Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L09383g36636013460.0
YGL162W (SUT1)2991513055e-32
YPR009W (SUT2)2681402819e-29
Sklu_1042.22981382812e-28
CAGL0I04246g3571712692e-26
AEL298C3371262673e-26
Kwal_14.15243941852528e-24
KLLA0A03091g3831542402e-22
Scas_710.104371242229e-20
KLLA0A03443g97536860.016
KLLA0F04609g91623860.016
Scas_662.890622830.034
CAGL0G08844g84722830.034
AER370W80122820.038
Kwal_23.475481222820.040
YIL130W96422820.043
Sklu_1993.282322820.046
CAGL0L01903g128724820.047
KLLA0D01452g144519800.070
Scas_696.44116425800.077
YMR280C (CAT8)143319790.11
CAGL0M03025g125433790.11
KLLA0F25630g100739790.11
Kwal_27.10232120942780.13
CAGL0L03377g120920760.22
ABL121C128519760.23
YKL038W (RGT1)117022750.29
KLLA0F14322g71728750.30
CAGL0A00451g110721740.39
YOL089C (HAL9)103031740.40
AGL083W85629740.42
KLLA0F02750g114819740.45
Scas_637.799823730.51
KLLA0A09119g108229730.59
YJL089W (SIP4)82934720.59
Scas_625.5114120730.60
YLR256W (HAP1)150228720.75
YOR162C (YRR1)81086710.81
Sklu_2296.691921710.83
Scas_573.4147828710.84
AER183C87921710.91
YGL013C (PDR1)106822710.94
YER184C79424691.4
Scas_669.863726691.5
CAGL0B03421g135520691.5
Sklu_2187.342539681.6
KLLA0F22990g125377691.7
Scas_588.1183521681.9
AFR096W85219681.9
Sklu_2376.692222682.1
AFR117C115225682.2
Scas_521.289016672.4
Kwal_56.2260586523672.5
YLR266C (PDR8)70170672.8
Kwal_47.1768185427673.0
Sklu_2411.1168725663.1
YDR421W (ARO80)95020663.2
KLLA0F09559g65822663.2
CAGL0F09229g83523663.3
CAGL0A04455g109824663.5
Scas_711.3193215663.5
CAGL0K05841g137240663.6
KLLA0C14212g104029663.7
Sklu_2064.292222654.3
Scas_603.14*25993644.4
YOR380W (RDR1)54622654.7
Sklu_2191.271822645.6
Scas_518.591942646.7
Kwal_26.810997020646.8
YMR019W (STB4)94924638.1
Scas_709.65*65120638.4
Scas_630.1470134638.5
Scas_638.14104344638.6
KLLA0A02585g37021629.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L09383g
         (360 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L09383g 1018859..1019959 some similarities with sp|P53032 S...   523   0.0  
YGL162W (SUT1) [1827] chr7 (198142..199041) Protein that binds S...   122   5e-32
YPR009W (SUT2) [5445] chr16 (576547..577353) Protein with simila...   112   9e-29
Sklu_1042.2 YGL162W, Contig c1042 1296-2192 reverse complement        112   2e-28
CAGL0I04246g 377568..378641 weakly similar to sp|P53032 Saccharo...   108   2e-26
AEL298C [2207] [Homologous to ScYPR009W (SUT2) - SH; ScYGL162W (...   107   3e-26
Kwal_14.1524                                                          101   8e-24
KLLA0A03091g 276333..277484 some similarities with sgd|S0006213 ...    97   2e-22
Scas_710.10                                                            90   9e-20
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    38   0.016
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    38   0.016
Scas_662.8                                                             37   0.034
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    37   0.034
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    36   0.038
Kwal_23.4754                                                           36   0.040
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    36   0.043
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         36   0.046
CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces c...    36   0.047
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    35   0.070
Scas_696.44                                                            35   0.077
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    35   0.11 
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    35   0.11 
KLLA0F25630g 2378464..2381487 some similarities with sp|P32862 S...    35   0.11 
Kwal_27.10232                                                          35   0.13 
CAGL0L03377g complement(382932..386561) some similarities with s...    34   0.22 
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    34   0.23 
YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in...    33   0.29 
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    33   0.30 
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    33   0.39 
YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein i...    33   0.40 
AGL083W [4228] [Homologous to ScYKL038W (RGT1) - SH; ScYBR033W (...    33   0.42 
KLLA0F02750g complement(250368..253814) some similarities with s...    33   0.45 
Scas_637.7                                                             33   0.51 
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    33   0.59 
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    32   0.59 
Scas_625.5                                                             33   0.60 
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    32   0.75 
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    32   0.81 
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       32   0.83 
Scas_573.4                                                             32   0.84 
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    32   0.91 
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    32   0.94 
YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein...    31   1.4  
Scas_669.8                                                             31   1.5  
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    31   1.5  
Sklu_2187.3 YOL022C, Contig c2187 5491-6768                            31   1.6  
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    31   1.7  
Scas_588.11                                                            31   1.9  
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    31   1.9  
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              31   2.1  
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    31   2.2  
Scas_521.2                                                             30   2.4  
Kwal_56.22605                                                          30   2.5  
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    30   2.8  
Kwal_47.17681                                                          30   3.0  
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      30   3.1  
YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive transcri...    30   3.2  
KLLA0F09559g complement(876719..878695) some similarities with s...    30   3.2  
CAGL0F09229g complement(908186..910693) weakly similar to sp|P39...    30   3.3  
CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces c...    30   3.5  
Scas_711.31                                                            30   3.5  
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    30   3.6  
KLLA0C14212g complement(1229219..1232341) some similarities with...    30   3.7  
Sklu_2064.2 , Contig c2064 873-3641                                    30   4.3  
Scas_603.14*                                                           29   4.4  
YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with simi...    30   4.7  
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         29   5.6  
Scas_518.5                                                             29   6.7  
Kwal_26.8109                                                           29   6.8  
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...    29   8.1  
Scas_709.65*                                                           29   8.4  
Scas_630.14                                                            29   8.5  
Scas_638.14                                                            29   8.6  
KLLA0A02585g complement(226562..227674) some similarities with c...    28   9.0  

>CAGL0L09383g 1018859..1019959 some similarities with sp|P53032
           Saccharomyces cerevisiae YGL162w SUT1 or tr|Q12286
           Saccharomyces cerevisiae YPR009w, hypothetical start
          Length = 366

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/360 (74%), Positives = 269/360 (74%)

Query: 1   MATSITVLNRDTXXXXXXXXXXXXXRASFGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MATSITVLNRDT             RASFGD                             
Sbjct: 1   MATSITVLNRDTSLPPLLLPNLSSSRASFGDSLSSVPSSRSNSSSTTLSRIDSTSSAASS 60

Query: 61  XXXXXXXXXXQHVNLELKKARTDDHYYYNPAFAAATLSPVSSLPKPTQMLDVXXXXXXXX 120
                     QHVNLELKKARTDDHYYYNPAFAAATLSPVSSLPKPTQMLDV        
Sbjct: 61  VSSTDLFLSSQHVNLELKKARTDDHYYYNPAFAAATLSPVSSLPKPTQMLDVPTLSTLPS 120

Query: 121 XXXXXXXXXXXXXGEVIGSANIGATLSKFESRAFKVSKSKKAILNLASPKQKLPSPKLGX 180
                        GEVIGSANIGATLSKFESRAFKVSKSKKAILNLASPKQKLPSPKLG 
Sbjct: 121 FTSTYTTHSPTTPGEVIGSANIGATLSKFESRAFKVSKSKKAILNLASPKQKLPSPKLGV 180

Query: 181 XXXXXXXXXXXXXXXXXAFNTMASNIKSTSDLVANNAGKRQRIGPSCDKCRSKKIKCDAK 240
                            AFNTMASNIKSTSDLVANNAGKRQRIGPSCDKCRSKKIKCDAK
Sbjct: 181 IQKPISVPPKKSSPFVSAFNTMASNIKSTSDLVANNAGKRQRIGPSCDKCRSKKIKCDAK 240

Query: 241 IDILCQDEAVLHMFGQSLHHELTKHEIETQLGQEVYSQSSTFAYISKDLMSKIESREPDA 300
           IDILCQDEAVLHMFGQSLHHELTKHEIETQLGQEVYSQSSTFAYISKDLMSKIESREPDA
Sbjct: 241 IDILCQDEAVLHMFGQSLHHELTKHEIETQLGQEVYSQSSTFAYISKDLMSKIESREPDA 300

Query: 301 KIIKHLDKIIYFQPCTSCSRKKNTAVCAFSKGFTRADINIFSKIGSRVAQKPIYEMTYKE 360
           KIIKHLDKIIYFQPCTSCSRKKNTAVCAFSKGFTRADINIFSKIGSRVAQKPIYEMTYKE
Sbjct: 301 KIIKHLDKIIYFQPCTSCSRKKNTAVCAFSKGFTRADINIFSKIGSRVAQKPIYEMTYKE 360

>YGL162W (SUT1) [1827] chr7 (198142..199041) Protein that binds
           Ssn6p and counteracts Ssn6p-Tup1p-mediated
           transcriptional repression, involved in sterol uptake
           [900 bp, 299 aa]
          Length = 299

 Score =  122 bits (305), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 90/151 (59%), Gaps = 18/151 (11%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMFGQSLHHELTKHEIETQLGQEVYSQ 278
           KRQR GPSCDKCR KKIKC+AKI+IL QD+ ++ M    L + LT  +I    G  + + 
Sbjct: 152 KRQRSGPSCDKCRLKKIKCNAKIEILLQDDTIMPMISNKLRYVLTPDDIRLYRGTLLRNI 211

Query: 279 SSTFAYISKDLMSKIESREPDAKIIKHLDKIIYFQPCTSCSRKKNTAV---------CAF 329
           +     I  D++    SR    K+IKH+DK++   PC  C +KK+++          C F
Sbjct: 212 A-----IPDDVIEGTGSR----KLIKHIDKLVLLTPCLPCIKKKHSSSSTNFPKNDKCTF 262

Query: 330 SKGFTRADINIFSKIGSRVAQKPIYEMTYKE 360
           SKGFTRADINI SKI  +   K IY++TY +
Sbjct: 263 SKGFTRADINISSKISLKFKDKTIYDITYDD 293

>YPR009W (SUT2) [5445] chr16 (576547..577353) Protein with
           similarity to Sut1p, involved in sterol uptake [807 bp,
           268 aa]
          Length = 268

 Score =  112 bits (281), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 85/140 (60%), Gaps = 16/140 (11%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMFGQSLHHELTKHEIETQLGQEVYSQ 278
           KRQR GPSCD CR KKIKC+A I I  QD  ++     +LH+ L++ +I  Q   + + +
Sbjct: 132 KRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSNLHYTLSQDDIN-QFRMKFFRK 190

Query: 279 SSTFAYISKDLMSKIESREPDAKIIKHLDKIIYFQPCTSCSRK-KNTAVCAFSKGFTRAD 337
                    D+M   E       +IKHLDKI+ F+ CTSCSR+ +    C FS+GFT++D
Sbjct: 191 LP-------DVMGTYE-------VIKHLDKIVLFKACTSCSRRNQKNGKCLFSRGFTKSD 236

Query: 338 INIFSKIGSRVAQKPIYEMT 357
           +N+F KI S++  K I+EMT
Sbjct: 237 MNVFPKINSKLKDKSIFEMT 256

>Sklu_1042.2 YGL162W, Contig c1042 1296-2192 reverse complement
          Length = 298

 Score =  112 bits (281), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 86/138 (62%), Gaps = 12/138 (8%)

Query: 218 GKRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMFGQSLHHELTKHEIETQLGQEVYS 277
            KRQR+GPSCD CR +KIKCDA I I+ Q E+++     SLH  L+  ++E  L + +  
Sbjct: 157 SKRQRVGPSCDVCRVRKIKCDATIRIVHQAESLVSSISDSLHAVLSAQDLEL-LPKYLAD 215

Query: 278 QSSTFAYISKDLMSKIESREPDAKIIKHLDKIIYFQPCTSCSRKKNTAVCAFSKGFTRAD 337
           +      +  DL+ +++      +++KH+DK++ F+PC SC +K N A C FSKG TRAD
Sbjct: 216 R------VPLDLLLQVKDPADKTQLVKHVDKLVVFKPCRSCHKKHN-AACQFSKGLTRAD 268

Query: 338 INIFSKI----GSRVAQK 351
           INIF+++    G R A K
Sbjct: 269 INIFNRLEKKTGKRAALK 286

>CAGL0I04246g 377568..378641 weakly similar to sp|P53032
           Saccharomyces cerevisiae YGL162w SUT1 hypoxic protein
           involved in sterol uptake, start by similarity
          Length = 357

 Score =  108 bits (269), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 95/171 (55%), Gaps = 33/171 (19%)

Query: 207 KSTSDLVANNAGKRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMFGQSLHHELTKHE 266
           +  ++  A++  KRQR+GPSCDKCR KKIKC+A  +IL QD  ++ +F   LH+E +  E
Sbjct: 153 RGKNNAAAHHIAKRQRVGPSCDKCRVKKIKCNATSNILVQDLDIVSLFSTKLHYEFSPEE 212

Query: 267 I---ETQLGQEVYSQSSTFAYISKDLMSKI-ESREPDAK-IIKHLDKIIYFQPCTSCSRK 321
           I    +++ Q +  +    A   ++L   I +++ P  K ++KH+DK+I FQPC SC +K
Sbjct: 213 ILNENSEVNQYMRRKHIIDAPSIQNLKECIRKNQNPQNKTLVKHIDKLIIFQPCDSCQKK 272

Query: 322 KNTAV----------------------------CAFSKGFTRADINIFSKI 344
           KN  +                            C FSKGFTR+DI+I++KI
Sbjct: 273 KNNLLITANSTPIEIRQNPKFQKTHELLISHCNCTFSKGFTRSDISIYTKI 323

>AEL298C [2207] [Homologous to ScYPR009W (SUT2) - SH; ScYGL162W
           (SUT1) - SH] (81182..82195) [1014 bp, 337 aa]
          Length = 337

 Score =  107 bits (267), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 80/126 (63%), Gaps = 13/126 (10%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMFGQSLHHELTKHEIETQLGQEVYSQ 278
           KRQR GPSCD CRSKKIKCDA I IL QD +V   F + LH  +   E    L  E  SQ
Sbjct: 200 KRQRTGPSCDICRSKKIKCDATITILFQDASVTGSFNEMLHAPVNVSE----LANEWLSQ 255

Query: 279 SSTFAYISKDLMSKIESREPDAKIIKHLDKIIYFQPCTSCSRKKNTAVCAFSKGFTRADI 338
                 I  ++   + ++E    ++KH+DK+I F+PCTSCS++KN   C FSKGFTRADI
Sbjct: 256 ------IPDEVRQALLTKE--LTLLKHVDKLIAFKPCTSCSKRKN-CFCTFSKGFTRADI 306

Query: 339 NIFSKI 344
           N+++ +
Sbjct: 307 NVYTNL 312

>Kwal_14.1524
          Length = 394

 Score =  101 bits (252), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 90/185 (48%), Gaps = 60/185 (32%)

Query: 214 ANNAGKRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMFG---QSLHHELTKHEIETQ 270
           A  + KRQRIGPSCD CR KKIKCDA + +L QDEA++   G   +SLH  +T  E++  
Sbjct: 193 AAPSAKRQRIGPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNKNESLHATMTYSELKAA 252

Query: 271 LGQEVYSQSSTFAYISKDLMSKIESREPDA-KIIKHLDKIIYFQPCTSCSRKKNT----- 324
           L   V+        +   ++  +ES++  A ++++H+DK+++F+ C SC+R+  +     
Sbjct: 253 LPSHVWKN------LPARVLEALESQDSRAGEVVRHVDKVVFFRACASCARRNASGSGSG 306

Query: 325 ---------------------------------------------AVCAFSKGFTRADIN 339
                                                        A C FSKGFTR+DIN
Sbjct: 307 KESDGESGTSAPATPAGPTGSVRAAAGVAAAAAGTTATPAAALGPACCTFSKGFTRSDIN 366

Query: 340 IFSKI 344
           +F+++
Sbjct: 367 VFTRL 371

>KLLA0A03091g 276333..277484 some similarities with sgd|S0006213
           Saccharomyces cerevisiae YPR009w, hypothetical start
          Length = 383

 Score = 97.1 bits (240), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 93/154 (60%), Gaps = 15/154 (9%)

Query: 200 NTMASNIKSTSDLVANNAGKRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMF--GQS 257
           N + +NI S + ++ ++  KRQR GPSCD CRSKKIKCDA + ++ QD ++L      +S
Sbjct: 224 NQLLANI-SGAKVITSSKCKRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDES 282

Query: 258 LHHELTKHEIETQLGQEVYSQSSTFAYISKDLMSKIESREPDAKIIKHLDKIIYFQPCTS 317
           LH  L+   I+T        +      I  ++  ++  R+ D  +++H+DK+I F  C+S
Sbjct: 283 LHCPLS---IDT-------CRPDILMKIPTEVRKQLAERK-DMSLVRHVDKLIAFSSCSS 331

Query: 318 CSRKKNTAVCAFSKGFTRADINIFSKIGSRVAQK 351
           C +KK+   C+FSKGFTR DI +FS +  ++ ++
Sbjct: 332 CQKKKDRD-CSFSKGFTRNDIAVFSTLNKKLGKR 364

>Scas_710.10
          Length = 437

 Score = 90.1 bits (222), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 69/124 (55%), Gaps = 8/124 (6%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMFGQSLHHELTKHEIETQLGQEVYSQ 278
           KRQR+GPSCD CR KKIKCD++I ++ +   +L++    +H+     EIE  L +    +
Sbjct: 283 KRQRVGPSCDHCRFKKIKCDSQIKVVLESNHILNLISNKIHYVFNADEIE--LLKTTLLK 340

Query: 279 SST----FAYISKDLMSKIESREPDAKIIKHLDKIIYFQPCTSCSRKKNTAVCAFSKGFT 334
           ++T     A  +      I        ++KH DKII F PCTSC   KN   C FS GFT
Sbjct: 341 NTTLPEKLANTTTINKRNIAEGSVYPILLKHFDKIILFSPCTSCD--KNEQDCLFSMGFT 398

Query: 335 RADI 338
           R+DI
Sbjct: 399 RSDI 402

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 58/115 (50%), Gaps = 5/115 (4%)

Query: 220 RQRIGPSCDKCRSKKIKCDAKIDIL-CQDEAVLHMFGQSLHHELTKHEIETQLGQEVYSQ 278
           R+R   SCD CR +KIKCD+  +I+   ++ +  MF   + H LTK EI+ +L Q +   
Sbjct: 133 RKRNSSSCDYCRQRKIKCDSNFNIIRTSNQLIGPMFPDEIFHILTKKEID-ELQQVMVPP 191

Query: 279 SSTFAYISKDLMSKIESREPDAKIIKHLDKIIYFQPCTSCSRKKNTAVCAFSKGF 333
               + +     +   + E +  + K+ + +I F PCT+CS +     C F   F
Sbjct: 192 LELPSTLFNYQWNWEANPEGNPILFKNKNDLILFTPCTNCSMQ---FTCQFKDKF 243

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
           Saccharomyces cerevisiae YAL051w OAF1 peroxisome
           proliferating transcription factor, start by similarity
          Length = 975

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 20/36 (55%)

Query: 203 ASNIKSTSDLVANNAGKRQRIGPSCDKCRSKKIKCD 238
           A + KS  D  +N A KRQRI   C  CR  K KCD
Sbjct: 11  ADDEKSREDQTSNGACKRQRISFVCQACRKNKTKCD 46

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
           Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 18/23 (78%)

Query: 218 GKRQRIGPSCDKCRSKKIKCDAK 240
            KR+R+  +CD+CR KK+KCD K
Sbjct: 5   NKRRRVTRACDECRKKKVKCDGK 27

>Scas_662.8
          Length = 906

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 18/22 (81%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAK 240
           KR+R+  +CD+CR KK+KCD +
Sbjct: 29  KRRRVTRACDECRKKKVKCDGQ 50

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
           Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 17/22 (77%)

Query: 218 GKRQRIGPSCDKCRSKKIKCDA 239
           GKR+++  +CD CR KK+KCD 
Sbjct: 11  GKRRKVTRACDDCRKKKVKCDG 32

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
           complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 36.2 bits (82), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 19/22 (86%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAK 240
           KR+R+  +CD+CR KK+KCD++
Sbjct: 10  KRRRVTRACDECRKKKVKCDSR 31

>Kwal_23.4754
          Length = 812

 Score = 36.2 bits (82), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 18/22 (81%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAK 240
           KR+R+  +CD+CR KK+KCD +
Sbjct: 7   KRRRVTRACDECRKKKVKCDGQ 28

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region, putative transcription
           factor [2895 bp, 964 aa]
          Length = 964

 Score = 36.2 bits (82), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 18/22 (81%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAK 240
           KR+R+  +CD+CR KK+KCD +
Sbjct: 13  KRRRVTRACDECRKKKVKCDGQ 34

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 36.2 bits (82), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 18/22 (81%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAK 240
           KR+R+  +CD+CR KK+KCD +
Sbjct: 7   KRRRVTRACDECRKKKVKCDGQ 28

>CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces
           cerevisiae YKL038w RGT1, hypothetical start
          Length = 1287

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (70%)

Query: 215 NNAGKRQRIGPSCDKCRSKKIKCD 238
           NN  KR  +  +CD+CR KKIKCD
Sbjct: 4   NNDKKRTNVSRACDQCRRKKIKCD 27

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 35.4 bits (80), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 16/19 (84%)

Query: 222 RIGPSCDKCRSKKIKCDAK 240
           R+  +CD+CR+KKI+CD K
Sbjct: 178 RVAQACDRCRAKKIRCDGK 196

>Scas_696.44
          Length = 1164

 Score = 35.4 bits (80), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 216 NAGKRQRIGPSCDKCRSKKIKCDAK 240
           N     RI  +CD+CRSKK +CD K
Sbjct: 70  NEDSNLRIAQACDRCRSKKTRCDGK 94

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
           Transcription factor required for derepression of
           gluconeogenic enzymes, contains an N-terminal
           Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
           bp, 1433 aa]
          Length = 1433

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 15/19 (78%)

Query: 222 RIGPSCDKCRSKKIKCDAK 240
           RI  +CD+CRSKK +CD K
Sbjct: 65  RIAQACDRCRSKKTRCDGK 83

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
           Saccharomyces cerevisiae YMR280c CAT8 transcription
           factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 5/33 (15%)

Query: 214 ANNAGKRQ-----RIGPSCDKCRSKKIKCDAKI 241
            +N G R      R+  +CD+CR KK KCD KI
Sbjct: 42  GSNTGSRGSTPTYRVAQACDRCRLKKTKCDGKI 74

>KLLA0F25630g 2378464..2381487 some similarities with sp|P32862
           Saccharomyces cerevisiae YKL038w RGT1 regulator of
           glucose-induced genes, hypothetical start
          Length = 1007

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 200 NTMASNIKSTSDLVANNAGKRQRIGPSCDKCRSKKIKCD 238
           NT   ++ S        + +R ++  +CD+CR KKIKCD
Sbjct: 90  NTRRDSVSSNVSTATTESRRRSKVSRACDQCRKKKIKCD 128

>Kwal_27.10232
          Length = 1209

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 200 NTMASNI-KSTSDLVANNAGKRQRIGPSCDKCRSKKIKCDAK 240
           N+ A N  +S S + +       R+  +CD+CRSKK +CD K
Sbjct: 46  NSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGK 87

>CAGL0L03377g complement(382932..386561) some similarities with
           sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
           interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%)

Query: 220 RQRIGPSCDKCRSKKIKCDA 239
           ++R   +CD+CRSKKIKCD 
Sbjct: 22  KKRHSQACDRCRSKKIKCDG 41

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 15/19 (78%)

Query: 222 RIGPSCDKCRSKKIKCDAK 240
           R+  +CD+CRSKK +CD K
Sbjct: 73  RVAQACDRCRSKKTRCDGK 91

>YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in
           regulation of glucose transporters, acts as a
           transcriptional repressor that is converted to an
           activator upon glucose-induced phosphorylation [3513 bp,
           1170 aa]
          Length = 1170

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (72%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAK 240
           KR +   +CD+CR KKIKCD K
Sbjct: 39  KRTKASRACDQCRKKKIKCDYK 60

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
           Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 212 LVANNAGKRQRIGPSCDKCRSKKIKCDA 239
           L+   + K +R   +CD+CR KKIKCD 
Sbjct: 48  LMPTASTKVKRFSQACDRCRLKKIKCDG 75

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
           cerevisiae YGL013c PDR1 transcription factor,
           hypothetical start
          Length = 1107

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 16/21 (76%)

Query: 219 KRQRIGPSCDKCRSKKIKCDA 239
           +R ++G +CD CR +KIKC+ 
Sbjct: 23  RRTKVGKACDSCRRRKIKCNG 43

>YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein
           involved in salt tolerance, has similarity to
           transcription factors, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [3093 bp, 1030 aa]
          Length = 1030

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 21/31 (67%)

Query: 208 STSDLVANNAGKRQRIGPSCDKCRSKKIKCD 238
           +++D+  +    ++R+  +CD CR +KI+CD
Sbjct: 117 NSNDMSGSGKNLKKRVSKACDHCRKRKIRCD 147

>AGL083W [4228] [Homologous to ScYKL038W (RGT1) - SH; ScYBR033W
           (EDS1) - NSH] complement(550291..552861) [2571 bp, 856
           aa]
          Length = 856

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 214 ANNAGKRQRIGPSCDKCRSKKIKCDAKID 242
           A +  +R ++  +CD+CR KKIKC+ + D
Sbjct: 33  AGDGRRRTKVSRACDQCRRKKIKCEYQED 61

>KLLA0F02750g complement(250368..253814) some similarities with
           sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
           transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 33.1 bits (74), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 10/19 (52%), Positives = 16/19 (84%)

Query: 220 RQRIGPSCDKCRSKKIKCD 238
           ++R+  +CD+CR +KIKCD
Sbjct: 27  KKRVSKACDRCRRRKIKCD 45

>Scas_637.7
          Length = 998

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 1/23 (4%)

Query: 220 RQRIGPSCDKCRSKKIKCDAKID 242
           ++R+  +CD CR +KIKCD K+D
Sbjct: 99  KKRVSKACDHCRKRKIKCD-KVD 120

>KLLA0A09119g complement(797533..800781) weakly similar to sp|P12383
           Saccharomyces cerevisiae YGL013c PDR1 transcription
           factor, start by similarity
          Length = 1082

 Score = 32.7 bits (73), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 214 ANNAGK-RQRIGPSCDKCRSKKIKCDAKI 241
            N  GK R+++  +CD CR KKIKC   +
Sbjct: 41  GNGTGKPRRKVSRACDSCRKKKIKCSGTL 69

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
           activator of gluconeogenic genes through CSRE elements,
           activated by Snf1p kinase, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 32.3 bits (72), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 9/34 (26%)

Query: 222 RIGPSCDKCRSKKIKCD---------AKIDILCQ 246
           R   +CD+CR KKIKCD         AKID  C+
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCK 74

>Scas_625.5
          Length = 1141

 Score = 32.7 bits (73), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%)

Query: 219 KRQRIGPSCDKCRSKKIKCD 238
           KR +   +CD+CR KKIKCD
Sbjct: 67  KRTKASRACDQCRKKKIKCD 86

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
           with heme-dependent DNA-binding activity, responsible
           for heme-dependent activation of many genes [4509 bp,
           1502 aa]
          Length = 1502

 Score = 32.3 bits (72), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAKIDILCQ 246
           KR RI  SC  CR +K+KCD K+   CQ
Sbjct: 56  KRNRIPLSCTICRKRKVKCD-KLRPHCQ 82

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
           Transcription factor involved in drug-induced
           transcriptional regulation, including activation of
           multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMFGQSLHHELTKHEIETQLGQEVYSQ 278
           KR ++  SC  CR +K++CD +            M    +   LT  +   +  + +  +
Sbjct: 46  KRNKLIKSCGFCRRRKLRCDQQKP----------MCSTCISRNLTTCQYAEEFNKNIEKK 95

Query: 279 SSTFAYISKDLMSKIESREPDAKIIK 304
           ++   Y + DL+ K+E  E   +I++
Sbjct: 96  ATYGPYPNADLLKKVEELENKIRILE 121

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 32.0 bits (71), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%)

Query: 219 KRQRIGPSCDKCRSKKIKCDA 239
           +++R   +CD+CR KKIKCD 
Sbjct: 21  RQERSSQACDRCRLKKIKCDG 41

>Scas_573.4
          Length = 1478

 Score = 32.0 bits (71), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAKIDILCQ 246
           KR R+  SC  CR +K+KCD KI   CQ
Sbjct: 35  KRNRVPLSCTICRKRKVKCD-KIRPHCQ 61

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 32.0 bits (71), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 17/21 (80%)

Query: 220 RQRIGPSCDKCRSKKIKCDAK 240
           R+R+  +CD CR+KKI+C+ +
Sbjct: 74  RKRVSKACDICRAKKIRCNGE 94

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
           transcription factor, in conjunction with Pdr3p
           regulates the expression of a network of genes involved
           in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 32.0 bits (71), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 220 RQRIGPSCDKCRSKKIKCDAKI 241
           R ++  +CD CR +KIKC+ K 
Sbjct: 39  RSKVSKACDNCRKRKIKCNGKF 60

>YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein
           with similarity to transcription factors, has
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [2385 bp, 794 aa]
          Length = 794

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 18/24 (75%)

Query: 217 AGKRQRIGPSCDKCRSKKIKCDAK 240
           A ++ R+  +CD+C  KKIKC++K
Sbjct: 8   AKQKSRVTKACDRCHRKKIKCNSK 31

>Scas_669.8
          Length = 637

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 18/26 (69%)

Query: 216 NAGKRQRIGPSCDKCRSKKIKCDAKI 241
           N G+R++   +C+ C+ +K+KCD  I
Sbjct: 5   NGGERRKTPYACNVCKKRKVKCDKLI 30

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
           Saccharomyces cerevisiae YLR256w HAP1 transcription
           factor, hypothetical start
          Length = 1355

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 14/20 (70%)

Query: 219 KRQRIGPSCDKCRSKKIKCD 238
           KR RI  SC  CR +K+KCD
Sbjct: 15  KRNRIPLSCTICRKRKVKCD 34

>Sklu_2187.3 YOL022C, Contig c2187 5491-6768
          Length = 425

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 307 DKIIYFQPCTSCSRKKNTAVC--AFSKGFTRADINIFSK 343
           D+++Y   CT CSRK N+  C     K  +++D+N  S+
Sbjct: 112 DRVLYVFICTKCSRKANSIRCVRGVKKNKSKSDVNNLSE 150

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor singleton,
           hypothetical start
          Length = 1253

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 11/77 (14%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAKIDILCQD---EAVLHM-------FGQSLHHELTKHEIE 268
           KR R+  SC  CR +K+KCD K    CQ      V H+       + +    EL+K    
Sbjct: 17  KRNRVPLSCTICRKRKVKCD-KGRPQCQQCVKTGVGHLCHYMEQTWAEEAEKELSKDSEL 75

Query: 269 TQLGQEVYSQSSTFAYI 285
            QL + V S   T + +
Sbjct: 76  KQLRERVKSLEETLSKV 92

>Scas_588.11
          Length = 835

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 15/21 (71%)

Query: 218 GKRQRIGPSCDKCRSKKIKCD 238
           G++ R  P+C +CR +KI CD
Sbjct: 5   GRKMRKPPACVQCRKRKIGCD 25

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
           complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 14/19 (73%)

Query: 221 QRIGPSCDKCRSKKIKCDA 239
           +R   +CD+CR KKIKCD 
Sbjct: 23  KRSSQACDRCRLKKIKCDG 41

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 14/22 (63%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAK 240
           KRQR    C  C+ +KIKCD K
Sbjct: 20  KRQRTTVVCTNCKKRKIKCDRK 41

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
           (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 214 ANNAGKRQRIGPSCDKCRSKKIKCD 238
           A++  KR R+  SC  CR +K+KCD
Sbjct: 6   ASSKRKRNRVPLSCTICRKRKVKCD 30

>Scas_521.2
          Length = 890

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 11/16 (68%), Positives = 13/16 (81%)

Query: 226 SCDKCRSKKIKCDAKI 241
           +C +CRSKKIKCD K 
Sbjct: 40  ACKRCRSKKIKCDQKF 55

>Kwal_56.22605
          Length = 865

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%), Gaps = 1/23 (4%)

Query: 216 NAGK-RQRIGPSCDKCRSKKIKC 237
           + GK R+R+  +CD CR +KIKC
Sbjct: 17  SGGKFRKRVPKACDHCRKRKIKC 39

>YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys[6]
           zinc finger transcription factor, likely involved in
           pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 218 GKRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMFGQSLHHELTKHEIETQLGQEVYS 277
           GKR+++  SC  CR +K+KC ++   +CQ + V+    Q ++ E   + +      E++ 
Sbjct: 22  GKRRKVIKSCAFCRKRKLKC-SQARPMCQ-QCVIRKLPQCVYTEEFNYPLS---NTELFE 76

Query: 278 QSSTFAYISK 287
           Q    A + K
Sbjct: 77  QVPNVALVQK 86

>Kwal_47.17681
          Length = 854

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAKIDILC 245
           ++ R   +C+ C  +K++CDA I + C
Sbjct: 11  RKPRTNRACEVCHDRKVRCDANIRVPC 37

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 17/25 (68%)

Query: 215 NNAGKRQRIGPSCDKCRSKKIKCDA 239
           N + +R R+  +C+ C+ +KIKCD 
Sbjct: 16  NGSKQRLRVRKACEICKKRKIKCDG 40

>YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive
           transcription regulator of ARO9 and ARO10, member of the
           Zn2Cys6 transcription factor family [2853 bp, 950 aa]
          Length = 950

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 219 KRQRIGPSCDKCRSKKIKCD 238
           KR+R   +C  CRS+K+KCD
Sbjct: 17  KRRRTYQACISCRSRKVKCD 36

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (72%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAK 240
           KR+++  SC  CR +K+KCD K
Sbjct: 82  KRRKVIKSCTFCRKRKLKCDRK 103

>CAGL0F09229g complement(908186..910693) weakly similar to sp|P39961
           Saccharomyces cerevisiae YER184c, hypothetical start
          Length = 835

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 1/23 (4%)

Query: 217 AGKRQRIGPSCDKCRSKKIKCDA 239
           AGK  R+  +CD CR +K+KCD 
Sbjct: 12  AGK-DRVIRACDVCRKRKVKCDG 33

>CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces
           cerevisiae YBL066c SEF1, hypothetical start
          Length = 1098

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 13/24 (54%)

Query: 216 NAGKRQRIGPSCDKCRSKKIKCDA 239
           N G   R   SC  CR  KIKCDA
Sbjct: 76  NLGTTHRPVTSCTHCRQHKIKCDA 99

>Scas_711.31
          Length = 932

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 10/15 (66%), Positives = 13/15 (86%)

Query: 226 SCDKCRSKKIKCDAK 240
           +CD+CR KKIKCD +
Sbjct: 44  ACDRCRLKKIKCDDR 58

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor,
           hypothetical start
          Length = 1372

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 20/40 (50%)

Query: 199 FNTMASNIKSTSDLVANNAGKRQRIGPSCDKCRSKKIKCD 238
            N   SNIK+          KR R+  SC  CR +K+KCD
Sbjct: 43  MNKNTSNIKNKEKEKEKVKRKRNRVPLSCTICRRRKVKCD 82

>KLLA0C14212g complement(1229219..1232341) some similarities with
           sp|P25611 Saccharomyces cerevisiae YCR106w, hypothetical
           start
          Length = 1040

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 5/29 (17%)

Query: 215 NNAG-----KRQRIGPSCDKCRSKKIKCD 238
           NNAG     KR R+   C  CR +K +CD
Sbjct: 58  NNAGNKRVMKRNRVSYVCYACRRRKTRCD 86

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAK 240
           KR R+   C +CR +KIKCD +
Sbjct: 17  KRNRLSFVCLECRRRKIKCDKQ 38

>Scas_603.14*
          Length = 259

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 20/93 (21%)

Query: 216 NAGKRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMFGQSLHHELTKHEIETQLGQEV 275
           NA  + +  PSC   R K           C+D+A   + G  L H++   E  T+L    
Sbjct: 178 NANPQSQRAPSCYNVRKK-----------CKDQANNRLTGSLLAHKIADEEDATELEW-- 224

Query: 276 YSQSSTFAYISKDLMSKIESREPDAKIIKHLDK 308
               STF    + +M+  ES+E    I+K LDK
Sbjct: 225 --IESTFEQYKEGIMT--ESKEA---ILKPLDK 250

>YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [1641 bp, 546 aa]
          Length = 546

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAK 240
           KRQR+  +C  CR +K KC+ K
Sbjct: 12  KRQRVRKACVPCRERKRKCNGK 33

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (72%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAK 240
           KR+++  SC  CR +K+KCD K
Sbjct: 11  KRRKVIKSCLFCRKRKLKCDHK 32

>Scas_518.5
          Length = 919

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 205 NIKSTSDLVANNAGKRQRIGPSCDKCRSKKIKCDAKIDILCQ 246
           N  + +D        ++R+  +CD CR +K+KC    DI+ Q
Sbjct: 97  NETNVTDQYGEGKESKKRVLKACDYCRKRKVKCG---DIIAQ 135

>Kwal_26.8109
          Length = 970

 Score = 29.3 bits (64), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 14/20 (70%)

Query: 219 KRQRIGPSCDKCRSKKIKCD 238
           +R +   +CD+CR KK +CD
Sbjct: 31  RRSKTSRACDQCRGKKTRCD 50

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 28.9 bits (63), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 15/24 (62%)

Query: 216 NAGKRQRIGPSCDKCRSKKIKCDA 239
           N   R R+  +C+ C+ +K+KCD 
Sbjct: 76  NGKGRLRVQKACELCKKRKVKCDG 99

>Scas_709.65*
          Length = 651

 Score = 28.9 bits (63), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 15/20 (75%)

Query: 219 KRQRIGPSCDKCRSKKIKCD 238
           KR++   +CD+C  ++IKCD
Sbjct: 36  KRKKASRACDQCHHRRIKCD 55

>Scas_630.14
          Length = 701

 Score = 28.9 bits (63), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 2/34 (5%)

Query: 219 KRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLH 252
           KR R+  SC  CR +K KCD +I   C    VLH
Sbjct: 18  KRNRVPKSCTVCRLRKSKCD-RIKPYCS-SCVLH 49

>Scas_638.14
          Length = 1043

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 6/44 (13%)

Query: 203 ASNIKSTSDL-VANNAGKRQR-----IGPSCDKCRSKKIKCDAK 240
            S +  T DL   N+  KR R     +  +CD CR +KIKC  K
Sbjct: 18  GSQLCETPDLHNTNSKDKRVRKPTNKVSKACDNCRKRKIKCTGK 61

>KLLA0A02585g complement(226562..227674) some similarities with
           ca|CA5890|CaFCR1 Candida albicans Zinc cluster
           transcription factor, hypothetical start
          Length = 370

 Score = 28.5 bits (62), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 9/21 (42%), Positives = 14/21 (66%)

Query: 220 RQRIGPSCDKCRSKKIKCDAK 240
           ++R+  +CD CR  K KCD +
Sbjct: 15  KRRVSKACDACRKSKTKCDGE 35

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.129    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,127,026
Number of extensions: 268887
Number of successful extensions: 999
Number of sequences better than 10.0: 80
Number of HSP's gapped: 986
Number of HSP's successfully gapped: 83
Length of query: 360
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 257
Effective length of database: 13,030,455
Effective search space: 3348826935
Effective search space used: 3348826935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)