Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L07524g1371356713e-92
Kwal_23.6466103742594.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L07524g
         (135 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L07524g complement(828912..829325) no similarity, hypotheti...   263   3e-92
Kwal_23.6466                                                           27   4.8  

>CAGL0L07524g complement(828912..829325) no similarity, hypothetical
           start
          Length = 137

 Score =  263 bits (671), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 128/135 (94%), Positives = 128/135 (94%)

Query: 1   MSRSNNDYKNSAGGNGGDLWKSASITVKNNNQNFSFHLICTGCCLGSLLSSMILESHAVV 60
           MSRSNNDYKNSAGGNGGDLWKSASITVKNNNQNFSFHLICTGCCLGSLLSSMILESHAVV
Sbjct: 1   MSRSNNDYKNSAGGNGGDLWKSASITVKNNNQNFSFHLICTGCCLGSLLSSMILESHAVV 60

Query: 61  LEEKTVGLVWRPDISAIKIGHGDSTDWHVQKVFFACSFXXXXXXXVWNNSFKFLFFCQIH 120
           LEEKTVGLVWRPDISAIKIGHGDSTDWHVQKVFFACSF       VWNNSFKFLFFCQIH
Sbjct: 61  LEEKTVGLVWRPDISAIKIGHGDSTDWHVQKVFFACSFKKEKKKKVWNNSFKFLFFCQIH 120

Query: 121 KFHCKMPYYCNSTWL 135
           KFHCKMPYYCNSTWL
Sbjct: 121 KFHCKMPYYCNSTWL 135

>Kwal_23.6466
          Length = 1037

 Score = 27.3 bits (59), Expect = 4.8,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 21/42 (50%)

Query: 45  LGSLLSSMILESHAVVLEEKTVGLVWRPDISAIKIGHGDSTD 86
           LGS+ S +I   H   +EE+  G  W   +   K+  G +TD
Sbjct: 928 LGSIKSPLIENYHMGFMEERRAGEKWPTAVFLYKLTQGIATD 969

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.136    0.465 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,628,715
Number of extensions: 165467
Number of successful extensions: 476
Number of sequences better than 10.0: 2
Number of HSP's gapped: 476
Number of HSP's successfully gapped: 2
Length of query: 135
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 44
Effective length of database: 13,445,871
Effective search space: 591618324
Effective search space used: 591618324
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 56 (26.2 bits)