731 (90%), Positives = 665/731 (90%)

Query: 1   MRDQGQEGFTPVQRRVVSPVGAARSPLLTSPLVQKYAGASLATPRKHXXXXXXXXXXXXX 60
           MRDQGQEGFTPVQRRVVSPVGAARSPLLTSPLVQKYAGASLATPRKH             
Sbjct: 1   MRDQGQEGFTPVQRRVVSPVGAARSPLLTSPLVQKYAGASLATPRKHLGASNSNNGNNGS 60

Query: 61  XXXXMSKNSMLGSTIPSTLRKVSLQREFHDNDSDXXXXXXXXXPRWSKSAQGDGDVIIVG 120
               MSKNSMLGSTIPSTLRKVSLQREFHDNDSD         PRWSKSAQGDGDVIIVG
Sbjct: 61  LLASMSKNSMLGSTIPSTLRKVSLQREFHDNDSDVVGAGVGGGPRWSKSAQGDGDVIIVG 120

Query: 121 AAGGDNTASPTGDGEGLNXXXXXXXXXXXXSGAGNGSNEIDIAKIPLIERLQLWRHDAWI 180
           AAGGDNTASPTGDGEGLN            SGAGNGSNEIDIAKIPLIERLQLWRHDAWI
Sbjct: 121 AAGGDNTASPTGDGEGLNTTTLTTTTTTVTSGAGNGSNEIDIAKIPLIERLQLWRHDAWI 180

Query: 181 QHLYGTAEFVATKIYTMTGDANDAFWLALIYYSMGSHNRCIELLTKDDIISVSIVCRYLL 240
           QHLYGTAEFVATKIYTMTGDANDAFWLALIYYSMGSHNRCIELLTKDDIISVSIVCRYLL
Sbjct: 181 QHLYGTAEFVATKIYTMTGDANDAFWLALIYYSMGSHNRCIELLTKDDIISVSIVCRYLL 240

Query: 241 ARCYIDVKNYDDALDIVGETNPFADTAEASARIESDGGIKLESSMCFLRGKIYVAQNDFS 300
           ARCYIDVKNYDDALDIVGETNPFADTAEASARIESDGGIKLESSMCFLRGKIYVAQNDFS
Sbjct: 241 ARCYIDVKNYDDALDIVGETNPFADTAEASARIESDGGIKLESSMCFLRGKIYVAQNDFS 300

Query: 301 RAKEAFKEAVLVDPKNFEAYRQLVDSHLLTTNEEWEXXXXXXXXXXXXXXXXVKSLYTLE 360
           RAKEAFKEAVLVDPKNFEAYRQLVDSHLLTTNEEWE                VKSLYTLE
Sbjct: 301 RAKEAFKEAVLVDPKNFEAYRQLVDSHLLTTNEEWELLDSLDFDSLGDDSILVKSLYTLE 360

Query: 361 LSKNQNQDRITEAQDILRQDYDLAXXXXXXXXXXXXLFNQCKFSQCLNVCELMLKRDQFN 420
           LSKNQNQDRITEAQDILRQDYDLA            LFNQCKFSQCLNVCELMLKRDQFN
Sbjct: 361 LSKNQNQDRITEAQDILRQDYDLADDIDIVTSDIDILFNQCKFSQCLNVCELMLKRDQFN 420

Query: 421 NKILPTYISCLYEVKSSNKLFLLAHELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSK 480
           NKILPTYISCLYEVKSSNKLFLLAHELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSK
Sbjct: 421 NKILPTYISCLYEVKSSNKLFLLAHELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSK 480

Query: 481 SSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLT 540
           SSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLT
Sbjct: 481 SSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLT 540

Query: 541 LAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSV 600
           LAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSV
Sbjct: 541 LAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSV 600

Query: 601 QINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLA 660
           QINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLA
Sbjct: 601 QINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLA 660

Query: 661 INPGNSSAQKLLNYALELNVTLELDENHPLVVNSNILDEEHSASKIGKRRQPFESINVDK 720
           INPGNSSAQKLLNYALELNVTLELDENHPLVVNSNILDEEHSASKIGKRRQPFESINVDK
Sbjct: 661 INPGNSSAQKLLNYALELNVTLELDENHPLVVNSNILDEEHSASKIGKRRQPFESINVDK 720

Query: 721 KRNKAGQLTEQ 731
           KRNKAGQLTEQ
Sbjct: 721 KRNKAGQLTEQ 731

>Kwal_14.874
          Length = 722

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/701 (47%), Positives = 449/701 (64%), Gaps = 54/701 (7%)

Query: 30  SPLVQKYAG-ASLATPRKHXXXXXXXXXXXXXXXXXMSKNSMLGSTIPSTLRKVSLQREF 88
           SPLVQK    ASLATP                    M+KN + G  IPSTLRKVS+  + 
Sbjct: 59  SPLVQKIQNNASLATP-----APVQDHGSTAGLLASMTKNGLFGPQIPSTLRKVSIVGD- 112

Query: 89  HDNDSDXXXXXXXXXPRWSKSAQGDGDVIIVGAAGGDNTASPTGDGEGLNXXXXXXXXXX 148
                           R   S+ G         AGGD T  P    +             
Sbjct: 113 --------------SRRHPGSSSG---------AGGDIT-DPNAQLD------------- 135

Query: 149 XXSGAGNGSNEIDIAKIPLIERLQLWRHDAWIQHLYGTAEFVATKIYTMTGDANDAFWLA 208
               + +  + IDIA++P  E+L+LWRHD+ +QH Y TAEF+  K+Y MTGD NDAFWLA
Sbjct: 136 ----SDHVISAIDIAQLPAAEKLRLWRHDSLMQHQYRTAEFLGDKVYAMTGDPNDAFWLA 191

Query: 209 LIYYSMGSHNRCIELLTKDDIISVSIVCRYLLARCYIDVKNYDDALDIVGETNPFADTAE 268
            +YY+ GS+ R +ELL+++++ + S++CRYL A C I +K Y+DALDIVGETNPF D   
Sbjct: 192 QVYYNSGSYIRAVELLSRNNLDTSSVMCRYLTALCLIQLKKYEDALDIVGETNPFRDPLG 251

Query: 269 ASARIESDGGIKLESSMCFLRGKIYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLVDSHL 328
           +  +   DGGIKLESSMC+LRGKI+ A NDF +AK++ KEAVLVD KNFEA+ +L+  +L
Sbjct: 252 SHVK-NQDGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAVLVDVKNFEAFDELISKNL 310

Query: 329 LTTNEEWEXXXXXXXXXXXXXXXXVKSLYTLELSKNQNQDRITEAQDILRQDYDLAXXXX 388
           LT +EEW                 ++SLY   LSK  N D++ +A D L ++Y L+    
Sbjct: 311 LTPSEEWAFIASLDFTDLDDNEDLIRSLYVSRLSKYLNLDQVFKAHDFLNEEYKLSSNTD 370

Query: 389 XXXXXXXXLFNQCKFSQCLNVCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHELA 448
                   LF QCKFS CL +CE  L++D+FN  ILP +ISCLYE+   NKLFL++H++A
Sbjct: 371 LIHSKADTLFTQCKFSDCLKLCEEALEKDEFNFSILPIFISCLYELGGKNKLFLISHKMA 430

Query: 449 EKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQA 508
           E  P++ ITW+ V  YYM  +++ EARKYFSK+SI+DP+F+ AW+GFAHT+A+EGE +QA
Sbjct: 431 ENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQA 490

Query: 509 ISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKF 568
           ISAYSTA+RFFPG  LPNLFLGMQY+   TL LAEEYF LAY+  P DP++LNE+GVL F
Sbjct: 491 ISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLNEMGVLYF 550

Query: 569 KKGELHKAKRYLKKAAECCKDMERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNILEDT 628
           KKG+  KAK+YLKKA E  K ++  SK+ +S+  NL+HTYR+LGENEKA+     +LE  
Sbjct: 551 KKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETA 610

Query: 629 ENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINPGNSSAQKLLNYALELNVTLELDENH 688
              ++  C+LG++YL+ N+++KAIDALH  LA+ P N +AQ LL  AL++N++  LD++H
Sbjct: 611 GKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQDLLKQALDVNMSTILDDSH 670

Query: 689 PLVVNSNILDEEHSASKIGKRRQPFESINVDK--KRNKAGQ 727
           PLV++S + D+    S +  R++    ++V    KR K GQ
Sbjct: 671 PLVISSKLQDQN---SDVVSRKRAANRVDVRDIAKRLKHGQ 708

>Scas_685.10
          Length = 760

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/690 (47%), Positives = 438/690 (63%), Gaps = 46/690 (6%)

Query: 15  RVVSPVGAARSPLLTSPLVQK----YAGASLATPRKHXXXXXXXXXXX---XXXXXXMSK 67
           R VS     RS L  SPLVQK       ASL TP +                     +SK
Sbjct: 59  RTVSGQSPYRS-LANSPLVQKTNPSIITASLTTPHQKNTGTIPTNLNANPNSSLLASLSK 117

Query: 68  NSMLGSTIPSTLRKVSLQREFHDNDSDXXXXXXXXXPRWSKSAQGDGDVIIVGAAGGDNT 127
            ++ GSTI S+LRK                                     V      N 
Sbjct: 118 GNVFGSTISSSLRK-------------------------------------VSIQPNSNI 140

Query: 128 ASPTGDGEGLNXXXXXXXXXXXXSGAGNGSNEIDIAKIPLIERLQLWRHDAWIQHLYGTA 187
                  E ++            +     S EID++++  IERL+LWRHDA +QH+Y TA
Sbjct: 141 PETNTKDENMSNEINKATTTTLTTNTTIVSPEIDLSELTSIERLRLWRHDALMQHMYRTA 200

Query: 188 EFVATKIYTMTGDANDAFWLALIYYSMGSHNRCIELLTKDDIISVSIVCRYLLARCYIDV 247
           E++  KIYT+T D NDAFWLA +YY+     R I+LLTKD++ S++I+CRYL+  C   +
Sbjct: 201 EYIGNKIYTITEDPNDAFWLAQVYYNNNEFIRAIDLLTKDNLESLNIICRYLMGLCLFKL 260

Query: 248 KNYDDALDIVGETNPFADTAEAS-ARIESDGGIKLESSMCFLRGKIYVAQNDFSRAKEAF 306
           + YDDALD+V E NPF+D+ + S   I  DGGIK+ESS+C+LRG I+ AQN+  +AK AF
Sbjct: 261 QRYDDALDVVDELNPFSDSKQDSDPTIAPDGGIKVESSLCYLRGLIFAAQNNLKKAKTAF 320

Query: 307 KEAVLVDPKNFEAYRQLVDSHLLTTNEEWEXXXXXXXXXXXXXXXXVKSLYTLELSKNQN 366
           KEAVLVD KN+EA+  L+  +L++  EEW+                ++ LYTL +SK  +
Sbjct: 321 KEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFSTLGDNEEMIRYLYTLNVSKYIH 380

Query: 367 QDRITEAQDILRQDYDLAXXXXXXXXXXXXLFNQCKFSQCLNVCELMLKRDQFNNKILPT 426
           QD    A+  L  +Y L+            L++QCKFS+CL  CE  L  D++N  ILPT
Sbjct: 381 QDVSKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFSECLEACEKALDGDEYNPTILPT 440

Query: 427 YISCLYEVKSSNKLFLLAHELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDP 486
           YISCLYE    NKLFLL+H LAEK P++ ITW+ VATYYM ++ +P+ARKYFSK+SI+DP
Sbjct: 441 YISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMAIEDVPKARKYFSKASILDP 500

Query: 487 TFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYF 546
           +F+ AWLGFAHT+ LEGE DQA+SAY+TAARFFPG+ +PNLFLGM+YMA+NTL+LAEEYF
Sbjct: 501 SFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFLGMEYMATNTLSLAEEYF 560

Query: 547 SLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQINLSH 606
           +LAY++   DP++LNE+GV+ FKK EL K+KRYLKKA E  ++   +S  V+S+Q+NL+H
Sbjct: 561 TLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRNSSGTSTIVISIQMNLAH 620

Query: 607 TYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINPGNS 666
           TYR+LGE E+AIK    +LE+    +E+YC+LGFLYLKT +L KAID LH  LA+ P N+
Sbjct: 621 TYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHESLALKPSNT 680

Query: 667 SAQKLLNYALELNVTLELDENHPLVVNSNI 696
           SAQ+LL +ALELN ++ LDENHPLV+N+ +
Sbjct: 681 SAQELLLHALELNASIVLDENHPLVMNAEL 710

>Sklu_2380.6 YKL022C, Contig c2380 14352-16676 reverse complement
          Length = 774

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/714 (45%), Positives = 439/714 (61%), Gaps = 70/714 (9%)

Query: 14  RRVVSPVGAARSP---LLTSPLVQKYAG-ASLATPRKHXXXXXXXXXXXXXXXXXMSKNS 69
           RR       A++P   +  SPL+QK     SLATP                    MSK+ 
Sbjct: 93  RRWCGATSTAQTPHHPVTNSPLIQKIQNPTSLATP-----APPAGDGSTAGLLASMSKSG 147

Query: 70  MLGSTIPSTLRKVSLQREFHDNDSDXXXXXXXXXPRWSKSAQGDGDVIIVGAAGGDNTAS 129
           + G  +PSTLRK+S+ R F    S             S S   D   +I GA        
Sbjct: 148 LFGPAVPSTLRKISVTRSFDGQTSAKDD---------SNSELDDNLEVISGAT------- 191

Query: 130 PTGDGEGLNXXXXXXXXXXXXSGAGNGSNEIDIAKIPLIERLQLWRHDAWIQHLYGTAEF 189
                                         IDI+ +   E+L+LWRHDA +QH Y TAE+
Sbjct: 192 ------------------------------IDISTLSPAEKLRLWRHDALMQHHYRTAEY 221

Query: 190 VATKIYTMTGDANDAFWLALIYYSMGSHNRCIELLTKDDIISVSIVCRYLLARCYIDVKN 249
           +  K+Y++T D NDAFWLA +YY+ GS+ R +ELL++D + + S++CRYL A C I ++ 
Sbjct: 222 IGDKVYSITRDPNDAFWLAQVYYNNGSYIRAVELLSRDGLDTSSVMCRYLTALCLIKMEK 281

Query: 250 YDDALDIVGETNPFADTAEASARIESDGGIKLESSMCFLRGKIYVAQNDFSRAKEAFKEA 309
           YDDALDIVGE+NPF D +    +   DGGIKLESS+C+LRGKIY AQN+F +AK++FKEA
Sbjct: 282 YDDALDIVGESNPFKDVSAQHVK-NQDGGIKLESSLCYLRGKIYSAQNNFEKAKQSFKEA 340

Query: 310 VLVDPKNFEAYRQLVDSHLLTTNEEWEXXXXXXXXXXXXXXXXVKSLYTLELSKNQNQDR 369
           V VD KNFEA+ +L+ ++LLT N+EWE                +KSLYT +LSK  N D+
Sbjct: 341 VQVDVKNFEAFDELISNNLLTPNQEWEFLSTLDFSDLDDNEELIKSLYTTKLSKYLNLDQ 400

Query: 370 ITEAQDILRQDYDLAXXXXXXXXXXXXLFNQCKFSQCLNVCELMLKRDQFNNKILPTYIS 429
           I+EA++ L  +Y+L              F QCKFS+CL +CE +L+RD+FN  +LPTYI+
Sbjct: 401 ISEAREYLINEYNLEDNTDLIRSEIDTFFTQCKFSKCLCLCEQVLERDEFNFYVLPTYIA 460

Query: 430 CLYEVKSSNKLFLLAHELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFA 489
           CLYE+   NKLFL++H+LAE  P++ +TW  V TYY+ ++++ EARKYFSK+SI+DP F 
Sbjct: 461 CLYELGGKNKLFLVSHKLAENFPKSPVTWLGVGTYYLSINKVAEARKYFSKASILDPNFG 520

Query: 490 PAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLA 549
            AW+GFAHT+A EGE +QA+SAYSTA+RFFPG  LPNLFLGMQY+  NTL+LAEEY +LA
Sbjct: 521 QAWIGFAHTYAAEGEHEQAVSAYSTASRFFPGTHLPNLFLGMQYIVMNTLSLAEEYLTLA 580

Query: 550 YESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQINLSHTYR 609
           Y+  P DP++LNE+GV+ FKK +  KAK+Y KKA E  K +   SK  LS+  NL HTYR
Sbjct: 581 YDICPHDPLLLNEMGVIYFKKSDYPKAKKYFKKAWEASKRLNSDSKAWLSIHTNLGHTYR 640

Query: 610 RLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINPGNSSAQ 669
           ++G+ E+A+     +LE +   + +YC++G +YLK  +++KAID+LH  LA+ P N  AQ
Sbjct: 641 KMGDYERAVACFKIVLETSNQDTSVYCAIGLIYLKLRKIEKAIDSLHNALALQPSNQIAQ 700

Query: 670 KLLNYALELNVTLELDENHPLVVNSNILDE--------------EHSASKIGKR 709
            LL  ALE+N+   LDE HPLVV+S I +                 SA+KI KR
Sbjct: 701 DLLKQALEVNMCTVLDETHPLVVSSKINESASNYFPNSKKRDLVNQSAAKIAKR 754

>YKL022C (CDC16) [3233] chr11 complement(394369..396891) Component
           of anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [2523 bp, 840 aa]
          Length = 840

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/590 (51%), Positives = 419/590 (71%), Gaps = 17/590 (2%)

Query: 159 EIDIAKIPLIERLQLWRHDAWIQHLYGTAEFVATKIYTMTGDANDAFWLALIYYSMGSHN 218
           ++D++++  IERL+LWR DA +QH+Y TAE++A K+Y ++ D +DAFWL  +YY+   + 
Sbjct: 221 QLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQYV 280

Query: 219 RCIELLTKDDIISVSIVCRYLLARCYIDVKNYDDALDIVGETNPFADTAEASARIE---- 274
           R +EL+T++++  V+I+CRYLL   ++ ++ +DDALD++GE NPF++    +A       
Sbjct: 281 RAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGEYNPFSEDPSTTAANTMSNN 340

Query: 275 ----------SDGGIKLESSMCFLRGKIYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLV 324
                     +DGGIK+ESS+CFLRGKIY AQN+F++A++AF+EA+LVD KNFEA+  L+
Sbjct: 341 GNNSNTSQPVTDGGIKMESSLCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEMLL 400

Query: 325 DSHLLTTNEEWEXXXXXXXXXXXXXXXXVKSLYTLELSKNQNQDRITEAQDILRQDYDLA 384
             +LLT  EEW+                +K+LY + LSK  N + IT++ +IL +DY LA
Sbjct: 401 SKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYKLA 460

Query: 385 XXXXXXXXXXXXLFNQCKFSQCLNVCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLA 444
                        + QCKF++CL +CE +L+ D+FN  ILP YI CLYE+ + NKLFLL+
Sbjct: 461 DNVDVVRSKVDICYTQCKFNECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLS 520

Query: 445 HELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGE 504
           H LAE  P++ ITW+ VATYYM LDRI EA+KY+SKSSI+DP+FA AWLGFAHT+ALEGE
Sbjct: 521 HRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGE 580

Query: 505 QDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIG 564
           QDQA++AYSTA+RFFPGM LP LFLGMQ+MA N+L LAE YF LAY+  P DP++LNE+G
Sbjct: 581 QDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMG 640

Query: 565 VLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNI 624
           V+ FKK E  KAK+YLKKA E  KD++ SS+T +S+Q+NL HTYR+L ENE AIK    +
Sbjct: 641 VMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCV 700

Query: 625 LEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINPGNSSAQKLLNYALELNVTLEL 684
           LE  + +SEI+CSLG+LYLKT +LQKAID LH+ L + P NSSA  LL  ALELNVTL L
Sbjct: 701 LEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVTLSL 760

Query: 685 DENHPLVVNSNILDE-EHSASKIGKRRQP--FESINVDKKRNKAGQLTEQ 731
           D +HPL+  SN++ +     + + K+R    ++ +N+ K+     ++ +Q
Sbjct: 761 DASHPLIDKSNLMSQASKDKASLNKKRSSLTYDPVNMAKRLRTQKEIFDQ 810

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 40/81 (49%), Gaps = 11/81 (13%)

Query: 20  VGAARSP---LLTSPLVQKYAGASLATPRKHXXXXXXXXXXXX-------XXXXXMSKNS 69
              A SP   L  SPL+QK   A++ TP +                         MSKNS
Sbjct: 90  TNTATSPYQSLANSPLIQKLQ-ANIMTPHQPSANSNSNSNSITGNVVNDNNLLASMSKNS 148

Query: 70  MLGSTIPSTLRKVSLQREFHD 90
           M GSTIPSTLRKVSLQRE+ D
Sbjct: 149 MFGSTIPSTLRKVSLQREYKD 169

>KLLA0E07986g 720700..722865 similar to sp|P09798 Saccharomyces
           cerevisiae YKL022c CDC16 subunit of anaphase-promoting
           complex (cyclosome) singleton, start by similarity
          Length = 721

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/574 (48%), Positives = 392/574 (68%), Gaps = 7/574 (1%)

Query: 158 NEIDIAKIPLIERLQLWRHDAWIQHLYGTAEFVATKIYTMTGDANDAFWLALIYYSMGSH 217
           N  D++ +  +E+L+LWRHDA +QH Y TAE +   IY+MT D NDAFWLA +YY+ GS+
Sbjct: 137 NVFDVSDLSSVEKLRLWRHDALMQHHYKTAEHIGDLIYSMTKDPNDAFWLAQVYYNQGSY 196

Query: 218 NRCIELLTKDDIISVSIVCRYLLARCYIDVKNYDDALDIVGETNPFADTAEASARIESDG 277
            R +EL+  D + S SI+CRYL A C   +   ++ALDI+G+TNPF   +E S+   +DG
Sbjct: 197 VRAVELIFTDQLDSESIMCRYLAALCLFKLNKLEEALDIIGDTNPF--QSEPSSPGNADG 254

Query: 278 GIKLESSMCFLRGKIYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLVDSHLLTTNEEWEX 337
           G+KLESSMC LRG+IYV+ ++  +AKE FKEAV VD KN+EA+  L+  H+LTT E+W+ 
Sbjct: 255 GVKLESSMCLLRGRIYVSLSNMEQAKECFKEAVQVDVKNYEAFDYLLSKHMLTTAEQWDL 314

Query: 338 XXXXXXXXXXXXXXXVKSLYTLELSKNQNQDRITEAQDILRQDYDLAXXXXXXXXXXXXL 397
                          ++ LY   LSK Q+Q  I  A+ +L   Y L             L
Sbjct: 315 VRSLQFDDLDDNEEMMRCLYISRLSKYQHQTEIEHARKVLSDKYYLKDNRTVLLAEIELL 374

Query: 398 FNQCKFSQCLNVCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHELAEKDPRNCIT 457
            NQ KF+QC+ +CE +L+ D++N ++LP YI CL+   + NKLFLL+H+LAE  P++ +T
Sbjct: 375 NNQSKFTQCMKLCEQVLEVDEYNLEVLPIYIQCLHSFAAKNKLFLLSHKLAENFPKSPVT 434

Query: 458 WYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAAR 517
           W+ VATYY+ + ++ EARKYFS+SSIMDP+F  +WLGFAHT+  EGE +QA+SAYSTAAR
Sbjct: 435 WFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAAR 494

Query: 518 FFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAK 577
           FFPG  LP+L+LGMQY   + L+LAEEYF +AY+  P DP++LNE+GV+ FK+    KAK
Sbjct: 495 FFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAK 554

Query: 578 RYLKKAAECCKDMERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCS 637
           +Y+K+A +  K+M+  SK  +S+ INL HTYR+LGE+E+AIK    +LE ++ ++ ++CS
Sbjct: 555 KYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCS 614

Query: 638 LGFLYLKTNQLQKAIDALHRVLAINPGNSSAQKLLNYALELNVTLELDENHPLVVNSNIL 697
           LGFLYL+  +++KAID+ H+ LA++ GN ++ KLL  ALE+N  + +DENHP+V++SNI 
Sbjct: 615 LGFLYLRMKKIEKAIDSFHKALALDQGNQASNKLLKTALEINAHMIIDENHPMVISSNIQ 674

Query: 698 DEEHS-ASKIGKRRQPFESINVD----KKRNKAG 726
           +   S  SK  K+R      + D     KR K G
Sbjct: 675 NIPTSHVSKNDKKRTSLGITSFDPVTEAKRLKQG 708

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 25/55 (45%), Gaps = 5/55 (9%)

Query: 30  SPLVQKYAGAS-LATPRKHXXXXXXXXXXXXXXXXXMSKNSMLGSTIPSTLRKVS 83
           SPLVQK    S LATP                    M+KN + G  +PSTLRK S
Sbjct: 64  SPLVQKIRDVSHLATP----AVMRHNGTAGSSLLASMTKNGLFGPALPSTLRKTS 114

>ACR168W [1215] [Homologous to ScYKL022C (CDC16) - SH]
           complement(650615..652738) [2124 bp, 707 aa]
          Length = 707

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/552 (48%), Positives = 381/552 (69%), Gaps = 4/552 (0%)

Query: 160 IDIAKIPLIERLQLWRHDAWIQHLYGTAEFVATKIYTMTGDANDAFWLALIYYSMGSHNR 219
           +D+A++   E+L+LWRHDA +QH Y TAE++  K+Y+MT D NDAFWLA +YY+MG + R
Sbjct: 128 VDLAELSAAEKLRLWRHDALMQHHYRTAEYIGDKVYSMTRDPNDAFWLAQVYYNMGQYIR 187

Query: 220 CIELLTKDDIISVSIVCRYLLARCYIDVKNYDDALDIVGETNPFADTAEASARIESDGGI 279
            +ELL++D + + S++CRYL A C + ++ YDDALDIVGE NPF D +    R   DGGI
Sbjct: 188 AVELLSRDGLDASSVMCRYLTALCLVKMEKYDDALDIVGEVNPFKDDSAEHVR-NLDGGI 246

Query: 280 KLESSMCFLRGKIYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLVDSHLLTTNEEWEXXX 339
           KLESS+C+LRG+IY AQN+   AKE FKEAV VD KNFEA+ +L+ +++LT +EE E   
Sbjct: 247 KLESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDVKNFEAFDRLISNNMLTPDEETEFIA 306

Query: 340 XXXXXXXXXXXXXVKSLYTLELSKNQNQDRITEAQDILRQDYDLAXXXXXXXXXXXXLFN 399
                        ++ LY+ +LSK  +  ++  A   L  +Y L             L  
Sbjct: 307 RLDFTDLDDNQELIRCLYSTKLSKYGDLTKLKAAHRFLLDEYHLEDNKDVQTTEIELLIF 366

Query: 400 QCKFSQCLNVCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHELAEKDPRNCITWY 459
           Q K+ +CL +CE +L++D+FN  +LPTY+ CLYE+   NKLFL++H+LAE  P++ +TW+
Sbjct: 367 QGKYLECLELCEKVLEQDEFNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWF 426

Query: 460 CVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFF 519
            V TYY  ++ I EARKYFSK+S++DP F  AWLGFAHT+A+EGE +QA+SAYSTAARFF
Sbjct: 427 AVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFF 486

Query: 520 PGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRY 579
           PG  LP+L+LGMQY   +TLTLAEEYF +AY+  P DP++LNE+GV+ FKK +  +AK++
Sbjct: 487 PGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKF 546

Query: 580 LKKAAECCKDMERS--SKTVLSVQINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCS 637
            K+A E   +M++S  S   +S  +NL HTYR+L E+E+A+     +LE  + S+ ++C+
Sbjct: 547 FKRACEAI-NMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCA 605

Query: 638 LGFLYLKTNQLQKAIDALHRVLAINPGNSSAQKLLNYALELNVTLELDENHPLVVNSNIL 697
           L  +YLK  +LQKAIDALH VLA+ P + + Q+LL  AL++NV L LD  HPL+V++ I 
Sbjct: 606 LATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLLKIALDVNVHLPLDNGHPLMVSAKIS 665

Query: 698 DEEHSASKIGKR 709
           +    +S   KR
Sbjct: 666 ENMKMSSNDKKR 677

 Score = 37.0 bits (84), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 39/92 (42%), Gaps = 25/92 (27%)

Query: 13  QRRV---------VSPVGAA-------RSPLLTSPLVQKYAGASLATPRKHXXXXXXXXX 56
           QRRV         + P G A       R+ ++ SPLVQK     L TP            
Sbjct: 30  QRRVMMPSTGEDSLGPSGMADSGTHTPRNSVVHSPLVQK---TQLGTP------YMAEGA 80

Query: 57  XXXXXXXXMSKNSMLGSTIPSTLRKVSLQREF 88
                   MSK ++ G  +PSTLRKVS  RE+
Sbjct: 81  ATGGLLGSMSKTALFGPAVPSTLRKVSNVREY 112

>AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH]
           complement(154711..156681) [1971 bp, 656 aa]
          Length = 656

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 101/243 (41%), Gaps = 7/243 (2%)

Query: 422 KILPTYISCLYEVKSSNKLFLLAHELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSKS 481
           K +  Y + L+ +    +L  L HEL  +D +NCITW C+   + L     EA K   K+
Sbjct: 405 KDMDVYSTLLWHLHDKIRLADLCHELMAQDDKNCITWCCLGNLFSLNRDHDEAIKALKKA 464

Query: 482 SIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTL 541
           + ++P FA A+    H ++     D A   Y  A    P     +  LGM  +       
Sbjct: 465 TSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDE 524

Query: 542 AEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQ 601
           A  +F  A   +P + ++    GV   + G   KA  + + A E    ++ +S   L   
Sbjct: 525 ALLHFEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACE----LQPNSSLAL--- 577

Query: 602 INLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAI 661
              S     LG+   A++    + + T N + ++  LG LY    + + AI      + +
Sbjct: 578 FKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAMNL 637

Query: 662 NPG 664
           +P 
Sbjct: 638 DPN 640

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by sequence-specific
           DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex
           undergoes Hog1p-dependent conversion to a
           transcriptional activator [2901 bp, 966 aa]
          Length = 966

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 97/226 (42%), Gaps = 13/226 (5%)

Query: 451 DPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAIS 510
           +P +      +A  Y   D    A + + ++ +++P  +  W    H + +  +  +A +
Sbjct: 76  NPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYN 135

Query: 511 AYSTAARFFPGMSLPNLF--LGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKF 568
           AY  A       ++P L+  +G+ Y    +L  AEE F+   E  P       +   + F
Sbjct: 136 AYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPH----FEKANEIYF 191

Query: 569 KKGELHKAKRYLKKAAECCKDMERSSKTVLS---VQINLSHTYRRLGENEKAIKYLTNIL 625
           + G ++K +    +A EC + +       L    +   L      +GE + A +   ++L
Sbjct: 192 RLGIIYKHQGKWSQALECFRYILPQPPAPLQEWDIWFQLGSVLESMGEWQGAKEAYEHVL 251

Query: 626 EDTENSSEIYCSLGFLYLKTN----QLQKAIDALHRVLAINPGNSS 667
              ++ +++   LG LY  +N      QKA+D L + L  +P +++
Sbjct: 252 AQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDAT 297

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 61/290 (21%), Positives = 106/290 (36%), Gaps = 65/290 (22%)

Query: 428 ISCLYEVKSSNKLFLLAHELAEK----DPRNCITWYCVATYYMLLDRIPEARKYFSKS-- 481
           ++ L  +  S  +F  A EL E+    +P     W  +   Y++LD +  A   + ++  
Sbjct: 83  LTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALY 142

Query: 482 SIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPN---LFLGMQYMASNT 538
            + +P     W G    +   G  D A  A++      P     N     LG+ Y     
Sbjct: 143 HLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGK 202

Query: 539 LTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVL 598
            + A E F       PQ P  L E  +  F+ G + ++    + A E  +        VL
Sbjct: 203 WSQALECFRYIL---PQPPAPLQEWDIW-FQLGSVLESMGEWQGAKEAYEH-------VL 251

Query: 599 SVQINLSHTYRRLG-----------ENEKAIKYLTNILE-DTENSSEIY----------- 635
           +   + +   ++LG           + +KA+ YL   LE D  +++  Y           
Sbjct: 252 AQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWYHLGRVHMIRTD 311

Query: 636 ----------------------CSLGFLYLKTNQLQKAIDALHRVLAINP 663
                                 CS+G LY + +Q + A+DA  R + +NP
Sbjct: 312 YTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNP 361

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 84/211 (39%), Gaps = 9/211 (4%)

Query: 457 TWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAA 516
           TW  +A+    L     A   +  +   +P+ A A    AH +       +A   Y  A 
Sbjct: 48  TWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERAL 107

Query: 517 RFFPGMSLPNLFLGMQYMASNTLTLAEEYF--SLAYESSPQDPVILNEIGVLKFKKGELH 574
              P +S     LG  Y+  + L  A   +  +L + S+P  P + + IG+L  + G L 
Sbjct: 108 LVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLD 167

Query: 575 KAKRYLKKAAECCKDMERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNILEDTE---NS 631
            A+    K  E     E++++    + I     Y+  G+  +A++    IL         
Sbjct: 168 YAEEAFAKVLELDPHFEKANEIYFRLGI----IYKHQGKWSQALECFRYILPQPPAPLQE 223

Query: 632 SEIYCSLGFLYLKTNQLQKAIDALHRVLAIN 662
            +I+  LG +     + Q A +A   VLA N
Sbjct: 224 WDIWFQLGSVLESMGEWQGAKEAYEHVLAQN 254

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 72/187 (38%), Gaps = 11/187 (5%)

Query: 484 MDP---TFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLT 540
           +DP   + A  WL  A      G+ D+A  AY    +F P  +     L   Y + +   
Sbjct: 38  LDPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQ 97

Query: 541 LAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSV 600
            A E +  A   +P+   +   +G       +L +A    ++A         S+  V  +
Sbjct: 98  RAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL-----YHLSNPNVPKL 152

Query: 601 QINLSHTYRRLGENEKAIKYLTNILE---DTENSSEIYCSLGFLYLKTNQLQKAIDALHR 657
              +   Y R G  + A +    +LE     E ++EIY  LG +Y    +  +A++    
Sbjct: 153 WHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRY 212

Query: 658 VLAINPG 664
           +L   P 
Sbjct: 213 ILPQPPA 219

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 54/136 (39%), Gaps = 14/136 (10%)

Query: 411 ELMLKRDQFNNKILPTYISCLYEVKS------SNKLFLLAHELAEKDPRNCITWYCVATY 464
           E +L ++Q + K+L   + CLY + +         L  L   L E DP +  TWY +   
Sbjct: 248 EHVLAQNQHHAKVL-QQLGCLYGMSNVQFYDPQKALDYLLKSL-EADPSDATTWYHLGRV 305

Query: 465 YMLLDRIPEARKYFSKSSIMD---PTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPG 521
           +M+      A   F ++   D   P F   W      +    +   A+ AY+ A R  P 
Sbjct: 306 HMIRTDYTAAYDAFQQAVNRDSRNPIF---WCSIGVLYYQISQYRDALDAYTRAIRLNPY 362

Query: 522 MSLPNLFLGMQYMASN 537
           +S     LG  Y   N
Sbjct: 363 ISEVWYDLGTLYETCN 378

>KLLA0B09262g 814303..817128 some similarities with sp|P14922
           Saccharomyces cerevisiae YBR112c CYC8 general repressor
           of transcription singleton, hypothetical start
          Length = 941

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/251 (21%), Positives = 102/251 (40%), Gaps = 14/251 (5%)

Query: 428 ISCLYEVKSSNKLFLLAHELA-EKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDP 486
           I+ L E      L  +A++   + +P +      +A  Y   D    A + + ++   +P
Sbjct: 114 IASLAETLGDADLAAMAYDATLQHNPSSTNALTSLAHLYRSRDMFQRAAELYQRALSANP 173

Query: 487 TFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLF--LGMQYMASNTLTLAEE 544
                W    H + +  E   A +AY  A       ++P L+  +G+ Y    +L  AEE
Sbjct: 174 ELGDIWATLGHCYLMLDELQNAYAAYQQALYHLSNPNIPKLWHGIGILYDRYGSLDYAEE 233

Query: 545 YFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLS---VQ 601
            F+   E  PQ      +   + F+ G ++K +    +A EC + +       L    V 
Sbjct: 234 AFAKVLELDPQ----FEKANEIYFRLGIIYKHQGKWNQALECFRYILPQPPAPLQEWDVW 289

Query: 602 INLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTN----QLQKAIDALHR 657
             L      +GE + A     +I+   +  +++   LG LY   N      QKA++ L +
Sbjct: 290 FQLGSVLESMGEWQGARDAYEHIISQNDRHAKVLQQLGCLYGMNNVSFYDPQKALNLLLK 349

Query: 658 VLAINPGNSSA 668
            L I+  ++++
Sbjct: 350 SLEIDSTDATS 360

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 57/284 (20%), Positives = 101/284 (35%), Gaps = 53/284 (18%)

Query: 428 ISCLYEVKSSNKLFLLAHELAEK----DPRNCITWYCVATYYMLLDRIPEARKYFSKS-- 481
           ++ L  +  S  +F  A EL ++    +P     W  +   Y++LD +  A   + ++  
Sbjct: 145 LTSLAHLYRSRDMFQRAAELYQRALSANPELGDIWATLGHCYLMLDELQNAYAAYQQALY 204

Query: 482 SIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPN---LFLGMQYMASNT 538
            + +P     W G    +   G  D A  A++      P     N     LG+ Y     
Sbjct: 205 HLSNPNIPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGK 264

Query: 539 LTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDM----ERSS 594
              A E F       PQ P  L E  V  F+ G + ++    + A +  + +    +R +
Sbjct: 265 WNQALECFRYIL---PQPPAPLQEWDVW-FQLGSVLESMGEWQGARDAYEHIISQNDRHA 320

Query: 595 KTVLSVQINLSHTYRRLGENEKAIKYLTNILE---------------------------- 626
           K +  +            + +KA+  L   LE                            
Sbjct: 321 KVLQQLGCLYGMNNVSFYDPQKALNLLLKSLEIDSTDATSWYHLGRIHMIRNDYTSAYDA 380

Query: 627 -------DTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINP 663
                  D+ N +  +CS+G LY +  Q + A+DA  R + +NP
Sbjct: 381 FQQAVNRDSRNPT-FWCSIGVLYYQIAQYRDALDAYTRAIRLNP 423

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 70/187 (37%), Gaps = 11/187 (5%)

Query: 484 MDP---TFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLT 540
           +DP   + A  WL  A      G+ D A  AY    +  P  +     L   Y + +   
Sbjct: 100 LDPLSQSTAETWLSIASLAETLGDADLAAMAYDATLQHNPSSTNALTSLAHLYRSRDMFQ 159

Query: 541 LAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSV 600
            A E +  A  ++P+   I   +G       EL  A    ++A         S+  +  +
Sbjct: 160 RAAELYQRALSANPELGDIWATLGHCYLMLDELQNAYAAYQQAL-----YHLSNPNIPKL 214

Query: 601 QINLSHTYRRLGENEKAIKYLTNILE---DTENSSEIYCSLGFLYLKTNQLQKAIDALHR 657
              +   Y R G  + A +    +LE     E ++EIY  LG +Y    +  +A++    
Sbjct: 215 WHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRY 274

Query: 658 VLAINPG 664
           +L   P 
Sbjct: 275 ILPQPPA 281

>YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component of
           anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [1881 bp, 626 aa]
          Length = 626

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 90/220 (40%), Gaps = 10/220 (4%)

Query: 413 MLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHELAEKD---PRNCITWYCVATYYMLLD 469
           ++K+D +    L TY + LY ++ ++KL  LA  +++ D   P  C     +A YY    
Sbjct: 355 IVKQDPYRLNDLETYSNILYVMQKNSKLAYLAQFVSQIDRFRPETCCI---IANYYSARQ 411

Query: 470 RIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFL 529
              ++  YF ++  +D     AW    H F        AI  Y  A    P        L
Sbjct: 412 EHEKSIMYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGL 471

Query: 530 GMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKD 589
           G  Y   +    +  YF  A    P D  I   +G    K G   +A +  K++ +  + 
Sbjct: 472 GQAYALLDMHLYSLYYFQKACTLKPWDRRIWQVLGECYSKTGNKVEAIKCYKRSIKASQT 531

Query: 590 MERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNILEDTE 629
           +++++    S+   L+  Y  L + ++  K++   ++  E
Sbjct: 532 VDQNT----SIYYRLAQLYEELEDLQECKKFMMKCVDVEE 567

>Scas_599.5
          Length = 809

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 73/182 (40%), Gaps = 7/182 (3%)

Query: 491 AWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAY 550
            W    + F+L+ + D+AI A+  A +  P         G +Y++ ++   A+ ++  A 
Sbjct: 592 TWCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAI 651

Query: 551 ESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQINLSHTYRR 610
            +          +G+   K GE  +A  Y +KA          S  +L     +  T  +
Sbjct: 652 SNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSI-----NPSNAILICCCGV--TMEK 704

Query: 611 LGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINPGNSSAQK 670
           LG  EKA+ Y     +    SS        L     +  +A+DA   ++ I P  ++ Q 
Sbjct: 705 LGNQEKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQF 764

Query: 671 LL 672
           +L
Sbjct: 765 IL 766

>Kwal_27.10740
          Length = 628

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 111/258 (43%), Gaps = 18/258 (6%)

Query: 424 LPTYISCLYEVKSSNKLFLLAHELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSI 483
           +  + + L+ +  +  L  L HEL E +     TW C+   + L     E+ K F +S+ 
Sbjct: 379 MEIFSTLLWHLNDTTGLSHLCHELLEVNRLAPETWCCIGNLFSLKKDHEESIKAFQRSTQ 438

Query: 484 MDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAE 543
           +DP+F  A+    H ++     D A++ Y  A          N + G+  M S  L   E
Sbjct: 439 LDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKA--LASNSQHYNAYYGLG-MCSLKLGQYE 495

Query: 544 E---YFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLS- 599
           E   +F  A   +P + +++   GV   K   L   +R L+     C+    SS  +   
Sbjct: 496 ECLLHFEKARSINPVNVILICCCGVALEK---LSHQERALQNYDLACELQPMSSLALFKR 552

Query: 600 VQINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVL 659
            Q+ L+     +G+   A++    +++   + + I+  LG LY    + Q A+  L   +
Sbjct: 553 AQLLLA-----MGKYNYALESFEKLVKIAPDEATIHFLLGQLYQIVGRKQDAVKELTIAM 607

Query: 660 AINPGNSSAQKLLNYALE 677
            ++P  S   +L+  ALE
Sbjct: 608 NLDPKGS---QLIKSALE 622

>ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH]
           complement(103567..106299) [2733 bp, 910 aa]
          Length = 910

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/201 (20%), Positives = 81/201 (40%), Gaps = 9/201 (4%)

Query: 451 DPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAIS 510
           +P +      +A  Y   D    A + + ++  ++P     W    H + +  +  +A +
Sbjct: 92  NPSSTKALTSLAHLYRSRDVFQRAAELYQRALAVNPELGDVWATLGHCYLMLDDLQRAYA 151

Query: 511 AYSTAARFFPGMSLPNLF--LGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKF 568
           AY  A       ++P L+  +G+ Y    +L  AEE F+   E  P       ++  + F
Sbjct: 152 AYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPH----FEKVNEIYF 207

Query: 569 KKGELHKAKRYLKKAAECCKDMERSSKTVLS---VQINLSHTYRRLGENEKAIKYLTNIL 625
           + G ++K +    +A EC + +       L    V   L      +GE + A +   ++L
Sbjct: 208 RLGIIYKHQGKWNQALECFRYILPQPPAPLQEWDVWFQLGSVLESMGEWQGAREAYEHVL 267

Query: 626 EDTENSSEIYCSLGFLYLKTN 646
              +  +++   LG LY   N
Sbjct: 268 SQNDRHAKVLQQLGCLYGMNN 288

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 627 DTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINP 663
           D+ N +  +CS+G LY + +Q + A+DA  R + +NP
Sbjct: 342 DSRNPT-FWCSIGVLYYQISQYRDALDAYTRAIRLNP 377

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 34/70 (48%)

Query: 594 SKTVLSVQINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAID 653
           S++     ++++     LG+ ++A       L+   +S++   SL  LY   +  Q+A +
Sbjct: 58  SQSAAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDVFQRAAE 117

Query: 654 ALHRVLAINP 663
              R LA+NP
Sbjct: 118 LYQRALAVNP 127

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 66/176 (37%), Gaps = 8/176 (4%)

Query: 492 WLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYE 551
           WL  A      G+ D+A  AY    ++ P  +     L   Y + +    A E +  A  
Sbjct: 65  WLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDVFQRAAELYQRALA 124

Query: 552 SSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQINLSHTYRRL 611
            +P+   +   +G       +L +A    ++A         S+  V  +   +   Y R 
Sbjct: 125 VNPELGDVWATLGHCYLMLDDLQRAYAAYQQAL-----YHLSNPNVPKLWHGIGILYDRY 179

Query: 612 GENEKAIKYLTNILE---DTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINPG 664
           G  + A +    +LE     E  +EIY  LG +Y    +  +A++    +L   P 
Sbjct: 180 GSLDYAEEAFAKVLELDPHFEKVNEIYFRLGIIYKHQGKWNQALECFRYILPQPPA 235

>CAGL0I02288g complement(203605..205524) similar to sp|P16522
           Saccharomyces cerevisiae YHR166c CDC23, hypothetical
           start
          Length = 639

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 107/271 (39%), Gaps = 17/271 (6%)

Query: 409 VCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHELAEKD---PRNCITWYCVATYY 465
           + E +++ D +    + T+ + LY ++ + KL  LA  +++ D   P  C     +A YY
Sbjct: 364 IFEKIMEDDPYRLDDMDTFSNILYVMQKNAKLAYLAQFVSQIDRFRPETCCV---IANYY 420

Query: 466 MLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLP 525
                  ++  YF ++  +D     AW    H F      + AI +Y  A    P     
Sbjct: 421 SARQEHEKSIMYFRRALTLDKKTTSAWTLMGHEFVELKNSNAAIESYRRAVDIDPRDFRA 480

Query: 526 NLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAE 585
              LG  Y   +    +  YF  A    P D  +   +G    K G   +A +  ++A +
Sbjct: 481 WYGLGQAYEVLDMHLYSLYYFQRACILKPLDKRMWQALGSCYAKVGNHAEAIKCYERALQ 540

Query: 586 CCKDMERSSK-----TVLSVQINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGF 640
                E+ +       +L  Q N     + L E    I+ +T  L  T+ S +    L  
Sbjct: 541 LTTQSEQDTALLYKLALLFEQTNGIDKCKLLMEKCVEIERITEGLV-TDESVKARLWLAK 599

Query: 641 LYLKTNQLQKAIDALHRVLAINPGNSSAQKL 671
             LKTN   KA D     LA+   N ++Q++
Sbjct: 600 FELKTNNYVKAYD-----LAVGVSNGTSQEM 625

>Scas_680.35
          Length = 631

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 84/214 (39%), Gaps = 4/214 (1%)

Query: 408 NVCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHELAEKDPRNCITWYCVATYYML 467
           N+ E ++K D +    L TY + LY ++  +KL  LA  +A+ D     T   +A YY  
Sbjct: 355 NLFEQVVKMDPYRLDDLDTYSNILYVMQKHSKLAYLAQFVAQIDKFRSETCCIMANYYSA 414

Query: 468 LDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNL 527
                ++  YF ++  ++     AW    H F        AI  Y  A            
Sbjct: 415 RQEHEKSIMYFRRALTLNKKCTSAWTLMGHEFVELKNSHAAIECYRRAVDINVRDFKAWY 474

Query: 528 FLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECC 587
            LG  Y   +    +  YF  A    P D  +   +G    K G   +A +  ++A +  
Sbjct: 475 GLGQAYEVLDMHLYSLYYFQKACTLKPLDRRMWQALGTCYTKIGNKTEAIKCFERAIQLS 534

Query: 588 KDMERSSKTVLSVQINLSHTYRRLGENEKAIKYL 621
            + ++ +    ++  NL+  Y +L +     +Y+
Sbjct: 535 GNADQDT----TLMYNLAKLYDQLNDAANCKQYM 564

>CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces
           cerevisiae YBR112c CYC8 general repressor of
           transcription, hypothetical start
          Length = 1148

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 94/217 (43%), Gaps = 13/217 (5%)

Query: 460 CVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFF 519
            +A  Y   D   +A + +  +  ++P  +  W    H + +  +  +A +AY  A    
Sbjct: 87  SLAHLYRSRDMFQKAAELYECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHL 146

Query: 520 PGMSLPNLF--LGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAK 577
              ++P L+  +G+ Y    +L  AEE F+   E  P       +   + F+ G ++K +
Sbjct: 147 SNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPH----FEKANEIYFRLGIIYKHQ 202

Query: 578 RYLKKAAECCKDMERSSKTVLS---VQINLSHTYRRLGENEKAIKYLTNILEDTENSSEI 634
               +A EC + +     T L    +   L      +GE + A +   ++L   ++ +++
Sbjct: 203 GKWSQALECFRYILAQPPTPLQEWDIWFQLGSVLESMGEWQGAREAYEHVLLQNDHHAKV 262

Query: 635 YCSLGFLYLKTN----QLQKAIDALHRVLAINPGNSS 667
           +  LG LY   N      QKA+  L + L ++P +++
Sbjct: 263 FQQLGCLYGMNNVQFYDPQKALSYLLKSLEVDPSDAT 299

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 20/30 (66%)

Query: 634 IYCSLGFLYLKTNQLQKAIDALHRVLAINP 663
            +CS+G LY + +Q + A+DA  R + +NP
Sbjct: 334 FWCSIGVLYYQISQYRDALDAYTRAIRLNP 363

>KLLA0A05258g 466776..468674 similar to sp|P16522 Saccharomyces
           cerevisiae YHR166c CDC23 subunit of anaphase-promoting
           complex (cyclosome), start by similarity
          Length = 632

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 78/198 (39%), Gaps = 22/198 (11%)

Query: 424 LPTYISCLYEVKSSNKLFLLAHELAEKD---PRNCITWYCVATYYMLLDRIPEARKYFSK 480
           L TY + LY ++   KL  LA   A  D   P  C     +A Y+    +  ++  YF +
Sbjct: 372 LDTYSNVLYVLQKPYKLAYLAQYAANVDIYRPETCCI---IANYFSSKQQHEKSILYFRR 428

Query: 481 SSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLT 540
           + ++D ++  AW+   H F        AI  Y  A+   P        LG  Y   +  +
Sbjct: 429 ALMLDKSYTHAWILMGHEFIEMKNSHAAIECYRRASDVNPRDFQAWYGLGQAYEVLDKHS 488

Query: 541 LAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRY--LKKAAECCKDMERSSKTVL 598
            A  YF  A    P D            K+     A  Y  L K  +  K  +RSS+  L
Sbjct: 489 FALYYFQKACALKPLD------------KRMWFASASCYEKLDKTVQAIKCFQRSSQ--L 534

Query: 599 SVQINLSHTYRRLGENEK 616
           S + ++S  YR    +EK
Sbjct: 535 SGEQDISILYRLAKLHEK 552

>Kwal_23.3670
          Length = 802

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/221 (20%), Positives = 89/221 (40%), Gaps = 13/221 (5%)

Query: 451 DPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAIS 510
           +P +      +A  Y   D    A + + ++  ++P     W    H + +  +  +A +
Sbjct: 96  NPSSTKALTSLAHLYRSRDMFQRAAELYQRALTVNPELGDIWATLGHCYLMLDDLQRAYA 155

Query: 511 AYSTAARFFPGMSLPNLF--LGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKF 568
           AY  A       ++P L+  +G+ Y    +L  AEE F+   E  PQ      +   + F
Sbjct: 156 AYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQ----FEKANEIYF 211

Query: 569 KKGELHKAKRYLKKAAECCKDMERSSKTVLS---VQINLSHTYRRLGENEKAIKYLTNIL 625
           + G ++K +    +A EC + +       L    V   L      + E + A +   ++L
Sbjct: 212 RLGIIYKHQGKWNQALECFRYILTQPPAPLQEWDVWFQLGSVLESMSEWQGAREAYEHVL 271

Query: 626 EDTENSSEIYCSLGFLYLKTN----QLQKAIDALHRVLAIN 662
              E  +++   LG LY   N      Q A++ L + L ++
Sbjct: 272 LQNERHAKVLQQLGCLYGMQNVQFYNTQTALNLLLKSLEVD 312

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 627 DTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINP 663
           D+ N +  +CS+G LY + +Q + A+DA  R + +NP
Sbjct: 346 DSRNPT-FWCSIGVLYYQISQYRDALDAYTRAIRLNP 381

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 67/176 (38%), Gaps = 8/176 (4%)

Query: 492 WLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYE 551
           WL  A      G+ D+A  AY    ++ P  +     L   Y + +    A E +  A  
Sbjct: 69  WLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYQRALT 128

Query: 552 SSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQINLSHTYRRL 611
            +P+   I   +G       +L +A    ++A         S+  V  +   +   Y R 
Sbjct: 129 VNPELGDIWATLGHCYLMLDDLQRAYAAYQQAL-----YHLSNPNVPKLWHGIGILYDRY 183

Query: 612 GENEKAIKYLTNILE---DTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINPG 664
           G  + A +    +LE     E ++EIY  LG +Y    +  +A++    +L   P 
Sbjct: 184 GSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILTQPPA 239

>Scas_705.55
          Length = 907

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/254 (19%), Positives = 96/254 (37%), Gaps = 47/254 (18%)

Query: 457 TWYCVAT----------------------------------YYMLLDRIPEARKYFSKSS 482
           TW  +A+                                   Y   D    A + + ++ 
Sbjct: 58  TWLSIASLAETVGDADRAAMAYDATLQFNPQSTKALTSLAHLYRSRDMFQRAAELYERAL 117

Query: 483 IMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLF--LGMQYMASNTLT 540
            ++P  +  W    H + +  +  +A ++Y  A       ++P L+  +G+ Y    +L 
Sbjct: 118 SINPELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLSNPNVPKLWHGIGILYDRYGSLD 177

Query: 541 LAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLS- 599
            AEE F+   E  PQ      +   + F+ G ++K +    +A EC + +       L  
Sbjct: 178 YAEEAFAKVLELDPQ----FEKANEIYFRLGIIYKHQGKWTQALECFRYILNQPPAPLQE 233

Query: 600 --VQINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTN----QLQKAID 653
             +   L      + E + A +   ++L   EN +++   LG LY   N      QKA++
Sbjct: 234 WDIWFQLGSVLESMNEWQGAREAYEHVLLQNENHAKVLQQLGCLYGMNNVSFYDPQKALN 293

Query: 654 ALHRVLAINPGNSS 667
            L + L ++P +S+
Sbjct: 294 YLLKSLEVDPNDST 307

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 102/290 (35%), Gaps = 65/290 (22%)

Query: 428 ISCLYEVKSSNKLFLLAHELAEK----DPRNCITWYCVATYYMLLDRIPEARKYFSKS-- 481
           ++ L  +  S  +F  A EL E+    +P     W  +   Y++LD +  A   + ++  
Sbjct: 93  LTSLAHLYRSRDMFQRAAELYERALSINPELSDVWATLGHCYLMLDDLQRAYNSYQQALY 152

Query: 482 SIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPN---LFLGMQYMASNT 538
            + +P     W G    +   G  D A  A++      P     N     LG+ Y     
Sbjct: 153 HLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGK 212

Query: 539 LTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVL 598
            T A E F        Q P  L E  +  F+ G + ++    + A E  +        VL
Sbjct: 213 WTQALECFRYILN---QPPAPLQEWDIW-FQLGSVLESMNEWQGAREAYEH-------VL 261

Query: 599 SVQINLSHTYRRLG-----------ENEKAIKYLTNILEDTENSSE-------------- 633
               N +   ++LG           + +KA+ YL   LE   N S               
Sbjct: 262 LQNENHAKVLQQLGCLYGMNNVSFYDPQKALNYLLKSLEVDPNDSTTWYHLGRVHMIRND 321

Query: 634 --------------------IYCSLGFLYLKTNQLQKAIDALHRVLAINP 663
                                +CS+G LY + +Q + A+DA  R + +NP
Sbjct: 322 YTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNP 371

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 68/179 (37%), Gaps = 8/179 (4%)

Query: 489 APAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSL 548
           A  WL  A      G+ D+A  AY    +F P  +     L   Y + +    A E +  
Sbjct: 56  AETWLSIASLAETVGDADRAAMAYDATLQFNPQSTKALTSLAHLYRSRDMFQRAAELYER 115

Query: 549 AYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQINLSHTY 608
           A   +P+   +   +G       +L +A    ++A         S+  V  +   +   Y
Sbjct: 116 ALSINPELSDVWATLGHCYLMLDDLQRAYNSYQQAL-----YHLSNPNVPKLWHGIGILY 170

Query: 609 RRLGENEKAIKYLTNILE---DTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINPG 664
            R G  + A +    +LE     E ++EIY  LG +Y    +  +A++    +L   P 
Sbjct: 171 DRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWTQALECFRYILNQPPA 229

>AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH]
           (111535..115707) [4173 bp, 1390 aa]
          Length = 1390

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/151 (19%), Positives = 59/151 (39%), Gaps = 2/151 (1%)

Query: 454 NCITW--YCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISA 511
           N + W    +  YY+ L +  E+ ++F  +  +D +   AW+G    +A  G  + +I  
Sbjct: 657 NSVNWPYRVLGVYYLELQQEAESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKV 716

Query: 512 YSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKG 571
           +  A    P      LFL +     +    + E         PQ+ +    +     +  
Sbjct: 717 FERALELSPEHKYAGLFLAISLCQLSEFEKSLEALRKLVNKYPQEAIFKERLSATLVEHA 776

Query: 572 ELHKAKRYLKKAAECCKDMERSSKTVLSVQI 602
                + YL KAA C  ++    + ++S Q+
Sbjct: 777 LQFFDQGYLIKAATCAAEVISIIEGIVSEQV 807

>YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of
           anaphase-promoting complex (APC), required for the
           metaphase-anaphase transition and for Clb2p degradation
           [2277 bp, 758 aa]
          Length = 758

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 60/153 (39%), Gaps = 4/153 (2%)

Query: 433 EVKSSNKLFLLAHELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAW 492
           +VKSSN    LA+ L +  P    TW C+     L      A K F K++ +DP FA A+
Sbjct: 522 KVKSSN----LANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAY 577

Query: 493 LGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYES 552
               H  +     D A + Y  A    P        LG   M       A  YF  A   
Sbjct: 578 TLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

Query: 553 SPQDPVILNEIGVLKFKKGELHKAKRYLKKAAE 585
           +P + V++   G    K G   KA +Y + A  
Sbjct: 638 NPVNVVLICCCGGSLEKLGYKEKALQYYELACH 670

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 81/195 (41%), Gaps = 15/195 (7%)

Query: 483 IMD--PTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLT 540
           +MD  P     W    +  +L+ + D AI A+  A +  P  +      G ++ ++++  
Sbjct: 532 LMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSD 591

Query: 541 LAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSV 600
            A+  +  A    PQ       +G    K G+  +A  Y +KA        RS   V  V
Sbjct: 592 SAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKA--------RSINPVNVV 643

Query: 601 QINL-SHTYRRLGENEKAIKY--LTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHR 657
            I     +  +LG  EKA++Y  L   L+ T + S+    +G L     +   A+     
Sbjct: 644 LICCCGGSLEKLGYKEKALQYYELACHLQPTSSLSKY--KMGQLLYSMTRYNVALQTFEE 701

Query: 658 VLAINPGNSSAQKLL 672
           ++ + P +++A  LL
Sbjct: 702 LVKLVPDDATAHYLL 716

>ABR206W [800] [Homologous to ScYHR166C (CDC23) - SH]
           complement(787181..789229) [2049 bp, 682 aa]
          Length = 682

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 49/240 (20%), Positives = 93/240 (38%), Gaps = 9/240 (3%)

Query: 413 MLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHELAEKDPRNCITWYCVATYYMLLDRIP 472
           ++K D +    L  Y + LY ++  +KL  L+   A+ D     T   +A Y+    +  
Sbjct: 410 IVKLDPYRLDDLDIYSNILYVIQKPHKLAYLSQFAADLDAYRPETCCIIANYFSAKQQHE 469

Query: 473 EARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQ 532
           +A  YF ++  ++ T   AW    H F        AI  Y  A    P        LG  
Sbjct: 470 KAIMYFRRALTLNKTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDINPCDFKAWYGLGQA 529

Query: 533 YMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMER 592
           Y   +    A  Y   A    P D  +   +     K    ++A +  ++A++   D + 
Sbjct: 530 YEVLDRHLYALYYLQKACSLKPLDKRMWQALANCYDKLDRPNQAIKCFQRASQLSNDQD- 588

Query: 593 SSKTVLSVQINLSHTYRRLGENEKAIKYLTNILE-DTENSSEIY--CSLGFLYLKTNQLQ 649
                +++   L+  Y R+ +      Y+   +E ++ N   I   C+   L+L  ++++
Sbjct: 589 -----ITILYYLATLYERVQDAISCKNYMLKCIEVESANQGIILDECAKARLWLARHEVK 643

>KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex (cyclosome), start by
           similarity
          Length = 710

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 7/93 (7%)

Query: 233 SIVCRYLLARCYIDVK-NYDDALDIVGETNPFADTAEASARIESDGGIKLESSMCFLRGK 291
           ++ C Y+ +RC + +K NY DALD +       DT        S  G   +S++C L GK
Sbjct: 141 NLACAYVYSRCCLKLKKNYSDALDCLLSLQSCWDTCL------SHFGYPKKSTICLLVGK 194

Query: 292 IYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLV 324
           ++   +  S+++   + ++  +P  +EA  +L 
Sbjct: 195 LFKLLDHESKSETFLRSSLDGNPYLWEASTELC 227

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 54/254 (21%), Positives = 99/254 (38%), Gaps = 10/254 (3%)

Query: 424 LPTYISCLYEVKSSNKLFLLAHELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSI 483
           + T+ + L+ ++    L  L  EL   D  N I W  +   + L     EA   F K+  
Sbjct: 461 MDTFSTVLWHLQDKTHLSALCAELLTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQ 520

Query: 484 MDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAE 543
           +DP FA A+    H ++     D A S +  A             LGM  +       A 
Sbjct: 521 LDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKTHYNALYGLGMCCVKLGKFEEAL 580

Query: 544 EYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQIN 603
            +F  A   +P + ++    GV   +  +  +A  + + A E    ++ +S   L     
Sbjct: 581 LFFEKARALNPVNVILNCCCGVALERLQQPERALNFYELATE----LQPNSSLAL---FK 633

Query: 604 LSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINP 663
            S     +G+   A+     +   T + + ++  LG LY    + Q A++     + ++P
Sbjct: 634 KSQLLLNMGQYSSALHNFERLESLTPDEAHVHFLLGNLYQIVGKKQDAMNQYTIAMNLDP 693

Query: 664 GNSSAQKLLNYALE 677
             S   +L+  A+E
Sbjct: 694 KGS---QLIKEAME 704

>Scas_672.24
          Length = 300

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 273 IESDGGIKLESSMCFLRGKIYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLVDS 326
           +E      LE  + ++ G+IY+   DF RA   F+E + + P N+ A+ QL +S
Sbjct: 154 VELTEKFPLEPELWWMLGEIYMNLKDFDRAIYCFEEILCIMPFNYVAFAQLAES 207

>Kwal_56.24750
          Length = 619

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 45/112 (40%)

Query: 409 VCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHELAEKDPRNCITWYCVATYYMLL 468
           + E ++K D +  + + TY + LY ++  +KL  LA   +  D     T   +A YY   
Sbjct: 343 IFENIIKIDPYRLEDMDTYSNILYVMQKPSKLAYLAQFASGVDRFRAETCCIIANYYSAK 402

Query: 469 DRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFP 520
               ++  YF ++  ++     AW    H F        AI  Y  A    P
Sbjct: 403 QEHEKSIMYFRRALTLNKKCTSAWTLMGHEFVELKNSHAAIECYRRAVDINP 454

>YOR080W (DIA2) [4887] chr15 (474553..476793) Protein involved in
           invasive growth, contains an F-box, tetratricopeptide
           (TPR) repeats and leucine-rich (LRR) repeats [2241 bp,
           746 aa]
          Length = 746

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 45/106 (42%), Gaps = 16/106 (15%)

Query: 562 EIGVLKFKKGELHKAKRYLKKAAECCK--DMERSSKTVLSVQINLSHTYRRLGENEKAIK 619
           E+G   FK GE  +AKR    A   C     E+  +   + Q++ +    +   + + IK
Sbjct: 34  ELGTRLFKSGEYLQAKRIFTNALRVCDSYSQEQIMRIRNAYQLDTARPDNKRLYHPRYIK 93

Query: 620 YLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINPGN 665
            L NI           C+    Y K N L+  +D   R+L + PGN
Sbjct: 94  ILDNI-----------CA---CYEKLNDLKSCLDVSQRLLKLEPGN 125

>CAGL0C01903g complement(199487..201796) similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex, hypothetical start
          Length = 769

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 92/240 (38%), Gaps = 8/240 (3%)

Query: 427 YISCLYEVKSSNKLFLLAHELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDP 486
           + + L+ ++   +L  L   L    P    TW CV  Y  L     +A + F K++ +DP
Sbjct: 523 FSTLLWHLQDYKRLASLVDYLLTYYPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKIDP 582

Query: 487 TFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYF 546
            FA A+    H  +     D A   +  A    P        +G+  M       A  YF
Sbjct: 583 KFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYF 642

Query: 547 SLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQINLSH 606
             A +  P + V++   GV   K     KA  Y + A      ++ +S      + NL +
Sbjct: 643 EKARQIYPINAVLICCCGVALEKLEYQDKALEYYELAC----TLQPNSNLARFKRANLLY 698

Query: 607 TYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINP-GN 665
               +G    A++    + + T     ++  LG LY    +  +AI      + ++P GN
Sbjct: 699 A---MGRYNLALQSFEELSKLTPEEPTVHFVLGQLYQIMGRKNEAIREFTVAMNLDPKGN 755

>Kwal_33.13428
          Length = 1052

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 56/134 (41%)

Query: 443 LAHELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALE 502
           L +E+ +KD +N   +  +   Y L  R  +    +  ++ ++P+    W   A   A  
Sbjct: 173 LYNEVIKKDVKNFAAYKTLGDIYQLQQRFNDCCNSWFLAAHLNPSDWEFWKVVATLSADL 232

Query: 503 GEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNE 562
           G   Q+I  Y+ A R             + Y  +N L  A E F   Y ++P D  +L E
Sbjct: 233 GHIRQSIYCYTRALRMNSEEWECVYGRAVLYRKTNQLGRALEGFQRLYNNNPFDGNLLRE 292

Query: 563 IGVLKFKKGELHKA 576
           + VL      +++A
Sbjct: 293 LAVLYVDYNRINEA 306

>ACR173W [1220] [Homologous to ScYJR088C - SH]
           complement(657718..658575) [858 bp, 285 aa]
          Length = 285

 Score = 32.7 bits (73), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 54/118 (45%), Gaps = 3/118 (2%)

Query: 551 ESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQINLSHTYRR 610
           E+SP+  + L +  +L+  +G+   A +YLK   E   + +  S   L V   L    R 
Sbjct: 81  ENSPR--MHLMKATLLQVTEGD-PAAAKYLKNLLEKQLEYDTDSVDYLQVGKKLIALERP 137

Query: 611 LGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINPGNSSA 668
               E  +K L ++LE     +E++ +L   Y K  Q  +AI     VL I+P   SA
Sbjct: 138 ALSTELWMKKLLSLLEKFPLDAELWWTLAMEYYKLGQFDQAIYCFEEVLLISPLAYSA 195

>ACL058W [991] [Homologous to NOHBY] complement(261723..264176)
           [2454 bp, 817 aa]
          Length = 817

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 2/68 (2%)

Query: 268 EASARIESDGGIKLESSMCFLRGK--IYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLVD 325
           E S   E D G KL  ++CFL  K    +  ND  R   A   +VL D    E   ++  
Sbjct: 334 ETSLPSEFDEGGKLNPNLCFLNAKYQFVILVNDVCRMDAALSRSVLSDKDLLEFRERVAQ 393

Query: 326 SHLLTTNE 333
            H L  N+
Sbjct: 394 LHALCANK 401

>AFL103C [3092] [Homologous to ScYPL210C (SRP72) - SH]
           (245331..247175) [1845 bp, 614 aa]
          Length = 614

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 64/134 (47%), Gaps = 19/134 (14%)

Query: 524 LPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKA 583
           +P  FL  + +A  +  L E+ + +          +LNE  V    KG+L +A+  LK+A
Sbjct: 164 VPLAFLPAEAVAEVSGKLVEDSYDM----------LLNESMVCS-SKGQLEQAESLLKRA 212

Query: 584 AECCKDMERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYL 643
            E  +  E     V ++Q+ L++  + LG  +++ K LT++ +     S +        +
Sbjct: 213 LELAR-AEEVEDDVHTIQLQLAYVTQLLGRKKESRKLLTDLQKQVSAVSPLVS-----II 266

Query: 644 KTNQLQKAIDALHR 657
           KTN   K++D L R
Sbjct: 267 KTN--LKSLDDLSR 278

>YOR027W (STI1) [4840] chr15 (381052..382821) Stress-induced protein
           required for optimal growth at high and low temperature,
           has tetratricopeptide (TPR) repeats [1770 bp, 589 aa]
          Length = 589

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 1/96 (1%)

Query: 530 GMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKD 589
           G ++  +     A E+++ A+E   +D   LN     +++KGE   A   L  A E  ++
Sbjct: 269 GNKFYKARQFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGEYETAISTLNDAVEQGRE 327

Query: 590 MERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNIL 625
           M    K +      + + Y +LG+ +K I+Y    L
Sbjct: 328 MRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

>Scas_721.64
          Length = 578

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 32/120 (26%)

Query: 228 DIISVSIVCRYLLARCYIDVKNYD-DALDIVGE--TNPFAD------TAEASARIESDGG 278
           DI  V++     LA  YI+ + YD +AL I+     N + +      T E S RIESD  
Sbjct: 346 DIDPVNLDALENLAISYIN-EGYDTNALKILNRWVKNKYPNFEHYEATTEESKRIESDLE 404

Query: 279 IKL----------------------ESSMCFLRGKIYVAQNDFSRAKEAFKEAVLVDPKN 316
             L                      ++ +  +RG +Y A++DF +  E FKE++ ++P +
Sbjct: 405 DDLSHNFNAVMIKKFNRLAESLPEHDAKLELIRGLLYYAEDDFDKTIECFKESLKINPND 464

>Kwal_23.5408
          Length = 1410

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 3/70 (4%)

Query: 434  VKSSNKLFLLAHELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWL 493
            V+ +   F+ A  L+   PR    WY +A   +  + I  AR    KS  + P  +  WL
Sbjct: 979  VRVAQHCFIKATALS---PRETSVWYDMAVLALKYNDIDFARSVLMKSQTIAPQDSSPWL 1035

Query: 494  GFAHTFALEG 503
            G A     EG
Sbjct: 1036 GLALASEKEG 1045

>KLLA0A07062g complement(636546..638291) similar to sp|P15705
           Saccharomyces cerevisiae YOR027w STI1 stress-induced
           protein, start by similarity
          Length = 581

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 544 EYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQIN 603
           E ++ A+E+   D   LN     +++KG+   A   L KA E  +++    K +      
Sbjct: 276 EKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRELRADYKVISKSFAR 334

Query: 604 LSHTYRRLGENEKAIKYLTNIL 625
           + ++Y +LG+ +KAI Y    L
Sbjct: 335 MGNSYHKLGDLKKAIDYYEKSL 356

>ABR131W [723] [Homologous to ScYNL121C (TOM70) - SH; ScYHR117W
           (TOM71) - SH] complement(641630..643414) [1785 bp, 594
           aa]
          Length = 594

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 1/81 (1%)

Query: 449 EKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQA 508
           E DP++   +Y  A    ++ +  +A K F K+   DP+    ++  A     E + D  
Sbjct: 367 ELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDC 426

Query: 509 ISAYSTAARFFP-GMSLPNLF 528
            + +S A R FP    +PN +
Sbjct: 427 ETLFSEARRRFPTAPEVPNFY 447

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 530 GMQYMASNTLTLAEEYFSLAYESSPQDP-------VILNEIGVLKFKKGELHKAKRYLKK 582
           G   +A    T A E F+ A+E++P +        + L  +G+LKF K E  +A   L+K
Sbjct: 272 GSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQK 331

Query: 583 A 583
           A
Sbjct: 332 A 332

>CAGL0L04048g 474410..476173 similar to sp|P07213 Saccharomyces
           cerevisiae YNL121c TOM70 or sp|P38825 Saccharomyces
           cerevisiae YHR117w TOM7, hypothetical start
          Length = 587

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 1/79 (1%)

Query: 451 DPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAIS 510
           DP     +Y       ++ +  +A + F K+   DPT    ++  A     EG  D   +
Sbjct: 361 DPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCET 420

Query: 511 AYSTAARFFPGM-SLPNLF 528
            +S A R FP    +PN F
Sbjct: 421 LFSEARRKFPDAPEVPNFF 439

>KLLA0D01155g complement(104847..105854) similar to sgd|S0005533
           Saccharomyces cerevisiae YOR007c SGT2, start by
           similarity
          Length = 335

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 603 NLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAI 661
           N +  Y  L + E+A+K     +E     S+ +  LGF     N+ ++A+DA  +VL I
Sbjct: 134 NRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192

>KLLA0B09966g complement(872760..873872) similar to sp|P33313
           Saccharomyces cerevisiae YBR155w CNS1 singleton,
           hypothetical start
          Length = 370

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 62/136 (45%), Gaps = 12/136 (8%)

Query: 547 SLAYESSPQDPVILNEIGV-LKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQ---- 601
           ++AYE  P      +EI    K +  +L+K KR+    A   K ++     VLS+     
Sbjct: 59  AMAYEGEP------HEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKC-DVLSINESLY 111

Query: 602 INLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAI 661
           +NL+     +      I Y    L+    + + +  +G  YL+  + + +++A+   LA+
Sbjct: 112 LNLAACELEIKNYRSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAV 171

Query: 662 NPGNSSAQKLLNYALE 677
           +P N + + + + A E
Sbjct: 172 DPENGALKSIQSKATE 187

>YHR117W (TOM71) [2405] chr8 (342351..344270) Minor import receptor
           of the mitochondrial outer membrane, similar to Tom70p
           in sequence and in function, has tetratricopeptide (TPR)
           repeats [1920 bp, 639 aa]
          Length = 639

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 3/83 (3%)

Query: 588 KDMERSSKTVLSVQIN--LSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKT 645
           K +  S +   +VQ+    +H +     NE AIKY    +E   N    Y ++   Y+ T
Sbjct: 116 KGLSPSQRQAYAVQLKNRGNHFFTAKNFNE-AIKYYQYAIELDPNEPVFYSNISACYIST 174

Query: 646 NQLQKAIDALHRVLAINPGNSSA 668
             L+K I+   + L I P +S A
Sbjct: 175 GDLEKVIEFTTKALEIKPDHSKA 197

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 289 RGKIYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLV 324
           RG++Y    D+  AKE F++A  ++P+N   Y QL 
Sbjct: 418 RGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLA 453

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 40/101 (39%), Gaps = 3/101 (2%)

Query: 494 GFAHTFALEGEQDQA-ISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYES 552
           GF +     GE D A +   S + R    + L N   G  +  +     A +Y+  A E 
Sbjct: 99  GFDYPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNR--GNHFFTAKNFNEAIKYYQYAIEL 156

Query: 553 SPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERS 593
            P +PV  + I       G+L K   +  KA E   D  ++
Sbjct: 157 DPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKA 197

>CAGL0L12936g 1380327..1382129 similar to sp|P07213 Saccharomyces
           cerevisiae YNL121c TOM70 or sp|P38825 Saccharomyces
           cerevisiae YHR117w TOM7, hypothetical start
          Length = 600

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (59%)

Query: 283 SSMCFLRGKIYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLV 324
           +++ + RG++Y    ++ +A E FK++   DPKN   Y QL 
Sbjct: 380 AAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLA 421

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 449 EKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGF-AHTFALEGEQDQ 507
           E DP+N   +  +A      +++ E  K F ++    PT AP    F A   A +G+ D+
Sbjct: 408 ESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPT-APEVPNFYAEILADKGDIDE 466

Query: 508 AISAYSTAARF 518
           A+  Y+ A R 
Sbjct: 467 AVKQYNIAYRL 477

>Scas_585.4
          Length = 918

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 3/83 (3%)

Query: 452 PRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISA 511
           P N  TWY      +  +++  A + FS+   +DPT A AW   +  +    E ++   A
Sbjct: 641 PLNFETWYFYGCVALECNKMEVAAEAFSRCVSLDPTHAMAWSNLSAAYV---ELNKLKEA 697

Query: 512 YSTAARFFPGMSLPNLFLGMQYM 534
           +S   R     S  N  +   YM
Sbjct: 698 FSCLKRSIACDSQRNWRIWENYM 720

>KLLA0E00979g 104991..107315 some similarities with sp|Q01477
           Saccharomyces cerevisiae YER151c UBP3 ubiquitin-specific
           proteinase singleton, hypothetical start
          Length = 774

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 6/95 (6%)

Query: 643 LKTNQLQKAIDALHRVLAINPGNS-SAQKLLNYALEL-NVTL----ELDENHPLVVNSNI 696
            K N     I     V  I+PG+S S++K L Y  E+ N T      L E++P+ +N+N 
Sbjct: 88  FKPNAFNNYIPMNANVPNISPGSSKSSEKGLEYRFEVGNATYFNSEALKESYPIYINTNF 147

Query: 697 LDEEHSASKIGKRRQPFESINVDKKRNKAGQLTEQ 731
            +   + S + + R+ + +       N+   +TE+
Sbjct: 148 AEFSRAKSTMEELRKSYSNFKTATVANEPNSVTEE 182

>CAGL0E01573g complement(148847..151561) similar to sp|P42842
           Saccharomyces cerevisiae YNL313c, start by similarity
          Length = 904

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 29/59 (49%)

Query: 457 TWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTA 515
           TWY      +  +++  A + F++ + +DPT A +W   +  +  +G+  +A S    A
Sbjct: 635 TWYFYGCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQA 693

>Scas_666.23
          Length = 596

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 45/104 (43%), Gaps = 2/104 (1%)

Query: 427 YISCLYEVKSSNKLFLLAHELAEK-DPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMD 485
           Y++ +   K     +   +E A K D +N   +Y     Y +  +  +A + F K+  +D
Sbjct: 345 YMALILADKGDTDNYFANYEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELD 404

Query: 486 PTFAPAWLGFAHTFALEGEQDQAISAYSTAARFFPGMS-LPNLF 528
           P     ++  A     E + D   + +S A R FP  S +PN +
Sbjct: 405 PENIFPYIQLACLSYRENKFDDCETLFSEARRKFPNSSEVPNFY 448

>KLLA0F04191g 397611..400268 weakly similar to sp|P19735
           Saccharomyces cerevisiae YBR055c PRP6
           snRNP(U4/U6)-associated splicing factor singleton, start
           by similarity
          Length = 885

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 17/89 (19%)

Query: 540 TLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAE-------------C 586
           +L +  F  A E++ + P+++ EIG +  K+ +  KA ++  +A+E              
Sbjct: 767 SLRKTTFQDALEATKEHPMVITEIGKVFQKEHQYAKAYKWFIRASENNLQFGDPWVWLYI 826

Query: 587 CKDMERSSKTVLSVQINLSHTYRRLGENE 615
           C+    S    + +QIN   T ++L ENE
Sbjct: 827 CE----SCMNPVDLQINEEKTLKKLKENE 851

>CAGL0G10087g 962823..967058 similar to sp|P17883 Saccharomyces
           cerevisiae YPR189w SKI3 antiviral protein, start by
           similarity
          Length = 1411

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 95/242 (39%), Gaps = 23/242 (9%)

Query: 493 LGFAHTFA-LEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYE 551
           LG  +T+       + A+S +       P  +   L  G  YM     T A E   LA  
Sbjct: 453 LGTVYTYVDTPKNHEAALSLFDKVLLEQPSNTEAKLGKGFIYMERENWTEAYELL-LAVS 511

Query: 552 SSPQDPV-ILNEIGVLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQI-NLSHTYR 609
           S   D   +L+EIG  +   G+  +A    K+  +    M+  ++   ++    L+ TY 
Sbjct: 512 SKYADRWDVLSEIGWCRVMLGQCEQAILDFKEVLKNIHGMDLRTQEFRALNYWRLAETYL 571

Query: 610 RLGENEK----------AIKYLTNILEDTENSSEIYCSLGFLYLK-TNQLQKAIDALHRV 658
            + E+E           A K L   ++  +  +  YCSLG +Y        +A    +R 
Sbjct: 572 NIQESEHVSEGFENVKLAYKILIQSIKALDGYAPSYCSLGKIYSNYYGDFSRAFRCHYRA 631

Query: 659 LAINPGNSSAQKLL--NYALELNVTLELDENHPLVVNSNILDEEHSASKIGKRRQPFESI 716
             ++ G+  + + L   YA   N TL L+      V+  ++  E S   + K   P+  +
Sbjct: 632 FELDAGDIISAEYLARTYADATNWTLALE------VSERLVKSEKSKKALRKVSWPYRIL 685

Query: 717 NV 718
            V
Sbjct: 686 GV 687

>CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor, hypothetical start
          Length = 590

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 12/82 (14%)

Query: 494 GFAHTFALEGEQDQAISAYSTAARFFPGMSLPN----------LFLGMQYMASNTLTLAE 543
           GF ++  LEG++D+  + +S   R F  +SL N          L LG+ + A++      
Sbjct: 387 GFYNSAELEGKRDEHENIHSKMTRRF--LSLVNRINSVDPDIQLCLGLLFYANDEFDRTI 444

Query: 544 EYFSLAYESSPQDPVILNEIGV 565
           + F  A + +P D ++ N +G 
Sbjct: 445 DCFQAALKVNPNDELMWNRLGA 466

>CAGL0J09570g complement(939447..941096) some similarities with
           sp|P35056 Saccharomyces cerevisiae YDR244w PAS10
           peroxisomal targeting signal receptor, hypothetical
           start
          Length = 549

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 30/70 (42%)

Query: 446 ELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQ 505
           +L E+DP++ ITW  +        R   A + +  +  + P+F  A      T    GE 
Sbjct: 416 KLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSFVRARYNLGSTLVKNGEL 475

Query: 506 DQAISAYSTA 515
            + I +  TA
Sbjct: 476 QRGIESLLTA 485

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 625 LEDTENSSEIYC--SLGFLYLKTNQLQKAIDALHRVLAINPGNSSAQKLL 672
           L++ E    + C   LG + L+  Q + A+DA    L + PG+  A KLL
Sbjct: 280 LQEHEQQHMVDCWYRLGIVQLQNEQEESAMDAFQHALELEPGHLEALKLL 329

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 4/95 (4%)

Query: 494 GFAHTFALEGEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESS 553
           G AHT    G  D AI   +       G  + +  + M+ M+ +++  A    +      
Sbjct: 92  GMAHT---NGHLDAAIPMSNMIPVQMGGYQVMDRSM-MEPMSGSSVAYANTSANANGTPL 147

Query: 554 PQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCK 588
           P  PV  N +  +    G+LHK KR   KA E C+
Sbjct: 148 PPQPVSANYMNNISQMPGQLHKEKRRAAKACEYCR 182

>YDL238C (YDL238C) [638] chr4 complement(28985..30454) Putative
           guanine deaminase [1470 bp, 489 aa]
          Length = 489

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 61/137 (44%), Gaps = 10/137 (7%)

Query: 583 AAECCKD-MERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFL 641
           A  C ++ M++ SK V    I   H    L EN++ I+++ ++  + E+ +++Y   G L
Sbjct: 233 APSCSRELMQQLSKLVKDENI---HVQTHLSENKEEIQWVQDLFPECESYTDVYDKYGLL 289

Query: 642 YLKT--NQLQKAIDALHRVLAINPGNSSAQKLLNYAL---ELNVTLELDENHPLVVNSNI 696
             KT         DA  RV+       S   + N +L   E  V   LD+   + + +++
Sbjct: 290 TEKTVLAHCIHLTDAEARVIKQRRCGISHCPISNSSLTSGECRVRWLLDQGIKVGLGTDV 349

Query: 697 LDEEHSASKIGKRRQPF 713
               HS S +   RQ F
Sbjct: 350 -SAGHSCSILTTGRQAF 365

>CAGL0A03630g complement(364712..367900) similar to sp|P33339
           Saccharomyces cerevisiae YGR047c TFC4, hypothetical
           start
          Length = 1062

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 53/134 (39%)

Query: 443 LAHELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALE 502
           L +E+ +KDPRN   +  +   Y L  R+ +    +  ++ ++ +    W   A   +  
Sbjct: 155 LFNEVIKKDPRNFAAYETLGDIYQLQGRMNDCCNSWFLAAHLNASDWEFWKIVAILSSDL 214

Query: 503 GEQDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNE 562
           G   QAI  +S                 + Y  +  +  A + F   Y  SP D  IL E
Sbjct: 215 GHIRQAIYCFSRVIHLNKEEWECIYRRALLYKQTGQIARALDGFQKMYTKSPSDANILRE 274

Query: 563 IGVLKFKKGELHKA 576
           + +L     ++ KA
Sbjct: 275 LAILYVDYNKVEKA 288

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,669,200
Number of extensions: 868785
Number of successful extensions: 3571
Number of sequences better than 10.0: 69
Number of HSP's gapped: 3559
Number of HSP's successfully gapped: 126
Length of query: 731
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 622
Effective length of database: 12,822,747
Effective search space: 7975748634
Effective search space used: 7975748634
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)