Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L07502g228954003e-48
YBR067C (TIP1)210742321e-23
Scas_718.43214752191e-21
Scas_643.2252761818e-16
Sklu_2257.2231741632e-13
CAGL0C03872g255731535e-12
Scas_436.1216761516e-12
YIL011W (TIR3)269741537e-12
CAGL0H09614g236731421e-10
CAGL0H09592g236731421e-10
CAGL0F01485g337771371e-09
YOR009W (TIR4)487781301e-08
CAGL0F01463g221761244e-08
Scas_614.13737751255e-08
Scas_717.7247741192e-07
YEL049W (PAU2)120751115e-07
YGR294W120751107e-07
YBR301W (DAN3)120751107e-07
Scas_614.12224751147e-07
YER011W (TIR1)254761131e-06
YFL020C (PAU5)122751072e-06
YOL161C120751063e-06
YJL223C (PAU1)120751063e-06
YIL176C120751063e-06
YOR010C (TIR2)251761103e-06
YNR076W (PAU6)120751054e-06
YLL064C120751054e-06
YLR461W (PAU4)120751044e-06
YDR542W120751045e-06
YGL261C120751045e-06
YAL068C120751045e-06
YHL046C120751045e-06
Scas_692.28*218751075e-06
YLR037C (DAN2)124751029e-06
YIR041W124751021e-05
YLL025W124751021e-05
YKL224C123751011e-05
YMR325W124751011e-05
YCR104W (PAU3)124751011e-05
YPL282C164751013e-05
YOR394W164751013e-05
YJR150C (DAN1)29874998e-05
Scas_692.28d14875932e-04
YJR151C (DAN4)116170900.002
CAGL0C00209g43777750.12
CAGL0G10175g57777750.14
Scas_692.1942974690.73
YBL108C-A4220601.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L07502g
         (225 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L07502g complement(826383..827069) similar to sp|P33890 Sac...   158   3e-48
YBR067C (TIP1) [257] chr2 complement(372063..372695) Cold- and h...    94   1e-23
Scas_718.43                                                            89   1e-21
Scas_643.2                                                             74   8e-16
Sklu_2257.2 YIL011W, Contig c2257 1749-2444                            67   2e-13
CAGL0C03872g complement(379501..380268) similar to sp|P40552 Sac...    64   5e-12
Scas_436.1                                                             63   6e-12
YIL011W (TIR3) [2653] chr9 (333724..334533) Member of the seripa...    64   7e-12
CAGL0H09614g complement(939286..939996) highly similar to sp|P10...    59   1e-10
CAGL0H09592g 937859..938569 highly similar to sp|P10863 Saccharo...    59   1e-10
CAGL0F01485g complement(151321..152334) similar to sp|P10863 Sac...    57   1e-09
YOR009W (TIR4) [4824] chr15 (344334..345797) Member of the serip...    55   1e-08
CAGL0F01463g 149905..150570 similar to sp|P10863 Saccharomyces c...    52   4e-08
Scas_614.13                                                            53   5e-08
Scas_717.7                                                             50   2e-07
YEL049W (PAU2) [1379] chr5 (63728..64090) Member of the seripaup...    47   5e-07
YGR294W (YGR294W) [2236] chr7 (1080311..1080673) Protein with st...    47   7e-07
YBR301W (DAN3) [477] chr2 (809013..809375) Protein with strong s...    47   7e-07
Scas_614.12                                                            49   7e-07
YER011W (TIR1) [1434] chr5 (175247..176011) Stress-induced cell ...    48   1e-06
YFL020C (PAU5) [1663] chr6 complement(99225..99593) Member of th...    46   2e-06
YOL161C (YOL161C) [4664] chr15 complement(11548..11910) Member o...    45   3e-06
YJL223C (PAU1) [2708] chr10 complement(8776..9138) Member of the...    45   3e-06
YIL176C (YIL176C) [2504] chr9 complement(8793..9155) Member of t...    45   3e-06
YOR010C (TIR2) [4825] chr15 complement(346194..346949) Cold-shoc...    47   3e-06
YNR076W (PAU6) [4659] chr14 (781915..782277) Protein with strong...    45   4e-06
YLL064C (YLL064C) [3360] chr12 complement(13083..13445) Protein ...    45   4e-06
YLR461W (PAU4) [3834] chr12 (1062916..1063278) Member of the ser...    45   4e-06
YDR542W (YDR542W) [1351] chr4 (1523230..1523592) Protein with st...    45   5e-06
YGL261C (YGL261C) [1739] chr7 complement(6290..6652) Protein wit...    45   5e-06
YAL068C (YAL068C) [1] chr1 complement(1807..2169) Protein possib...    45   5e-06
YHL046C (YHL046C) [2243] chr8 complement(11921..12283) Member of...    45   5e-06
Scas_692.28*                                                           46   5e-06
YLR037C (DAN2) [3455] chr12 complement(222686..223060) Member of...    44   9e-06
YIR041W (YIR041W) [2704] chr9 (433925..434299) Protein with stro...    44   1e-05
YLL025W (YLL025W) [3394] chr12 (94746..95120) Protein with stron...    44   1e-05
YKL224C (YKL224C) [3052] chr11 complement(1811..2182) Protein wi...    44   1e-05
YMR325W (YMR325W) [4277] chr13 (922639..923013) Protein with ver...    44   1e-05
YCR104W (PAU3) [625] chr3 (307797..308171) Protein involved in t...    44   1e-05
YPL282C (YPL282C) [5169] chr16 complement(7933..8427) Protein wi...    44   3e-05
YOR394W (YOR394W) [5166] chr15 (1082714..1083208) Protein with h...    44   3e-05
YJR150C (DAN1) [3041] chr10 complement(708726..709622) Cell wall...    43   8e-05
Scas_692.28d                                                           40   2e-04
YJR151C (DAN4) [3042] chr10 complement(712170..715655) Member of...    39   0.002
CAGL0C00209g complement(11626..12939) some similarities with sp|...    33   0.12 
CAGL0G10175g 977483..979216 some similarities with sp|P47179 Sac...    33   0.14 
Scas_692.19                                                            31   0.73 
YBL108C-A (YBL108C-A) [95] chr2 complement(7605..7733) Protein o...    28   1.0  

>CAGL0L07502g complement(826383..827069) similar to sp|P33890
          Saccharomyces cerevisiae YOR010c TIR2 or sp|P27654
          Saccharomyces cerevisiae YBR067c TIP1, start by
          similarity
          Length = 228

 Score =  158 bits (400), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 78/95 (82%)

Query: 1  MSKFXXXXXXXXXXXXXXXXXVEVAEIQVLVNDINSNLAQYLSLETNPDSGFQIPDNLLS 60
          MSKF                 VEVAEIQVLVNDINSNLAQYLSLETNPDSGFQIPDNLLS
Sbjct: 1  MSKFAVLIAAIAATLVNAQNAVEVAEIQVLVNDINSNLAQYLSLETNPDSGFQIPDNLLS 60

Query: 61 LYRNVATYTDDSFSTLLSGVNFDEITSTIVGLPWY 95
          LYRNVATYTDDSFSTLLSGVNFDEITSTIVGLPWY
Sbjct: 61 LYRNVATYTDDSFSTLLSGVNFDEITSTIVGLPWY 95

>YBR067C (TIP1) [257] chr2 complement(372063..372695) Cold- and
          heat-shock induced mannoprotein of the cell wall,
          member of the seripauperin (PAU) family [633 bp, 210
          aa]
          Length = 210

 Score = 94.0 bits (232), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 1/74 (1%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLETNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGVN 81
           E AE+Q ++ DINS+L+ YL LET  +SGFQIP ++LS+Y+ V TYTDD+++TL S ++
Sbjct: 24 AETAELQAIIGDINSHLSDYLGLETG-NSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELD 82

Query: 82 FDEITSTIVGLPWY 95
          FD IT TIV LPWY
Sbjct: 83 FDAITKTIVKLPWY 96

>Scas_718.43
          Length = 214

 Score = 89.0 bits (219), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 58/75 (77%), Gaps = 3/75 (4%)

Query: 23 EVAEIQVLVNDINSNLAQYLSLETNPDSGFQIPDNLLSLYRNVATYT--DDSFSTLLSGV 80
          + AE+Q ++ DINS+L++YL L+T  +SGFQIP ++L +Y+ V TY   DDS++TL S +
Sbjct: 25 QTAELQAIIEDINSHLSEYLGLQTG-NSGFQIPADVLKVYQQVMTYKAGDDSYTTLFSEL 83

Query: 81 NFDEITSTIVGLPWY 95
          NFDEIT TIV LPWY
Sbjct: 84 NFDEITQTIVKLPWY 98

>Scas_643.2
          Length = 252

 Score = 74.3 bits (181), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 53/76 (69%), Gaps = 3/76 (3%)

Query: 23 EVAEIQVLVNDINSNLAQYLSLETNPDSGFQI---PDNLLSLYRNVATYTDDSFSTLLSG 79
          +VAE+ VL+ D++SNLA Y+SL T P +GF +   P  +LS+   +AT TDDS++++ S 
Sbjct: 22 QVAELSVLLQDVSSNLADYMSLATTPGTGFSLEDMPSGVLSIGMALATATDDSYTSMYSE 81

Query: 80 VNFDEITSTIVGLPWY 95
          V+F  I+S +  LPWY
Sbjct: 82 VDFAGISSMLTELPWY 97

>Sklu_2257.2 YIL011W, Contig c2257 1749-2444
          Length = 231

 Score = 67.4 bits (163), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 52/74 (70%), Gaps = 3/74 (4%)

Query: 23 EVAEIQVLVNDINSNLAQYLSLE-TNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGVN 81
          +V EIQ+L++D++++L+ Y+SL   NPD  F IP  +L +Y  + TYTDDS+++L S ++
Sbjct: 20 DVQEIQLLLSDVSNHLSDYISLAYNNPD--FSIPSGVLGVYEQMTTYTDDSYTSLFSQID 77

Query: 82 FDEITSTIVGLPWY 95
             +++ +  LPWY
Sbjct: 78 MTAVSTIVTALPWY 91

>CAGL0C03872g complement(379501..380268) similar to sp|P40552
          Saccharomyces cerevisiae YIL011w TIR3, start by
          similarity
          Length = 255

 Score = 63.5 bits (153), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 23 EVAEIQVLVNDINSNLAQYLSLETNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGVNF 82
          E++E  V+++D+  +L  Y+S   N D  F +PD++L LY  + T TDDS++T+   +NF
Sbjct: 26 EISEFNVILSDVMGHLTDYISYAEN-DPNFTLPDHVLDLYMAMTTATDDSYTTMYDQINF 84

Query: 83 DEITSTIVGLPWY 95
           ++T  +  LPWY
Sbjct: 85 SQVTDAMTRLPWY 97

>Scas_436.1
          Length = 216

 Score = 62.8 bits (151), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 3/76 (3%)

Query: 23 EVAEIQVLVNDINSNLAQYLSLETNPDSGF---QIPDNLLSLYRNVATYTDDSFSTLLSG 79
          ++AE+ VL+ D++SNL  Y+SL T P +GF    +P  +LS+   +A  TD S++++ S 
Sbjct: 22 QIAELNVLLQDVSSNLGDYMSLATTPGTGFTLDDMPAGVLSIGMALAGATDHSYTSMYSE 81

Query: 80 VNFDEITSTIVGLPWY 95
          V+   ++S +  LPWY
Sbjct: 82 VDMAGVSSMLTQLPWY 97

>YIL011W (TIR3) [2653] chr9 (333724..334533) Member of the
          seripauperin (PAU) family of possible cell wall
          mannoproteins [810 bp, 269 aa]
          Length = 269

 Score = 63.5 bits (153), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 50/74 (67%), Gaps = 3/74 (4%)

Query: 23 EVAEIQVLVNDINSNLAQYLSLETN-PDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGVN 81
          E+ E   ++ D+ +NL QY+SL  N PD  F +P  +L +Y+++ T TDDS+++  + ++
Sbjct: 28 EIVEFDAILADVKANLEQYMSLAMNNPD--FTLPSGVLDVYQHMTTATDDSYTSYFTEMD 85

Query: 82 FDEITSTIVGLPWY 95
          F +IT+ +V +PWY
Sbjct: 86 FAQITTAMVQVPWY 99

>CAGL0H09614g complement(939286..939996) highly similar to
          sp|P10863 Saccharomyces cerevisiae YER011w TIR1 or
          sp|P33890 Saccharomyces cerevisiae YOR010c TIR2, start
          by similarity
          Length = 236

 Score = 59.3 bits (142), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 47/73 (64%), Gaps = 3/73 (4%)

Query: 26 EIQVLVNDINSNLAQYLSLETNPDSGF---QIPDNLLSLYRNVATYTDDSFSTLLSGVNF 82
          E+ V+++D+ SNL+ Y+SL  +P SG     +P  +L+L   +A+ TDDS++TL   ++F
Sbjct: 27 ELNVILDDVKSNLSSYMSLVQDPSSGITLANLPAGVLNLGMALASATDDSYTTLYKDIDF 86

Query: 83 DEITSTIVGLPWY 95
          D I   +  LPWY
Sbjct: 87 DGIVPFLSKLPWY 99

>CAGL0H09592g 937859..938569 highly similar to sp|P10863
          Saccharomyces cerevisiae YER011w TIR1 or sp|P33890
          Saccharomyces cerevisiae YOR010c TIR2, start by
          similarity
          Length = 236

 Score = 59.3 bits (142), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 47/73 (64%), Gaps = 3/73 (4%)

Query: 26 EIQVLVNDINSNLAQYLSLETNPDSGF---QIPDNLLSLYRNVATYTDDSFSTLLSGVNF 82
          E+ V+++D+ SNL+ Y+SL  +P SG     +P  +L+L   +A+ TDDS++TL   ++F
Sbjct: 27 ELNVILDDVKSNLSSYMSLVQDPSSGITLANLPAGVLNLGMALASATDDSYTTLYKDIDF 86

Query: 83 DEITSTIVGLPWY 95
          D I   +  LPWY
Sbjct: 87 DGIVPFLSKLPWY 99

>CAGL0F01485g complement(151321..152334) similar to sp|P10863
           Saccharomyces cerevisiae YER011w TIR1 or tr|Q12218
           Saccharomyces cerevisiae YOR009w, hypothetical start
          Length = 337

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 48/77 (62%), Gaps = 3/77 (3%)

Query: 22  VEVAEIQVLVNDINSNLAQYLSLETNPDSGFQ---IPDNLLSLYRNVATYTDDSFSTLLS 78
           +++AE+  ++ D+ +NL  Y++L  +P+SGF    +P  L+ L   V T TDDS++++ S
Sbjct: 24  MQLAELNAVMEDLKTNLQDYMNLAMDPNSGFSLADMPSGLIQLGMAVGTATDDSYTSMYS 83

Query: 79  GVNFDEITSTIVGLPWY 95
            V+F  +   +  +PWY
Sbjct: 84  DVDFAGVDKMVTMVPWY 100

>YOR009W (TIR4) [4824] chr15 (344334..345797) Member of the
          seripauperin (PAU) family of possible cell wall
          mannoproteins [1464 bp, 487 aa]
          Length = 487

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 49/78 (62%), Gaps = 4/78 (5%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLETNPDSGF---QIPDNLLSLYRN-VATYTDDSFSTLL 77
           ++ E+ V+++D+ +N+A Y++L   P+SGF   Q+P  ++ +    VA  +DDS++TL 
Sbjct: 22 AQINELNVVLDDVKTNIADYITLSYTPNSGFSLDQMPAGIMDIAAQLVANPSDDSYTTLY 81

Query: 78 SGVNFDEITSTIVGLPWY 95
          S V+F  +   +  +PWY
Sbjct: 82 SEVDFSAVEHMLTMVPWY 99

>CAGL0F01463g 149905..150570 similar to sp|P10863 Saccharomyces
          cerevisiae YER011w TIR1, start by similarity
          Length = 221

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 3/76 (3%)

Query: 23 EVAEIQVLVNDINSNLAQYLSLETNPDSGFQ---IPDNLLSLYRNVATYTDDSFSTLLSG 79
          ++AE+  ++ D +S+L+ Y  L  NP+SG     +P  +L L   + T TD S+++L   
Sbjct: 24 QLAELNAILQDFSSHLSDYTGLLANPNSGITAADLPAGVLQLGLAIQTATDKSYTSLYPS 83

Query: 80 VNFDEITSTIVGLPWY 95
          V+F  I + +  LPWY
Sbjct: 84 VDFKGIEALLPKLPWY 99

>Scas_614.13
          Length = 737

 Score = 52.8 bits (125), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 49/75 (65%), Gaps = 5/75 (6%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLETNPDSGFQIPDNLLSLYRNVATYTDD-SFSTLLSGV 80
           E AE+QV++ D+N NL  Y++L T   SGF +PDN++ +Y  +   TD  S++TL + +
Sbjct: 24 AENAELQVVLADVNDNLGNYMNLLT--VSGFTLPDNIIDIY--IGMGTDPVSYTTLFTEL 79

Query: 81 NFDEITSTIVGLPWY 95
          +  +I++ +  LPWY
Sbjct: 80 DMGQISAMLTWLPWY 94

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 49/75 (65%), Gaps = 5/75 (6%)

Query: 22  VEVAEIQVLVNDINSNLAQYLSLETNPDSGFQIPDNLLSLYRNVATYTDD-SFSTLLSGV 80
            E AE+QV++ D+N NL  Y++L T   SGF +PDN++++Y  +    D  S++TL + +
Sbjct: 362 AENAELQVVLADVNDNLGNYMNLLT--VSGFSLPDNIVNVYMGMG--ADPVSYTTLFTEL 417

Query: 81  NFDEITSTIVGLPWY 95
           +  +I++ +  LPWY
Sbjct: 418 DMGQISAMLTWLPWY 432

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 49/75 (65%), Gaps = 5/75 (6%)

Query: 22  VEVAEIQVLVNDINSNLAQYLSLETNPDSGFQIPDNLLSLYRNVATYTDD-SFSTLLSGV 80
            E AE+QV++ D+N NL  Y++L T   SGF +PDN++++Y  +    D  S++TL + +
Sbjct: 204 AENAELQVVLADVNDNLGNYMNLLT--VSGFSLPDNIVNVYFGMG--ADPVSYTTLFTEL 259

Query: 81  NFDEITSTIVGLPWY 95
           +  +I++ +  LPWY
Sbjct: 260 DMGQISAMLTWLPWY 274

>Scas_717.7
          Length = 247

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 50/74 (67%), Gaps = 3/74 (4%)

Query: 23 EVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGVN 81
          EVAE   ++ D+ ++L  Y+SL   NPD  F IP  +LS+Y  + TYTDD++++L S ++
Sbjct: 24 EVAEFNAILVDVQAHLEDYMSLAMNNPD--FTIPSGVLSVYEELTTYTDDTYTSLFSAID 81

Query: 82 FDEITSTIVGLPWY 95
          F ++T+ +  +PWY
Sbjct: 82 FAQVTTVMHQVPWY 95

>YEL049W (PAU2) [1379] chr5 (63728..64090) Member of the
          seripauperin (PAU) family [363 bp, 120 aa]
          Length = 120

 Score = 47.4 bits (111), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V+DI ++LAQY S +  +P   + I      +   V  Y D  F+T+L+G+
Sbjct: 31 VNLVELGVYVSDIRAHLAQYYSFQAAHPTETYPI-----EVAEAVFNYGD--FTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
            D++T  I G+PWY
Sbjct: 84 APDQVTRMITGVPWY 98

>YGR294W (YGR294W) [2236] chr7 (1080311..1080673) Protein with
          strong similarity to S. cerevisiae Pau5p, which is
          involved in phosphatidylinositol binding, member of the
          seripauperin and TIP1 family [363 bp, 120 aa]
          Length = 120

 Score = 47.0 bits (110), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V+DI ++LAQY S +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 31 VNLVELGVYVSDIRAHLAQYYSFQAAHPTETYPV-----EIAEAVFNYGD--FTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
            D++T  I G+PWY
Sbjct: 84 APDQVTRMITGVPWY 98

>YBR301W (DAN3) [477] chr2 (809013..809375) Protein with strong
          similarity to S. cerevisiae Pau5p, which is involved in
          phosphatidylinositiol binding, member of the
          seripauperin and TIP1 family [363 bp, 120 aa]
          Length = 120

 Score = 47.0 bits (110), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLE-TNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V+DI ++LAQY S +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 31 VNLVELGVYVSDIRAHLAQYYSFQVAHPTETYPV-----EIAEAVFNYGD--FTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
            D++T  I G+PWY
Sbjct: 84 APDQVTRMITGVPWY 98

>Scas_614.12
          Length = 224

 Score = 48.5 bits (114), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 7/75 (9%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSL-ETNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V DI +N+  YLS+ + NP+  +       ++         D F+T+L+G+
Sbjct: 30 VNLIELSVYVKDIRANMNDYLSMAKANPNQAYP------AIIATAVMGKGDDFTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
          + DE+T  + G+PWY
Sbjct: 84 SGDEVTMMLTGVPWY 98

>YER011W (TIR1) [1434] chr5 (175247..176011) Stress-induced cell
          wall mannoprotein, member of the seripauperin (PAU)
          family [765 bp, 254 aa]
          Length = 254

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 50/76 (65%), Gaps = 3/76 (3%)

Query: 23 EVAEIQVLVNDINSNLAQYLSLETNPDSGFQ---IPDNLLSLYRNVATYTDDSFSTLLSG 79
          ++ E+ V++ND+ S+L +Y+SL ++  SGF    +P  +L +   +A+ TDDS++TL S 
Sbjct: 23 QINELNVILNDVKSHLQEYISLASDSSSGFSLSSMPAGVLDIGMALASATDDSYTTLYSE 82

Query: 80 VNFDEITSTIVGLPWY 95
          V+F  ++  +  +PWY
Sbjct: 83 VDFAGVSKMLTMVPWY 98

>YFL020C (PAU5) [1663] chr6 complement(99225..99593) Member of the
           seripauperin (PAU) family [369 bp, 122 aa]
          Length = 122

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 8/75 (10%)

Query: 22  VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
           V + E+ V V+DI ++LA+Y S +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 33  VNLVELGVYVSDIRAHLAEYYSFQAAHPTETYPV-----EIAEAVFNYGD--FTTMLTGI 85

Query: 81  NFDEITSTIVGLPWY 95
             D++T  I G+PWY
Sbjct: 86  PADQVTRVITGVPWY 100

>YOL161C (YOL161C) [4664] chr15 complement(11548..11910) Member of
          the seripauperin (PAU) family; subtelomerically-encoded
          [363 bp, 120 aa]
          Length = 120

 Score = 45.4 bits (106), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V+DI ++LAQY   +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 31 VNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPV-----EVAEAVFNYGD--FTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
          + D++T  I G+PWY
Sbjct: 84 SPDQVTRMITGVPWY 98

>YJL223C (PAU1) [2708] chr10 complement(8776..9138) Member of the
          seripauperin (PAU) family (PAU1 and YIL176C code for
          identical proteins) [363 bp, 120 aa]
          Length = 120

 Score = 45.4 bits (106), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V+DI ++LAQY   +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 31 VNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPV-----EVAEAVFNYGD--FTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
          + D++T  I G+PWY
Sbjct: 84 SPDQVTRMITGVPWY 98

>YIL176C (YIL176C) [2504] chr9 complement(8793..9155) Member of
          the seripauperin (PAU) family (PAU1 and YIL176C code
          for identical proteins) [363 bp, 120 aa]
          Length = 120

 Score = 45.4 bits (106), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V+DI ++LAQY   +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 31 VNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPV-----EVAEAVFNYGD--FTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
          + D++T  I G+PWY
Sbjct: 84 SPDQVTRMITGVPWY 98

>YOR010C (TIR2) [4825] chr15 complement(346194..346949) Cold-shock
          induced protein, member of the seripauperin (PAU)
          family [756 bp, 251 aa]
          Length = 251

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 23 EVAEIQVLVNDINSNLAQYLSLETNPDSGFQIPD---NLLSLYRNVATYTDDSFSTLLSG 79
          E+ E+ V++ND+ SNL +Y+SL  +  SGF +      +L +   +A+ TDDS++TL S 
Sbjct: 23 EIDELNVILNDVKSNLQEYISLAEDSSSGFSLSSLPSGVLDIGLALASATDDSYTTLYSE 82

Query: 80 VNFDEITSTIVGLPWY 95
          V+F  ++  +  +PWY
Sbjct: 83 VDFAAVSKMLTMVPWY 98

>YNR076W (PAU6) [4659] chr14 (781915..782277) Protein with strong
          similarity to S. cerevisiae Pau5p, which is involved in
          phosphatidylinositol binding, member of the
          seripauperin and TIP1 family [363 bp, 120 aa]
          Length = 120

 Score = 45.1 bits (105), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V+DI ++LAQY   +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 31 VNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPV-----EVAEAVFNYGD--FTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
            D++T  I G+PWY
Sbjct: 84 APDQVTRMITGVPWY 98

>YLL064C (YLL064C) [3360] chr12 complement(13083..13445) Protein
          with strong similarity to S. cerevisiae Pau5p, which is
          a phosphatidylinositol binding protein, member of the
          seripauperin and TIP1 family [363 bp, 120 aa]
          Length = 120

 Score = 45.1 bits (105), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V+DI ++LAQY   +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 31 VNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPV-----EVAEAVFNYGD--FTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
            D++T  I G+PWY
Sbjct: 84 APDQVTRMITGVPWY 98

>YLR461W (PAU4) [3834] chr12 (1062916..1063278) Member of the
          seripauperin (PAU) family [363 bp, 120 aa]
          Length = 120

 Score = 44.7 bits (104), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V+DI ++LAQY   +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 31 VNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPV-----EVAEAVFNYGD--FTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
            D++T  I G+PWY
Sbjct: 84 APDQVTRMITGVPWY 98

>YDR542W (YDR542W) [1351] chr4 (1523230..1523592) Protein with
          strong similarity to S. cerevisiae Pau5p, which binds
          phosphatidylinositol, member of the seripauperin and
          TIP1 family [363 bp, 120 aa]
          Length = 120

 Score = 44.7 bits (104), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V+DI ++LAQY   +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 31 VNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPV-----EVAEAVFNYGD--FTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
            D++T  I G+PWY
Sbjct: 84 APDQVTRMITGVPWY 98

>YGL261C (YGL261C) [1739] chr7 complement(6290..6652) Protein with
          strong similarity to S. cerevisiae Pau5p, which is
          involved in phosphatidylinositol binding, member of the
          seripauperin and TIP1 family [363 bp, 120 aa]
          Length = 120

 Score = 44.7 bits (104), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V+DI ++LAQY   +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 31 VNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPV-----EVAEAVFNYGD--FTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
            D++T  I G+PWY
Sbjct: 84 APDQVTRMITGVPWY 98

>YAL068C (YAL068C) [1] chr1 complement(1807..2169) Protein
          possibly required for full induction of IME1 during
          early meiosis [363 bp, 120 aa]
          Length = 120

 Score = 44.7 bits (104), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V+DI ++LAQY   +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 31 VNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPV-----EVAEAVFNYGD--FTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
            D++T  I G+PWY
Sbjct: 84 APDQVTRMITGVPWY 98

>YHL046C (YHL046C) [2243] chr8 complement(11921..12283) Member of
          the seripauperin (PAU) family [363 bp, 120 aa]
          Length = 120

 Score = 44.7 bits (104), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V V+DI ++LAQY   +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 31 VNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPV-----EVAEAVFNYGD--FTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
            D++T  I G+PWY
Sbjct: 84 APDQVTRMITGVPWY 98

>Scas_692.28*
          Length = 218

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 8/75 (10%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
          V + E+ V VNDI +NL  Y ++   +P+  +  PD + S     A + D  F+T+L+G+
Sbjct: 31 VNLIELAVYVNDIKANLNDYFAMAAAHPEQAY--PDIIAS-----AVFGDADFTTMLTGI 83

Query: 81 NFDEITSTIVGLPWY 95
             E+TS + G+ WY
Sbjct: 84 EPAEVTSMLTGVAWY 98

>YLR037C (DAN2) [3455] chr12 complement(222686..223060) Member of
           the seripauperin (PAU) family [375 bp, 124 aa]
          Length = 124

 Score = 43.9 bits (102), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22  VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
           V + E+ V V+DI ++LA+Y   +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 34  VNLVELGVYVSDIRAHLAEYYMFQAAHPTETYPV-----EIAEAVFNYGD--FTTMLTGI 86

Query: 81  NFDEITSTIVGLPWY 95
             D++T  I G+PWY
Sbjct: 87  PADQVTRVITGVPWY 101

>YIR041W (YIR041W) [2704] chr9 (433925..434299) Protein with strong
           similarity to S. cerevisiae Pau5p, which is involved in
           phosphatidylinositol binding, member of the seripauperin
           and TIP1 family [375 bp, 124 aa]
          Length = 124

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22  VEVAEIQVLVNDINSNLAQY-LSLETNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
           V + E+ V V+DI ++LAQY L    +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 34  VNLVELGVYVSDIRAHLAQYYLFQAAHPSETYPV-----EIAEAVFNYGD--FTTMLTGI 86

Query: 81  NFDEITSTIVGLPWY 95
             +++T  I G+PWY
Sbjct: 87  PAEQVTRVITGVPWY 101

>YLL025W (YLL025W) [3394] chr12 (94746..95120) Protein with strong
           similarity to S. cerevisiae Yir041p, which is involved
           in phosphatidylinositol-3,4,5-triphosphate binding,
           member of the seripauperin and TIP1 family [375 bp, 124
           aa]
          Length = 124

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22  VEVAEIQVLVNDINSNLAQYLSLET-NPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
           V + E+ V V+DI ++LA+Y   +  +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 34  VNLVELGVYVSDIRAHLAEYYMFQAAHPTETYPV-----EIAEAVFNYGD--FTTMLTGI 86

Query: 81  NFDEITSTIVGLPWY 95
             D++T  I G+PWY
Sbjct: 87  PADQVTRVITGVPWY 101

>YKL224C (YKL224C) [3052] chr11 complement(1811..2182) Protein with
           very strong similarity to S. cerevisiae Yir041p, which
           is involved in phosphatidylinositol-3,4,5-triphosphate
           binding, member of the seripauperin and TIP1 family [372
           bp, 123 aa]
          Length = 123

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22  VEVAEIQVLVNDINSNLAQY-LSLETNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
           V + E+ V V+DI ++LAQY L    +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 34  VNLVELGVYVSDIRAHLAQYYLFQAAHPSETYPV-----EIAEAVFNYGD--FTTMLTGI 86

Query: 81  NFDEITSTIVGLPWY 95
             +++T  I G+PWY
Sbjct: 87  PAEQVTRVITGVPWY 101

>YMR325W (YMR325W) [4277] chr13 (922639..923013) Protein with very
           strong similarity to S. cerevisiae Yir041p, which binds
           phosphatidylinositol-3,4,5-triphosphate, member of the
           seripauperin and TIP1 family [375 bp, 124 aa]
          Length = 124

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22  VEVAEIQVLVNDINSNLAQY-LSLETNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
           V + E+ V V+DI ++LAQY L    +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 34  VNLVELGVYVSDIRAHLAQYYLFQAAHPTETYPV-----EIAEAVFNYGD--FTTMLTGI 86

Query: 81  NFDEITSTIVGLPWY 95
             +++T  I G+PWY
Sbjct: 87  PAEQVTRVITGVPWY 101

>YCR104W (PAU3) [625] chr3 (307797..308171) Protein involved in the
           response to rapamycin, member of the seripauperin and
           TIP1 family, has very strong similarity to S. cerevisiae
           Yir041p [375 bp, 124 aa]
          Length = 124

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22  VEVAEIQVLVNDINSNLAQY-LSLETNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
           V + E+ V V+DI ++LAQY L    +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 34  VNLVELGVYVSDIRAHLAQYYLFQAAHPTETYPV-----EIAEAVFNYGD--FTTMLTGI 86

Query: 81  NFDEITSTIVGLPWY 95
             +++T  I G+PWY
Sbjct: 87  PAEQVTRVITGVPWY 101

>YPL282C (YPL282C) [5169] chr16 complement(7933..8427) Protein with
           high similarity to S. cerevisiae Yir041wp, member of the
           seripauperin and TIP1 family [495 bp, 164 aa]
          Length = 164

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22  VEVAEIQVLVNDINSNLAQY-LSLETNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
           V + E+ V V+DI ++LAQY L    +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 74  VNLVELGVYVSDIRAHLAQYYLFQAAHPTETYPV-----EIAEAVFNYGD--FTTMLTGI 126

Query: 81  NFDEITSTIVGLPWY 95
             +++T  I G+PWY
Sbjct: 127 PAEQVTRVITGVPWY 141

>YOR394W (YOR394W) [5166] chr15 (1082714..1083208) Protein with high
           similarity to S. cerevisiae Yir041p, which is involved
           in phosphatidylinositol-3,4,5-triphosphate binding,
           member of the seripauperin and TIP1 family [495 bp, 164
           aa]
          Length = 164

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 22  VEVAEIQVLVNDINSNLAQY-LSLETNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
           V + E+ V V+DI ++LAQY L    +P   + +      +   V  Y D  F+T+L+G+
Sbjct: 74  VNLVELGVYVSDIRAHLAQYYLFQAAHPTETYPV-----EIAEAVFNYGD--FTTMLTGI 126

Query: 81  NFDEITSTIVGLPWY 95
             +++T  I G+PWY
Sbjct: 127 PAEQVTRVITGVPWY 141

>YJR150C (DAN1) [3041] chr10 complement(708726..709622) Cell wall
           mannoprotein induced during anaerobic growth, member of
           the seripauperin (PAU) family of possible cell wall
           mannoproteins [897 bp, 298 aa]
          Length = 298

 Score = 42.7 bits (99), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 22  VEVAEIQVLVNDINSNLAQYLSLETNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGVN 81
           V + E+ V V+DI ++L++Y + +    +    P+   +++          F+T+L+G++
Sbjct: 33  VNLIELAVYVSDIGAHLSEYYAFQALHKTETYPPEIAKAVFAG------GDFTTMLTGIS 86

Query: 82  FDEITSTIVGLPWY 95
            DE+T  I G+PWY
Sbjct: 87  GDEVTRMITGVPWY 100

>Scas_692.28d
          Length = 148

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 5/75 (6%)

Query: 22  VEVAEIQVLVNDINSNLAQYLSLE-TNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGV 80
           V + E+ V V+DI S++  YL ++  NP   +  PD + +   +   Y++D F+TL   +
Sbjct: 31  VNLIELAVYVHDIKSHMLDYLKMQMANPSQKY--PDIIETAVLH--NYSNDDFTTLFLDI 86

Query: 81  NFDEITSTIVGLPWY 95
           +  E+TS + G+ WY
Sbjct: 87  DGAEVTSMLTGVSWY 101

>YJR151C (DAN4) [3042] chr10 complement(712170..715655) Member of
           the seripauperin (PAU) family of possible cell wall
           mannoproteins [3486 bp, 1161 aa]
          Length = 1161

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 6/70 (8%)

Query: 26  EIQVLVNDINSNLAQYLSLETNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGVNFDEI 85
           E+ V V+DI +++ QY S   N       P  + +   +   Y D  F+T L+G++ DE+
Sbjct: 37  ELAVYVSDIRAHIFQYYSFR-NHHKTETYPSEIAAAVFD---YGD--FTTRLTGISGDEV 90

Query: 86  TSTIVGLPWY 95
           T  I G+PWY
Sbjct: 91  TRMITGVPWY 100

>CAGL0C00209g complement(11626..12939) some similarities with
          sp|P47179 Saccharomyces cerevisiae YJR151c,
          hypothetical start
          Length = 437

 Score = 33.5 bits (75), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 14/77 (18%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLE-TNPDSGFQIPDNLLS--LYRNVATYTDDSFSTLLS 78
          V + E+Q  + DI  ++ QYLS +  +PD  +  P  ++   ++ N +          LS
Sbjct: 32 VNMIELQAYLADIKGHMMQYLSFQGAHPDQPY--PSQMIGAVMFGNTSP---------LS 80

Query: 79 GVNFDEITSTIVGLPWY 95
           +  + IT  I G+PWY
Sbjct: 81 EIAPETITMMITGVPWY 97

>CAGL0G10175g 977483..979216 some similarities with sp|P47179
          Saccharomyces cerevisiae YJR151c, hypothetical start
          Length = 577

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 14/77 (18%)

Query: 22 VEVAEIQVLVNDINSNLAQYLSLE-TNPDSGFQIPDNLLS--LYRNVATYTDDSFSTLLS 78
          V + E+Q  + DI  ++ QYLS +  NP+  +  P  +L   ++ N            LS
Sbjct: 33 VNMIELQAYLADIKGHMMQYLSFQGANPNQPY--PSQMLGAVMFGNTG---------PLS 81

Query: 79 GVNFDEITSTIVGLPWY 95
           +  + IT  I G+PWY
Sbjct: 82 EIAPETITMMITGVPWY 98

>Scas_692.19
          Length = 429

 Score = 31.2 bits (69), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 9/74 (12%)

Query: 26 EIQVLVNDINSNLAQYLSLE-TNPDSGF--QIPDNLLSLYRNVATYTDDS-FSTLLSGVN 81
          E+ V V DI +    YLS++  NP   +  ++P  +L+     A   D S F+TL S + 
Sbjct: 3  ELMVYVKDIVAYRDDYLSMQKANPAMPYPAEMPRAVLA-----AIMGDKSKFTTLFSTIP 57

Query: 82 FDEITSTIVGLPWY 95
            E+   + G+PWY
Sbjct: 58 ATEVDFMVTGVPWY 71

>YBL108C-A (YBL108C-A) [95] chr2 complement(7605..7733) Protein of
          unknown function, has strong similarity to a region of
          S. cerevisiae Pau5p, which binds phosphatidylinositol
          [129 bp, 42 aa]
          Length = 42

 Score = 27.7 bits (60), Expect = 1.0,   Method: Composition-based stats.
 Identities = 9/20 (45%), Positives = 15/20 (75%)

Query: 76 LLSGVNFDEITSTIVGLPWY 95
          +L+G+  D++T  I G+PWY
Sbjct: 1  MLTGIAPDQVTRMITGVPWY 20

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,584,568
Number of extensions: 91793
Number of successful extensions: 422
Number of sequences better than 10.0: 49
Number of HSP's gapped: 380
Number of HSP's successfully gapped: 51
Length of query: 225
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 127
Effective length of database: 13,203,545
Effective search space: 1676850215
Effective search space used: 1676850215
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 59 (27.3 bits)