Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L09251g28227811991e-168
Scas_576.8d35777910.002
YPR005C (HAL1)29483730.26
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L09251g
         (278 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L09251g complement(1001979..1002827) no similarity, hypothe...   466   e-168
Scas_576.8d                                                            40   0.002
YPR005C (HAL1) [5441] chr16 complement(565782..566666) Protein i...    33   0.26 

>CAGL0L09251g complement(1001979..1002827) no similarity,
           hypothetical start
          Length = 282

 Score =  466 bits (1199), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 231/278 (83%), Positives = 231/278 (83%)

Query: 1   MSLDGIINGYTVLNLNHSSDRFSIYNAKDRNGSPCLLKVCHDGGSKQTAYKQATSDAMLE 60
           MSLDGIINGYTVLNLNHSSDRFSIYNAKDRNGSPCLLKVCHDGGSKQTAYKQATSDAMLE
Sbjct: 1   MSLDGIINGYTVLNLNHSSDRFSIYNAKDRNGSPCLLKVCHDGGSKQTAYKQATSDAMLE 60

Query: 61  SFIYNNNGEEIQCYIFPTSTLDYFTCNQSSNPTKSHQSRLKTLKSGIRYELLKTPTPDGG 120
           SFIYNNNGEEIQCYIFPTSTLDYFTCNQSSNPTKSHQSRLKTLKSGIRYELLKTPTPDGG
Sbjct: 61  SFIYNNNGEEIQCYIFPTSTLDYFTCNQSSNPTKSHQSRLKTLKSGIRYELLKTPTPDGG 120

Query: 121 MQFACHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNIIVHD 180
           MQFACH                                               VNIIVHD
Sbjct: 121 MQFACHSSDDCDDDDNDDDDDDEEEEEEEEEEEEEEEELENSDSDSDEDEDLEVNIIVHD 180

Query: 181 DIAKCPLEPILNSKNQPNAELEYIHTSQEHIHFVNNPVLQRVCHRQHRPIVRTPVPKSCP 240
           DIAKCPLEPILNSKNQPNAELEYIHTSQEHIHFVNNPVLQRVCHRQHRPIVRTPVPKSCP
Sbjct: 181 DIAKCPLEPILNSKNQPNAELEYIHTSQEHIHFVNNPVLQRVCHRQHRPIVRTPVPKSCP 240

Query: 241 AYHDGVQDNIQQKKLSCQKGQFELQMLQSSMLKRRSTS 278
           AYHDGVQDNIQQKKLSCQKGQFELQMLQSSMLKRRSTS
Sbjct: 241 AYHDGVQDNIQQKKLSCQKGQFELQMLQSSMLKRRSTS 278

>Scas_576.8d
          Length = 357

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 205 HTSQEHIHFVNNPVLQRVCHRQHRPIVRTPVPKSCPAYHDGVQDNIQQKKL----SCQKG 260
           H   EH+H + +P+       +   I +TP+P S       ++ N     L    S  K 
Sbjct: 279 HYKHEHVH-IKSPLQTAFHSNRLSTIPKTPIPISFAEASKVIKPNSMAPDLTKTNSTGKV 337

Query: 261 QFELQMLQSSMLKRRST 277
            FEL+MLQSSMLKRR++
Sbjct: 338 NFELKMLQSSMLKRRNS 354

 Score = 32.0 bits (71), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 7  INGYTVLNLNHSSDRFSIYNAKDRNGSPCLLKV 39
          +NGYTV NL   +D +  Y+A D NG+  +LKV
Sbjct: 13 VNGYTVKNLICKTDVYQAYDAVDCNGTCYVLKV 45

>YPR005C (HAL1) [5441] chr16 complement(565782..566666) Protein
           involved in ion homeostasis [885 bp, 294 aa]
          Length = 294

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 16/83 (19%)

Query: 209 EHIHFVNNPVLQRVCHRQHRPIVRTPVPKS-------CPAYHDGVQDNIQQKKLSCQKGQ 261
           +HI  VN     ++ H  H+ IV+TP+PKS       CP     ++     + L  +  Q
Sbjct: 212 KHISIVNPS--SKIYHSSHKQIVKTPIPKSGLSPIERCPFNGQNIK-CYSPRPLDHESPQ 268

Query: 262 ------FELQMLQSSMLKRRSTS 278
                 F+L++L+SS+L+RR ++
Sbjct: 269 RDFNNNFQLRILKSSVLQRRQST 291

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.132    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,053,113
Number of extensions: 320205
Number of successful extensions: 810
Number of sequences better than 10.0: 7
Number of HSP's gapped: 809
Number of HSP's successfully gapped: 9
Length of query: 278
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 178
Effective length of database: 13,134,309
Effective search space: 2337907002
Effective search space used: 2337907002
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)