Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L07480g31430914080.0
YBR066C (NRG2)2201012974e-32
Scas_718.44266612935e-31
Kwal_27.10925264622901e-30
YDR043C (NRG1)231682872e-30
Sklu_2357.7157612742e-29
CAGL0K12078g463662791e-27
AGR031W140622557e-27
Scas_569.2293842632e-26
KLLA0F18524g357612451e-23
YER028C394681543e-11
CAGL0M01870g315621506e-11
YGL035C (MIG1)504611519e-11
Kwal_14.2278463591454e-10
KLLA0E10989g474551454e-10
CAGL0A01628g424561445e-10
Scas_575.3455561411e-09
AFR471C389591411e-09
Sklu_2351.6548561402e-09
Scas_712.42*290561354e-09
YGL209W (MIG2)382621365e-09
CAGL0C02519g318681347e-09
CAGL0K09372g396581358e-09
KLLA0B00605g239601283e-08
Scas_687.33288561284e-08
CAGL0H04213g1321661305e-08
Kwal_47.19045266551275e-08
Scas_718.36d330671276e-08
Kwal_56.23453828651279e-08
CAGL0L11880g980501271e-07
YMR037C (MSN2)704771271e-07
KLLA0C17710g821651261e-07
Scas_709.32822641261e-07
Sklu_2398.2288591241e-07
AGR117C799551252e-07
Scas_681.19864551233e-07
YER169W (RPH1)796501224e-07
AGL207W277571195e-07
YML081W1251671216e-07
Kwal_47.166211178611216e-07
Sklu_2443.22213801167e-07
YDR096W (GIS1)894501199e-07
Kwal_26.8011190541131e-06
YOR113W (AZF1)914561181e-06
Scas_602.9547591171e-06
Scas_697.35839551172e-06
AFR580C838581153e-06
CAGL0K02145g317531133e-06
KLLA0B04477g13321221153e-06
KLLA0F23782g782651153e-06
Kwal_47.17888786651153e-06
AER159C1191611144e-06
YNL027W (CRZ1)678661135e-06
Kwal_26.8351698611136e-06
Scas_717.18354591117e-06
Sklu_2181.1410611118e-06
CAGL0L06072g300761108e-06
ABR089C571611119e-06
ADR308C278601091e-05
KLLA0B07909g922581111e-05
YJR127C (ZMS1)1380991111e-05
Scas_649.28730541091e-05
Kwal_14.2206254581072e-05
ACR264W769651092e-05
YPL230W391441072e-05
KLLA0F11682g374561072e-05
Scas_695.2571631082e-05
YPR015C2471001062e-05
Scas_683.25879601082e-05
ACL057W520531073e-05
Scas_703.231341561083e-05
CAGL0L03916g642551073e-05
KLLA0E08679g596771073e-05
KLLA0A04609g423751063e-05
Scas_717.17d350671053e-05
YDR216W (ADR1)1323511074e-05
Kwal_23.5400429411054e-05
Kwal_27.10467302621044e-05
CAGL0E04884g1489511064e-05
KLLA0F20636g2851151045e-05
Scas_721.921152511065e-05
Scas_707.46338621045e-05
CAGL0M06831g645681055e-05
KLLA0F13046g1379511055e-05
YKL062W (MSN4)630541046e-05
Kwal_47.17241403611046e-05
YPR013C317801036e-05
Sklu_2436.9517721037e-05
CAGL0M00594g1020671048e-05
ADL051W17353998e-05
YGR067C794551039e-05
YER130C443531021e-04
Scas_627.612071061021e-04
AGR172W1057511021e-04
Kwal_27.11460531661011e-04
CAGL0M13189g541761011e-04
KLLA0F26961g694611011e-04
CAGL0F05995g597541012e-04
AEL278W47641992e-04
Scas_720.3331664983e-04
CAGL0K04631g101354993e-04
ADL198W54777993e-04
AFR461C54485983e-04
ADL042W28152973e-04
KLLA0B03454g47241974e-04
CAGL0G10021g39478965e-04
AFL136W40944965e-04
Scas_717.1752556965e-04
Sklu_2389.276752975e-04
KLLA0F01463g78154967e-04
YPR186C (PZF1)42941957e-04
CAGL0L05786g34856948e-04
Scas_719.68135061950.001
KLLA0C17072g47453940.001
ADL050W14651900.001
Scas_602.4d25655920.001
Scas_710.950567930.001
YMR182C (RGM1)21144910.001
CAGL0E04312g688112930.002
Scas_707.3128959910.002
AGL197W844128920.002
CAGL0H07557g47661920.002
Scas_712.232768910.002
CAGL0E06116g61351910.003
CAGL0K06413g35978900.003
Sklu_1527.1205100880.003
CAGL0J01595g34471890.003
KLLA0F10109g62370900.004
CAGL0G08107g62550890.004
Scas_602.426686870.005
CAGL0I02816g29155870.005
YDR253C (MET32)19150850.007
Kwal_47.1833753665870.007
Scas_660.1236768860.009
Kwal_14.254371154870.009
AEL077W33655860.009
CAGL0K03003g64751860.009
Kwal_56.2392574551860.009
Scas_656.1*10261800.009
YDR146C (SWI5)70951860.011
CAGL0L00583g38841850.011
YDR463W (STP1)51970850.012
Sklu_2244.327156840.012
Scas_641.2453266850.014
KLLA0C16005g33144840.015
KLLA0A10373g20666820.017
YHR006W (STP2)54167840.018
Scas_378.120849820.019
YMR070W (MOT3)49056830.020
YDL048C (STP4)49072820.028
YPR022C113358830.029
CAGL0E01331g68951820.032
CAGL0M04323g70350810.040
Sklu_2359.572256810.047
YPL038W (MET31)17750780.049
YJL056C (ZAP1)88074800.051
Scas_631.743341800.054
Scas_711.5683254800.057
AGL246W22755780.064
Kwal_47.1657788148790.074
CAGL0J05060g71355790.075
AFR531W27459760.11
CAGL0L12562g223133750.13
Scas_568.519956750.13
Sklu_2289.129161750.18
Kwal_26.930030462740.22
Scas_713.5262055750.24
Scas_683.3047862740.29
ADL040W33088710.50
AEL174W66154720.56
Kwal_34.1594627959710.56
Scas_670.243561710.66
KLLA0E18645g43156710.67
Scas_721.5619955690.77
YLR131C (ACE2)77052700.95
KLLA0D16456g85472701.0
Scas_693.3163538691.1
Sklu_2206.2358112691.1
AGL071C39651681.3
CAGL0K02343g116233681.7
Scas_604.458548681.7
AGR186C28755671.8
KLLA0E13519g23029662.0
Kwal_26.802150750672.0
Kwal_27.1182419959652.1
AEL054C47760662.7
Kwal_23.4090205077663.0
CAGL0K04697g51568653.1
KLLA0F07073g55877653.3
KLLA0C03564g139987663.4
Kwal_23.5526378102643.8
KLLA0D11902g28955643.9
Sklu_2154.319059634.1
AFR588W31927644.3
AAL016C1478100645.2
Kwal_27.1016728590635.2
YLR375W34362626.4
Sklu_1899.395235636.5
Sklu_2254.460287636.5
YKR048C (NAP1)41747636.5
Scas_717.60d16748617.1
KLLA0E00726g51756627.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L07480g
         (309 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L07480g complement(822240..823184) some similarities with s...   546   0.0  
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...   119   4e-32
Scas_718.44                                                           117   5e-31
Kwal_27.10925                                                         116   1e-30
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...   115   2e-30
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement       110   2e-29
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...   112   1e-27
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...   102   7e-27
Scas_569.2                                                            105   2e-26
KLLA0F18524g complement(1701498..1702571) some similarities with...    99   1e-23
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    64   3e-11
CAGL0M01870g complement(219813..220760) some similarities with t...    62   6e-11
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    63   9e-11
Kwal_14.2278                                                           60   4e-10
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    60   4e-10
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    60   5e-10
Scas_575.3                                                             59   1e-09
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    59   1e-09
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       59   2e-09
Scas_712.42*                                                           57   4e-09
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    57   5e-09
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    56   7e-09
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    57   8e-09
KLLA0B00605g complement(46736..47455) some similarities with sp|...    54   3e-08
Scas_687.33                                                            54   4e-08
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    55   5e-08
Kwal_47.19045                                                          54   5e-08
Scas_718.36d                                                           54   6e-08
Kwal_56.23453                                                          54   9e-08
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...    54   1e-07
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    54   1e-07
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...    53   1e-07
Scas_709.32                                                            53   1e-07
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                52   1e-07
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...    53   2e-07
Scas_681.19                                                            52   3e-07
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...    52   4e-07
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    50   5e-07
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    51   6e-07
Kwal_47.16621                                                          51   6e-07
Sklu_2443.22 , Contig c2443 45390-46027                                49   7e-07
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...    50   9e-07
Kwal_26.8011                                                           48   1e-06
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    50   1e-06
Scas_602.9                                                             50   1e-06
Scas_697.35                                                            50   2e-06
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    49   3e-06
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    48   3e-06
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    49   3e-06
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    49   3e-06
Kwal_47.17888                                                          49   3e-06
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    49   4e-06
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    48   5e-06
Kwal_26.8351                                                           48   6e-06
Scas_717.18                                                            47   7e-06
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            47   8e-06
CAGL0L06072g complement(679924..680826) some similarities with s...    47   8e-06
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    47   9e-06
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    47   1e-05
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    47   1e-05
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    47   1e-05
Scas_649.28                                                            47   1e-05
Kwal_14.2206                                                           46   2e-05
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    47   2e-05
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    46   2e-05
KLLA0F11682g complement(1068992..1070116) some similarities with...    46   2e-05
Scas_695.2                                                             46   2e-05
YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...    45   2e-05
Scas_683.25                                                            46   2e-05
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    46   3e-05
Scas_703.23                                                            46   3e-05
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    46   3e-05
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    46   3e-05
KLLA0A04609g complement(411494..412765) some similarities with s...    45   3e-05
Scas_717.17d                                                           45   3e-05
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    46   4e-05
Kwal_23.5400                                                           45   4e-05
Kwal_27.10467                                                          45   4e-05
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    45   4e-05
KLLA0F20636g complement(1914452..1915309) some similarities with...    45   5e-05
Scas_721.92                                                            45   5e-05
Scas_707.46                                                            45   5e-05
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    45   5e-05
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    45   5e-05
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    45   6e-05
Kwal_47.17241                                                          45   6e-05
YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...    44   6e-05
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          44   7e-05
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    45   8e-05
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    43   8e-05
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    44   9e-05
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    44   1e-04
Scas_627.6                                                             44   1e-04
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    44   1e-04
Kwal_27.11460                                                          44   1e-04
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    44   1e-04
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    44   1e-04
CAGL0F05995g complement(598819..600612) some similarities with s...    44   2e-04
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    43   2e-04
Scas_720.33                                                            42   3e-04
CAGL0K04631g complement(440721..443762) some similarities with s...    43   3e-04
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    43   3e-04
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    42   3e-04
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    42   3e-04
KLLA0B03454g complement(314015..315433) some similarities with s...    42   4e-04
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    42   5e-04
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    42   5e-04
Scas_717.17                                                            42   5e-04
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            42   5e-04
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    42   7e-04
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    41   7e-04
CAGL0L05786g complement(636176..637222) some similarities with t...    41   8e-04
Scas_719.68                                                            41   0.001
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    41   0.001
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    39   0.001
Scas_602.4d                                                            40   0.001
Scas_710.9                                                             40   0.001
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    40   0.001
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    40   0.002
Scas_707.31                                                            40   0.002
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    40   0.002
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    40   0.002
Scas_712.2                                                             40   0.002
CAGL0E06116g complement(604708..606549) some similarities with t...    40   0.003
CAGL0K06413g 627811..628890 some similarities with sp|Q00947 Sac...    39   0.003
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             39   0.003
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...    39   0.003
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    39   0.004
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    39   0.004
Scas_602.4                                                             38   0.005
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    38   0.005
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    37   0.007
Kwal_47.18337                                                          38   0.007
Scas_660.12                                                            38   0.009
Kwal_14.2543                                                           38   0.009
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    38   0.009
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    38   0.009
Kwal_56.23925                                                          38   0.009
Scas_656.1*                                                            35   0.009
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    38   0.011
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    37   0.011
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    37   0.012
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                37   0.012
Scas_641.24                                                            37   0.014
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    37   0.015
KLLA0A10373g complement(907244..907864) some similarities with c...    36   0.017
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    37   0.018
Scas_378.1                                                             36   0.019
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    37   0.020
YDL048C (STP4) [816] chr4 complement(366739..368211) Protein wit...    36   0.028
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    37   0.029
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    36   0.032
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    36   0.040
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          36   0.047
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    35   0.049
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    35   0.051
Scas_631.7                                                             35   0.054
Scas_711.56                                                            35   0.057
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    35   0.064
Kwal_47.16577                                                          35   0.074
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    35   0.075
AFR531W [3723] [Homologous to ScAFR531W] complement(1389487..139...    34   0.11 
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    33   0.13 
Scas_568.5                                                             33   0.13 
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          33   0.18 
Kwal_26.9300                                                           33   0.22 
Scas_713.52                                                            33   0.24 
Scas_683.30                                                            33   0.29 
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    32   0.50 
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    32   0.56 
Kwal_34.15946                                                          32   0.56 
Scas_670.2                                                             32   0.66 
KLLA0E18645g complement(1648263..1649558) some similarities with...    32   0.67 
Scas_721.56                                                            31   0.77 
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    32   0.95 
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    32   1.0  
Scas_693.31                                                            31   1.1  
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            31   1.1  
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    31   1.3  
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    31   1.7  
Scas_604.4                                                             31   1.7  
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    30   1.8  
KLLA0E13519g complement(1190615..1191307) some similarities with...    30   2.0  
Kwal_26.8021                                                           30   2.0  
Kwal_27.11824                                                          30   2.1  
AEL054C [2452] [Homologous to ScYCR024C - SH] (535735..537168) [...    30   2.7  
Kwal_23.4090                                                           30   3.0  
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    30   3.1  
KLLA0F07073g 675221..676897 some similarities with sgd|S0004367 ...    30   3.3  
KLLA0C03564g complement(323354..327553) some similarities with s...    30   3.4  
Kwal_23.5526                                                           29   3.8  
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    29   3.9  
Sklu_2154.3 , Contig c2154 4677-5249 reverse complement                29   4.1  
AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C (...    29   4.3  
AAL016C [171] [Homologous to ScYCL014W (BUD3) - SH] (311460..315...    29   5.2  
Kwal_27.10167                                                          29   5.2  
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    28   6.4  
Sklu_1899.3 YFL034W, Contig c1899 4517-7375 reverse complement         29   6.5  
Sklu_2254.4 YDR501W, Contig c2254 4846-6654                            29   6.5  
YKR048C (NAP1) [3299] chr11 complement(525029..526282) Nucleosom...    29   6.5  
Scas_717.60d                                                           28   7.1  
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    28   7.5  

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/309 (88%), Positives = 272/309 (88%)

Query: 1   MYLTAPMYSPSATSTMNIQKVVSQLNVNEQNNILLPSLATCGTHLKSNTDDDMKLLLNKF 60
           MYLTAPMYSPSATSTMNIQKVVSQLNVNEQNNILLPSLATCGTHLKSNTDDDMKLLLNKF
Sbjct: 1   MYLTAPMYSPSATSTMNIQKVVSQLNVNEQNNILLPSLATCGTHLKSNTDDDMKLLLNKF 60

Query: 61  AFHNSNYFLQXXXXXXXXXXXXXXXXXXXXXXXMXXXXXXXXXXXXXXFKLDSESPNNIV 120
           AFHNSNYFLQ                       M              FKLDSESPNNIV
Sbjct: 61  AFHNSNYFLQPTIHTSNSSSASSTAVSSPVVAPMLQNSLPSPSLSPQQFKLDSESPNNIV 120

Query: 121 PPKIVVEEADQIQESPKPKRVKRRTKSASSMKKAPIKVVFDSSNSHNMSTEAIVNGVPSP 180
           PPKIVVEEADQIQESPKPKRVKRRTKSASSMKKAPIKVVFDSSNSHNMSTEAIVNGVPSP
Sbjct: 121 PPKIVVEEADQIQESPKPKRVKRRTKSASSMKKAPIKVVFDSSNSHNMSTEAIVNGVPSP 180

Query: 181 ATSPKPKRKNSTGTMSRSPFKTFNGCLNVNGKQDKKVLLGHISKPSNKVYSNRSSVIKLK 240
           ATSPKPKRKNSTGTMSRSPFKTFNGCLNVNGKQDKKVLLGHISKPSNKVYSNRSSVIKLK
Sbjct: 181 ATSPKPKRKNSTGTMSRSPFKTFNGCLNVNGKQDKKVLLGHISKPSNKVYSNRSSVIKLK 240

Query: 241 DNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           DNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH
Sbjct: 241 DNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300

Query: 301 YRTHSKKKE 309
           YRTHSKKKE
Sbjct: 301 YRTHSKKKE 309

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score =  119 bits (297), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 71/101 (70%), Gaps = 9/101 (8%)

Query: 210 NGKQDKKVLLGHISKPSNKVYSNRSSVIKLKDN-TQKIEQRRKHICQICLTGFTTSGHLS 268
           NGK D    +  ISKP+        +VIKLK   T    QR +H C+IC TGFTTSGHLS
Sbjct: 118 NGKSDPYSSI-KISKPT-------KTVIKLKSTKTNTAGQRTRHFCKICSTGFTTSGHLS 169

Query: 269 RHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKKE 309
           RH +IHTGEK+H+CPHEGC Q FSRHDNC QHYRTH+ KK+
Sbjct: 170 RHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTHANKKK 210

>Scas_718.44
          Length = 266

 Score =  117 bits (293), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (88%)

Query: 247 EQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSK 306
           + RRKH+C+IC TGFTTSGHLSRH +IHTGEK+H CP EGCNQ FSRHDNCLQHYRTH K
Sbjct: 205 QNRRKHVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLK 264

Query: 307 K 307
           K
Sbjct: 265 K 265

>Kwal_27.10925
          Length = 264

 Score =  116 bits (290), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 44/62 (70%), Positives = 57/62 (91%)

Query: 246 IEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           +EQRR+++C+IC+ GFTTSGHL+RH +IHTGEK+HVCPHEGC Q FSRHDNC+QHY+TH 
Sbjct: 195 VEQRRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTHL 254

Query: 306 KK 307
           ++
Sbjct: 255 RR 256

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score =  115 bits (287), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%)

Query: 242 NTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHY 301
           + + +EQRRK+IC+IC  GFTTSGHL+RH +IHTGEK+H CP++GC Q FSRHDNCLQHY
Sbjct: 164 DEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHY 223

Query: 302 RTHSKKKE 309
           RTH KK +
Sbjct: 224 RTHLKKGQ 231

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score =  110 bits (274), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (88%)

Query: 246 IEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           IEQRR+++C+IC  GFTTSGHL+RH +IHTGEK+HVCP EGC Q FSRHDNC+QHYRTH 
Sbjct: 94  IEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153

Query: 306 K 306
           K
Sbjct: 154 K 154

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score =  112 bits (279), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 56/66 (84%)

Query: 242 NTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHY 301
           N+  IE RRK++C++C  GFTTSGHL+RH +IHTGEK HVCP+EGC Q F+RHDNCLQHY
Sbjct: 392 NSDDIELRRKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHY 451

Query: 302 RTHSKK 307
           +TH K+
Sbjct: 452 KTHLKR 457

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score =  102 bits (255), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 44/62 (70%), Positives = 51/62 (82%)

Query: 246 IEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           +E+RRKH+CQ C  GFTTSGHL+RH +IHTGEK+H C   GC Q FSRHDNCLQHYRTH 
Sbjct: 74  VEKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133

Query: 306 KK 307
           K+
Sbjct: 134 KR 135

>Scas_569.2
          Length = 293

 Score =  105 bits (263), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 47/84 (55%), Positives = 61/84 (72%), Gaps = 5/84 (5%)

Query: 231 SNRSSVIKLKD-----NTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHE 285
           S R   I +KD     + +++E+RRK+IC++C  GFTTSGHL+RH +IHTGEK H C + 
Sbjct: 202 SKRQRAIMVKDLKKRKHEEELEKRRKYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYP 261

Query: 286 GCNQSFSRHDNCLQHYRTHSKKKE 309
           GC   FSRHDNC+QHYRTH K +E
Sbjct: 262 GCYLKFSRHDNCVQHYRTHFKVRE 285

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 99.0 bits (245), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 42/61 (68%), Positives = 49/61 (80%)

Query: 246 IEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           + +RRK+IC+IC  GFTTSGHL+RH +IHTGEK H C   GCNQ FSRHDN +QHYRTH 
Sbjct: 278 LAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHF 337

Query: 306 K 306
           K
Sbjct: 338 K 338

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (55%)

Query: 239 LKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCL 298
           L+D       +R   C+IC  GF    H  RH + HTGEK H C  +GC +SFSR D   
Sbjct: 4   LRDRFPPDNDQRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELK 63

Query: 299 QHYRTHSK 306
           +H RTH+K
Sbjct: 64  RHLRTHTK 71

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 36/62 (58%)

Query: 245 KIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           K  +  K IC++CL  F     LS H  IHTGEK + CP + C +SF+   N L+HY+ H
Sbjct: 166 KTSEDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLH 225

Query: 305 SK 306
            K
Sbjct: 226 FK 227

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 62.8 bits (151), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 33/61 (54%)

Query: 245 KIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           K E  R H C IC   F    H +RH +IHTGEK H C   GC + FSR D   +H R H
Sbjct: 31  KSEAPRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

Query: 305 S 305
           +
Sbjct: 91  T 91

>Kwal_14.2278
          Length = 463

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 32/59 (54%)

Query: 247 EQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           E  R +IC IC   F    H +RH + HTGEK H C   GC + FSR D   +H R H+
Sbjct: 18  ESPRPYICPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIHT 76

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 32/55 (58%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           R ++C IC  GF    H +RH + HTGE+ H C   GC++ FSR D   +H R H
Sbjct: 24  RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH 78

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 31/56 (55%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           R H+C IC   F    H +RH + HTGEK H C   GC + FSR D   +H R H+
Sbjct: 41  RPHVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIHT 96

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 268 SRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           S+  K     + HVCP   C ++F R ++  +H RTH+ +K
Sbjct: 31  SKAGKGDDAPRPHVCPI--CGRAFHRLEHQTRHMRTHTGEK 69

>Scas_575.3
          Length = 455

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 31/56 (55%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           R H+C IC   F    H +RH + HTGEK H C   GC + FSR D   +H R H+
Sbjct: 66  RPHVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIHT 121

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 268 SRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           SR  K     + HVCP   C ++F R ++  +H RTH+ +K
Sbjct: 56  SRANKDGDAPRPHVCPI--CQRAFHRLEHQTRHMRTHTGEK 94

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 31/59 (52%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           R ++C IC   F    H +RH + HTGEK H C   GC + FSR D   +H R H   +
Sbjct: 20  RPYVCPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIHESDR 78

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 31/56 (55%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           R ++C IC   F    H +RH + HTGEK H C   GC + FSR D   +H R H+
Sbjct: 32  RPYVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIHT 87

>Scas_712.42*
          Length = 290

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 30/56 (53%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           R   C+ C  GF    H  RH + HTGEK H C   GC + FSR D   +H RTH+
Sbjct: 16  RPFRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTHT 71

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 33/62 (53%)

Query: 248 QRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           + R   C  C  GF    H  RH + HTGEK H C   GC +SFSR D   +H RTH+ +
Sbjct: 13  ENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQ 72

Query: 308 KE 309
            +
Sbjct: 73  SQ 74

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 36/68 (52%)

Query: 237 IKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDN 296
           IK +D+      +R   C+IC  GF    H  RH + HTGEK H C    C +SFSR D 
Sbjct: 5   IKNQDSYPPDNFKRPFRCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADE 64

Query: 297 CLQHYRTH 304
             +H RTH
Sbjct: 65  LKRHSRTH 72

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 56.6 bits (135), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 32/58 (55%)

Query: 248 QRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           + R   C+ C  GF    H  RH + HTGEK H C   GC +SFSR D   +H RTH+
Sbjct: 13  KERPFKCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTHT 70

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKKE 309
           R ++C+IC   F    H +RH + HTGEK   C   GC + FSR+D   +H +TH K ++
Sbjct: 10  RPYLCEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFKSRK 69

>Scas_687.33
          Length = 288

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 29/56 (51%)

Query: 249 RRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           +R   C IC  GF    H  RH + HTGEK H C    C +SFSR D   +H R H
Sbjct: 14  QRPFRCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIH 69

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 240 KDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQ 299
           K  T K ++ R H+C IC  GF    HL RH + HT EK  +C    C + F+R D  L+
Sbjct: 21  KSRTIKTDKPRPHLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLR 78

Query: 300 H-YRTH 304
           H Y+ H
Sbjct: 79  HQYKLH 84

>Kwal_47.19045
          Length = 266

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 29/55 (52%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           R   C +C  GF    H  RH + HTGEK H C   GC + FSR D   +H RTH
Sbjct: 12  RPFKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTH 66

>Scas_718.36d
          Length = 330

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%)

Query: 238 KLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNC 297
           K++  T   +++  + C +C  GF     L  H+ I +G + + CP+  C +SF+   N 
Sbjct: 225 KVEVETSAFDEKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNM 284

Query: 298 LQHYRTH 304
           L+HY+ H
Sbjct: 285 LRHYKLH 291

>Kwal_56.23453
          Length = 828

 Score = 53.5 bits (127), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 6/65 (9%)

Query: 240 KDNTQKI---EQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHD 295
           K N+++I   ++ + ++CQ C   F++  HL+RH K +H+GEK H CP   C + F R D
Sbjct: 720 KINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRD 777

Query: 296 NCLQH 300
           + LQH
Sbjct: 778 HVLQH 782

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 252 HICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           ++CQ C   F++  HL+RH K +H+GEK H CP   C + F R D+ LQH
Sbjct: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKRFKRRDHVLQH 949

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (59%), Gaps = 6/77 (7%)

Query: 231 SNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQ 289
           S RSSV+   ++T+++E++  H C IC   F  S HL RH + +H+ E+   C    C++
Sbjct: 629 SRRSSVVI--ESTKELEEKPFH-CHICPKSFKRSEHLKRHVRSVHSNERPFAC--HICDK 683

Query: 290 SFSRHDNCLQHYRTHSK 306
            FSR DN  QH +TH K
Sbjct: 684 KFSRSDNLSQHIKTHKK 700

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (56%), Gaps = 8/65 (12%)

Query: 237 IKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHD 295
           I   D+  K+     ++CQ C   F++  HL+RH K +H+GEK H CP   C + F R D
Sbjct: 745 IMFLDDGSKV-----YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRD 797

Query: 296 NCLQH 300
           + LQH
Sbjct: 798 HVLQH 802

>Scas_709.32
          Length = 822

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 247 EQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           ++ +   C+ C   F  S HL RH + +H+ E+   CP   C++ FSR DN  QH +TH 
Sbjct: 760 DENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACP--TCDKKFSRSDNLAQHIKTHK 817

Query: 306 KKKE 309
           K+ +
Sbjct: 818 KRGD 821

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%)

Query: 251 KHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKKE 309
           +H+C  C   F     L  H+ IH G   + C   GC++ F+   N L+HYR H+KKKE
Sbjct: 217 QHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTKKKE 275

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 247 EQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           ++ + ++CQ C   F++  HL+RH K +H+GEK H CP   C + F R D+ LQH
Sbjct: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQH 779

>Scas_681.19
          Length = 864

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 247 EQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           E  + ++C  C   FT+  HL+RH K +H+GEK H CP   C + F R D+ LQH
Sbjct: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQH 812

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 252 HICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           +IC+ C   F++  HL+RH K +H+GEK H CP   C + F R D+ LQH
Sbjct: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPK--CGKRFKRRDHVLQH 756

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (57%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSK 306
           ++++C  C  GF  +  L  H  IHTG++   CP + C +SF+   N L+H++ H +
Sbjct: 181 QRYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFR 237

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 240 KDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQ 299
           K  T K ++ R  +C IC  GF    HL RH + HT EK  +C    C + F+R D  L+
Sbjct: 49  KSRTIKTDKPRPFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLR 106

Query: 300 H-YRTHS 305
           H ++ HS
Sbjct: 107 HQHKLHS 113

>Kwal_47.16621
          Length = 1178

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 240 KDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQ 299
           K  T K ++ R  +C IC  GF    HL RH + HT EK  +C    C + F+R D  L+
Sbjct: 66  KSRTIKTDRPRPFLCSICTRGFARQEHLKRHQRAHTNEKPFLCAF--CGRCFARRDLVLR 123

Query: 300 H 300
           H
Sbjct: 124 H 124

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 49.3 bits (116), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 7/80 (8%)

Query: 226 SNKVYSNRSSV-----IKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSH 280
           SN+V    S++     I  K  T K ++ R  +C IC  GF    HL RH + HT EK  
Sbjct: 17  SNEVTPTSSAIQGIMPIPRKSRTIKTDKPRPFLCPICTRGFARQEHLKRHQRSHTNEKPF 76

Query: 281 VCPHEGCNQSFSRHDNCLQH 300
           +C    C + F+R D  L+H
Sbjct: 77  LCAF--CGRCFARRDLVLRH 94

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 252 HICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           +IC+ C   F++  HL+RH K +H+GEK H CP   C + F R D+ LQH
Sbjct: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPR--CGKRFKRRDHVLQH 875

>Kwal_26.8011
          Length = 190

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%)

Query: 251 KHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           K+ CQ+CL  F+ S  L  H   HTG +   CP   C+++F+   N ++H +TH
Sbjct: 127 KYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTH 180

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 253 ICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           +C  C   FT  G+L  H ++HTGEK + C  + C++ FSR  N   H  TH K K
Sbjct: 622 VCDYCGKRFTQGGNLRTHERLHTGEKPYSC--DICDKKFSRKGNLAAHLVTHQKLK 675

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 9/103 (8%)

Query: 209 VNGKQDKKVLLGH---ISKPSNKVYSNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSG 265
           VN  QD  +L      I  P +++       ++    TQ     +KH C  C   F+ + 
Sbjct: 551 VNTTQDGDLLFNQTMDILPPKSELVGG----VEKPKGTQNTRAVKKHECPYCHRLFSQAT 606

Query: 266 HLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           HL  H + H G K  VC +  C + F++  N   H R H+ +K
Sbjct: 607 HLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEK 647

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 249 RRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
            + + C IC   F+  G+L+ H   H   K  VC  E CN++F++  N   H
Sbjct: 646 EKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 697

>Scas_602.9
          Length = 547

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 247 EQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           +  ++  C  C   F    HL RH + +H GEK + C    CN++FSR DN  QH +TH
Sbjct: 490 DATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYAC--HICNKNFSRSDNLTQHIKTH 546

>Scas_697.35
          Length = 839

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C  C   FT  G+L  H ++HTGEK + C  E C++ FSR  N   H  TH K K
Sbjct: 545 CGYCGKRFTQGGNLRTHQRLHTGEKPYEC--ELCDKKFSRKGNLAAHLLTHQKVK 597

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 247 EQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSK 306
           E  ++H C  C   F  S HL  H + H G K + C +  C + F++  N   H R H+ 
Sbjct: 510 EGSKQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLRTHQRLHTG 567

Query: 307 KK 308
           +K
Sbjct: 568 EK 569

 Score = 36.6 bits (83), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           C++C   F+  G+L+ H   H   K  +C  + CN+SF++  N   H
Sbjct: 573 CELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAH 619

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 246 IEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRT 303
           +  +RK+IC  C   F+ S H +RH + HTG K   C  + CN SF R D   +H RT
Sbjct: 2   VASQRKYICSFCAQAFSRSEHKTRHERSHTGVKPFSC--KVCNHSFVRRDLLQRHIRT 57

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 254 CQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           C+ C   F    HL RH + +H GEK + C    CN+ FSR DN  QH +THS
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYEC--HICNKKFSRSDNLNQHIKTHS 316

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 53/122 (43%), Gaps = 16/122 (13%)

Query: 180 PATSPKPKRKNST-GTMSRSPFKTFNGCLNVNGKQDKKVLLGHISKPSNKVYSNRSSVIK 238
           PATS  P  KN T  T+S +            G  DK+     + + S    S+    I 
Sbjct: 23  PATSHHPVVKNETVNTLSEA------------GSDDKEAD-TELDQDSEHAGSSGLVPIP 69

Query: 239 LKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCL 298
            K    K ++ R  +C IC  GF    HL RH + HT EK  +C    C + F+R D  L
Sbjct: 70  KKSRLIKTDRPRPFLCPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVL 127

Query: 299 QH 300
           +H
Sbjct: 128 RH 129

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 250 RKHI------CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRT 303
           R HI      C+ C   FT  G+L  H ++HTGEK + C  E C + FSR  N   H  T
Sbjct: 543 RSHIGYKPFSCEFCGKRFTQGGNLRTHIRLHTGEKPYEC--ERCGRKFSRKGNLAAHKLT 600

Query: 304 HSKKK 308
           H   K
Sbjct: 601 HDNLK 605

>Kwal_47.17888
          Length = 786

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 250 RKHI------CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRT 303
           R HI      C+ C   FT  G+L  H ++HTGEK + C  E C + FSR  N   H  T
Sbjct: 523 RSHIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLT 580

Query: 304 HSKKK 308
           H   K
Sbjct: 581 HENLK 585

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 240 KDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQ 299
           K  T K ++ R  +C +C  GF    HL RH + HT EK  +C    C + F+R D  L+
Sbjct: 68  KSRTIKTDKPRPFLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLR 125

Query: 300 H 300
           H
Sbjct: 126 H 126

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 7/66 (10%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHE-------GCNQSFSRHDNCLQHYR 302
           R  IC IC   F       RH  +HTG+K +VC  +       GC + F+R D   +H++
Sbjct: 595 RPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFK 654

Query: 303 THSKKK 308
           T S ++
Sbjct: 655 TESGRR 660

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 9/79 (11%)

Query: 237 IKLKDNTQKIE---QRRKH----ICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQ 289
           +K  DN +K++     RK+     C +C   FT   +L  H + HT E+  +C    C +
Sbjct: 547 VKKNDNLEKLDSVTNNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGK 604

Query: 290 SFSRHDNCLQHYRTHSKKK 308
           +F+R  +  +H   H+ KK
Sbjct: 605 AFARQHDRKRHEDLHTGKK 623

>Kwal_26.8351
          Length = 698

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 247 EQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           E+ +   CQ C   F  S HL RH + +H+ E+   C +  C++ FSR DN  QH +TH 
Sbjct: 636 EEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHK 693

Query: 306 K 306
           K
Sbjct: 694 K 694

>Scas_717.18
          Length = 354

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 30/59 (50%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           R H C IC    T S  L  H  IHTGEK + C    C+ S S   N  +HY++H K +
Sbjct: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 246 IEQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           ++  ++  C+ C   F    HL RH + +H GEK + C  E C + FSR DN  QH +TH
Sbjct: 348 LDASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGC--EICGKKFSRSDNLNQHIKTH 405

Query: 305 S 305
            
Sbjct: 406 G 406

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 232 NRSSVIKLKDNTQKI--EQRRKHICQICLTGFTTSGHLSRH-AKIHTGEKSHVCPHEGCN 288
           NR S+ K++     +  +  +   C +C   F    HL RH + +H GE+ + C  + C 
Sbjct: 196 NRGSIPKIRGRKPSLLFDDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSC--DICL 253

Query: 289 QSFSRHDNCLQHYRTH 304
           +SFSR DN  QH RTH
Sbjct: 254 KSFSRSDNLNQHKRTH 269

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 247 EQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           E+ +   CQ C   F  S HL RH + +H+ ++   C +  C++ FSR DN  QH +TH 
Sbjct: 499 EEEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTHR 556

Query: 306 K 306
           K
Sbjct: 557 K 557

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKKE 309
           +K++C++C         L  H   HTG++   C H GC++SF+   N L+H R HS+  E
Sbjct: 202 KKNVCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHSRGSE 261

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 246 IEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRT 303
           +  +RK+IC  C   F+ S H +RH + HTG K   C    C+ SF R D   +H RT
Sbjct: 2   VASQRKYICSFCAKPFSRSEHKARHERSHTGSKPFSC--SICSHSFVRRDLLQRHIRT 57

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 14/99 (14%)

Query: 212 KQDKKVLLGHISKPSNKVYSNRSSV----------IKLKDNTQKIEQRRKHICQICLTGF 261
           + DK  LL  + +PS  V  N+S+           I  K    K ++ R  +C  C  GF
Sbjct: 103 RADKDFLL--VPEPSMFVNGNQSNFAKPAGQGILPIPKKSRIIKTDKPRPFLCPTCTRGF 160

Query: 262 TTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
               HL RH   HT EK ++C    C + F+R D  L+H
Sbjct: 161 VRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRH 197

>Scas_649.28
          Length = 730

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 254 CQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSK 306
           C  C+  F  S HL RH + +H+ E+   C    C + FSR DN  QH +TH K
Sbjct: 675 CSECIKAFRRSEHLKRHIRSVHSSERPFAC--MFCEKKFSRSDNLSQHLKTHKK 726

>Kwal_14.2206
          Length = 254

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%)

Query: 252 HICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKKE 309
           H C+IC   F+    LS HA IHTG + + C    C + F+   N ++H + H+K ++
Sbjct: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 250 RKHI------CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRT 303
           R HI      C+ C   FT  G+L  H ++HTGE+ + C  + C + FSR  N   H  T
Sbjct: 507 RSHIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLT 564

Query: 304 HSKKK 308
           H   K
Sbjct: 565 HENYK 569

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           C   FT + HL+RH + HTGEK   CP   C + FSR DN  QH
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCP--ACLKFFSRVDNLKQH 90

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%)

Query: 251 KHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSK 306
           K+ C  C   F     LS H  IHTG+K + C +  C + F+   N L+HY+ H K
Sbjct: 303 KYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLK 358

>Scas_695.2
          Length = 571

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 253 ICQICLTGFTTSGHLSRHAKIHTGEKSHVCPH-------EGCNQSFSRHDNCLQHYRTHS 305
           +C IC   F       RH  +HTG+K +VC          GC++ F+R D   +H++T S
Sbjct: 481 VCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHFKTDS 540

Query: 306 KKK 308
            +K
Sbjct: 541 GRK 543

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 252 HICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           + C++C   FT   +L  H + HT E   VC    C ++F+R  +  +H   H+ KK
Sbjct: 452 YACELCDKTFTRPYNLKSHLRTHTNEXPFVC--NICGKAFARQHDRKRHEDLHTGKK 506

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 43/100 (43%), Gaps = 11/100 (11%)

Query: 208 NVNGKQDKKVLLGHISKPSNKVYSNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHL 267
           NV+  Q+   LL       + +     +V+KL+             C IC    +    L
Sbjct: 152 NVHIGQNPGTLLSQTQTDLDLIQKQLRAVVKLRKQ-----------CPICGKVCSRPSTL 200

Query: 268 SRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
             H  IHTG+    C  E CN+SF+   N L+H RTH KK
Sbjct: 201 RTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240

>Scas_683.25
          Length = 879

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 249 RRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           +++ IC  C  GF+ + H  RH + HTG K + C  + C   F R D  L+H +T  KK+
Sbjct: 12  QKRFICSFCAKGFSRAEHKIRHERSHTGLKPYKC--KVCTHCFVRSDLALRHIKTVHKKE 69

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 254 CQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           C+ C   F    HL RH + +H GEK + C  + C + FSR DN  QH +THS
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGC--DICGKKFSRSDNLNQHIKTHS 512

>Scas_703.23
          Length = 1341

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 245 KIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           K ++ R  +C  C  GF    HL RH + HT EK  +C    C + F+R D  L+H
Sbjct: 65  KTDKPRPFLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVF--CGRCFARRDLVLRH 118

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C+ C   FT +G+L  H ++HTGE+   C  + C+++F+R  N   H  TH   K
Sbjct: 510 CEFCGKRFTQAGNLRTHRRLHTGERPFKC--DKCDKTFARRGNLTAHEFTHESIK 562

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C  C   F+ S HL  H K H G K   C  E C + F++  N   H R H+ ++
Sbjct: 482 CAYCSKMFSQSTHLDVHIKAHMGYKPFEC--EFCGKRFTQAGNLRTHRRLHTGER 534

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 22/52 (42%)

Query: 249 RRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
            R   C  C   F   G+L+ H   H   K ++C  + C + FS+  N   H
Sbjct: 533 ERPFKCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKSH 584

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 239 LKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCP-------HEGCNQSF 291
           LK + +     R ++C +C   F      +RH  +HTG++ +VC          GC + F
Sbjct: 484 LKSHLRSHTDERPYVCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKF 543

Query: 292 SRHDNCLQHYRTHSKKK 308
           +R D   +H++T   KK
Sbjct: 544 ARSDALGRHFKTELGKK 560

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 7/95 (7%)

Query: 218 LLGHISKPSNKVYSNRSSVIKLKDNTQKIEQRRKH----ICQICLTGFTTSGHLSRHAKI 273
           L G +    +K   N  S + L   T+K +Q +KH     C IC   FT   +L  H + 
Sbjct: 432 LGGKVPNTEDKPKDNGESTLNLIGTTKK-KQAQKHPAVYACDICDKKFTRPYNLKSHLRS 490

Query: 274 HTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           HT E+ +VC    C ++F+R  +  +H   H+ K+
Sbjct: 491 HTDERPYVC--SVCGKAFARMHDKNRHEDLHTGKR 523

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 5/75 (6%)

Query: 234 SSVIKLKDNTQKIEQRRKHIC-QICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFS 292
           ++ + + D++  +++ + HIC +IC    T   HLS    IHTG+K + CP   C++ F+
Sbjct: 326 TNAMPINDSSLPLKKNQCHICGRICSRPSTLQTHLS----IHTGDKPYKCPKRNCHKRFN 381

Query: 293 RHDNCLQHYRTHSKK 307
              N L+HY+ H  K
Sbjct: 382 VKSNMLRHYKRHEFK 396

>Scas_717.17d
          Length = 350

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%)

Query: 240 KDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQ 299
           K N +K    + HIC +C    T S  L  H  IHTG +   C    C  S S   N  +
Sbjct: 273 KGNVKKRRGHKLHICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITR 332

Query: 300 HYRTHSK 306
           H+++H K
Sbjct: 333 HFKSHLK 339

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           R  +C++C   F    HL RH + HT EK + C    CN+ F+R D  ++H
Sbjct: 102 RSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDLLIRH 150

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 12/51 (23%)

Query: 258 LTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           L G T SG L          +S VC  E C ++F+R ++  +HYR+H+ +K
Sbjct: 92  LNGRTPSGKL----------RSFVC--EVCTRAFARQEHLKRHYRSHTNEK 130

>Kwal_23.5400
          Length = 429

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRH 294
           C  C  G TT   L RH   HT  +S VCPHEGC +SF +H
Sbjct: 111 CSYCGKGVTTKQQLRRHEITHT--RSFVCPHEGCEESFYKH 149

>Kwal_27.10467
          Length = 302

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%)

Query: 245 KIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           ++  + ++ C  C   F     L+ H   HTG+K + CP + C++ F+   N  +HY+ H
Sbjct: 191 RLRNQPRYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLH 250

Query: 305 SK 306
            K
Sbjct: 251 FK 252

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           R  +CQ C   F    HL+RH + HT EK + C    C++ F+R D  L+H
Sbjct: 28  RLFVCQTCTRAFARQEHLTRHERSHTKEKPYCCG--ICDRRFTRRDLLLRH 76

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 53/115 (46%), Gaps = 7/115 (6%)

Query: 190 NSTGTMSRSPFKTFNGCLNVNGKQDKKVLLGHISKPSNKVYSNRSSVIKLKDNTQKIEQR 249
            ST +    P    N C N +    +K    HIS  + + +++ ++V+K K N       
Sbjct: 177 GSTNSYYHPPLHHRNTCDNRSRPHSQKSGKQHISY-AQRHHNSPTTVVKGKANG------ 229

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           +  IC  C   FT    L  H  +H+G+K   C  EGCN+ F+   N ++H + H
Sbjct: 230 KADICAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLH 284

>Scas_721.92
          Length = 1152

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           R  +C +C   F    HL RHA+ HT EK + C    C + F+R D  L+H
Sbjct: 76  RLFVCDVCSRAFARQEHLDRHARSHTNEKPYQCG--ICTKKFTRRDLLLRH 124

>Scas_707.46
          Length = 338

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%)

Query: 246 IEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           +  R +  C +C    +    L  H  IHTG+    CP + CN+SF+   N L+H ++H 
Sbjct: 264 LASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ 323

Query: 306 KK 307
           KK
Sbjct: 324 KK 325

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 248 QRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHE-------GCNQSFSRHDNCLQH 300
             + + C IC   F       RH  +HTG+K +VC  +       GC + F+R D   +H
Sbjct: 545 DEKPYQCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRH 604

Query: 301 YRTHSKKK 308
           ++T S +K
Sbjct: 605 FKTSSGRK 612

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           R  +C++C   F    HL+RH + HT EK +VC    C + F+R D  ++H
Sbjct: 123 RLFVCKVCTRAFARQEHLTRHERSHTKEKPYVC--GICERRFTRRDLLIRH 171

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 254 CQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSK 306
           C+ C   F  S HL RH + +H+ E+   C    C + FSR DN  QH +TH K
Sbjct: 575 CKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKK 626

>Kwal_47.17241
          Length = 403

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 246 IEQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           ++  ++  C  C   F    HL RH + +H GEK   C    C + FSR DN  QH +TH
Sbjct: 340 LDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDC--HICGKKFSRSDNLNQHIKTH 397

Query: 305 S 305
           +
Sbjct: 398 T 398

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%)

Query: 229 VYSNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCN 288
           V +  ++    K +T+    + +  C +C    +    L  H  IHTG+    C  EGC 
Sbjct: 231 VLNGSATFSDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCT 290

Query: 289 QSFSRHDNCLQHYRTHSKKK 308
           +SF+   N L+H ++H +K+
Sbjct: 291 KSFNVKSNMLRHLKSHERKR 310

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 14/72 (19%)

Query: 247 EQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVC--------PHEGCNQS--FSRHDN 296
           EQR K++C  C   F   G+L+RH K H  EK++ C        P   C+ +  FSR D 
Sbjct: 157 EQRGKYVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTGGFSRRDT 216

Query: 297 CLQHYRTHSKKK 308
               Y+TH K +
Sbjct: 217 ----YKTHLKSR 224

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 236 VIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHD 295
           +I  K    K ++ R  +C IC  GF    HL RH   HT EK  +C    C + F+R D
Sbjct: 11  LIPKKSRAVKTDKPRPFLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLI--CGKCFARKD 68

Query: 296 NCLQHYR 302
             L+H +
Sbjct: 69  LVLRHLQ 75

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 42.7 bits (99), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSK 306
           C IC   FT    L  H  IHT  K + CP+  CN++F+   N  +H R H +
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIHKR 170

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 249 RRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRT 303
           ++K+IC  CL  F+ S H  RH + H G K   C  + C  SF R D   +H RT
Sbjct: 5   QKKYICSFCLKPFSRSEHKIRHERSHAGVKPFQC--QVCKHSFVRRDLLQRHIRT 57

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 254 CQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           C+ C   F    HL RH + +H  EK   C    CN++FSR DN  QH +TH+
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTC--HICNKNFSRSDNLNQHVKTHA 441

>Scas_627.6
          Length = 1207

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 50/106 (47%), Gaps = 10/106 (9%)

Query: 211 GKQDKKVLLGHISKPSNKVYSNRSSVIKLKDNTQKIEQRRKHICQ--ICLTGFTTSGHLS 268
           G   K ++   ++K  N+    R+S    K  + K+    ++IC    C   FT   HLS
Sbjct: 3   GSPSKNIIRATLNKTDNETSQRRASAPVQK--SAKLAVTERYICPHPDCNKSFTRQEHLS 60

Query: 269 RHAKIHTGEKSHVCP------HEGCNQSFSRHDNCLQHYRTHSKKK 308
           RH   H  ++  VCP      +  CN++F R D  ++H + H+K K
Sbjct: 61  RHKLNHWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRHQKRHTKSK 106

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           R  +C  C   F    HL RH + HT EK ++C    C++ FSR D  L+H
Sbjct: 47  RLFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGI--CDRRFSRRDLLLRH 95

>Kwal_27.11460
          Length = 531

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 7/66 (10%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVC-------PHEGCNQSFSRHDNCLQHYR 302
           R   C IC   F       RH  +HTG+K + C          GC + F+R D   +H++
Sbjct: 439 RPFSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFK 498

Query: 303 THSKKK 308
           T   K+
Sbjct: 499 TEGGKR 504

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 252 HICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           + C++C   FT   +L  H + HT E+   C    C ++F+R  +  +H   H+ +K
Sbjct: 413 YACELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRHEDLHTGQK 467

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 9/76 (11%)

Query: 232 NRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQS 290
           N+S  ++L D  +  +      C  C   F  S HL RH + +H+ E+   C    C + 
Sbjct: 470 NKSVSVELPDGAKPFQ------CADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKK 521

Query: 291 FSRHDNCLQHYRTHSK 306
           FSR DN  QH +TH +
Sbjct: 522 FSRSDNLSQHLKTHKR 537

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 247 EQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           E+ +   C  C   F  S HL RH + +H+ E+   C  + C++ FSR DN  QH +TH 
Sbjct: 616 EEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHC--QFCDKKFSRSDNLSQHLKTHK 673

Query: 306 K 306
           K
Sbjct: 674 K 674

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 254 CQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSK 306
           C +C   F  S HL RH + +H+ ++   C    C + FSR DN  QH +TH K
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSC--HLCEKKFSRSDNLSQHIKTHKK 588

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRH 294
           C +C  G TT   L RH   HT  KS  CPHEGC ++F +H
Sbjct: 180 CTVCGKGVTTRQQLRRHEITHT--KSFKCPHEGCGEAFYKH 218

>Scas_720.33
          Length = 316

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 243 TQKIEQRRKHICQ---ICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQ 299
           TQK  +R+   CQ    C   FT   HL+RH + HTGEK   C    C + FSR DN  Q
Sbjct: 8   TQK--ERKTFACQGYKDCHMTFTREEHLARHIRKHTGEKPFQC--YICFRFFSRMDNLKQ 63

Query: 300 HYRT 303
           H  T
Sbjct: 64  HRDT 67

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRT 303
           ++H C  C   F+ S H +RH + H G K   C  + C+ SF R D   +H RT
Sbjct: 10  KRHFCSFCNKAFSRSEHKTRHERSHAGVKPFEC--QVCSHSFVRRDLLQRHIRT 61

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 7/77 (9%)

Query: 239 LKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHE-------GCNQSF 291
           LK + +     R   C +C   F       RH  +H+G+K +VC  +       GC + F
Sbjct: 441 LKSHLRTHTDERPFSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKF 500

Query: 292 SRHDNCLQHYRTHSKKK 308
           +R D   +H++T S ++
Sbjct: 501 ARSDALGRHFKTESGRR 517

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 39/85 (45%), Gaps = 14/85 (16%)

Query: 234 SSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEK--------SHVCPHE 285
           SS  +LKD       + + +C  C   F   G+L+RH K H  EK        SHV P  
Sbjct: 134 SSAAQLKDEDGDELSKERFVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSHVPPET 193

Query: 286 GCNQS--FSRHDNCLQHYRTHSKKK 308
            C+ +  FSR D     Y+TH + +
Sbjct: 194 RCHTTGGFSRRDT----YKTHLRSR 214

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%)

Query: 253 ICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           +C+IC   F     L  H  +H  +K + C H GC + F+   N L+H R H
Sbjct: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKH 277

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRH 294
           C IC  G TT   L RH   HT  KS  C +EGCN+SF +H
Sbjct: 167 CSICGKGVTTRQQLKRHEITHT--KSFHCSYEGCNESFYKH 205

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 35/78 (44%), Gaps = 2/78 (2%)

Query: 217 VLLGHISKPSNKVYSNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTG 276
           V LG      N+  S+ +  I L+ +       R   C  C  G  T   L RH   HT 
Sbjct: 60  VHLGRKPWKCNQCESSFTKKIHLERHLYTHTDERPFYCSFCGKGLITRQQLKRHEVTHT- 118

Query: 277 EKSHVCPHEGCNQSFSRH 294
            KS  C +EGCN+SF +H
Sbjct: 119 -KSFNCEYEGCNESFYKH 135

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           C   FT + HL+RH +  TGEK   C  E CN+ FSR DN  QH
Sbjct: 28  CDRSFTRAEHLARHIRKQTGEKPSQC--EVCNRFFSRIDNLKQH 69

>Scas_717.17
          Length = 525

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 3/56 (5%)

Query: 252 HICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRT-HSK 306
           +IC IC   F     L RH   H+ E+ + CP   C     R DN LQH +  HSK
Sbjct: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCP--WCLSRHKRRDNLLQHMKLKHSK 441

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C   FT    L RH K+H+G K   CPH  C + FS  D   QH RTHS ++
Sbjct: 635 CSKSFTQRQKLLRHLKVHSGYKPFKCPH--CTKKFSTEDILQQHIRTHSGER 684

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           C  C   F TS  L  H + HTGEK   C  + C + F+   N  +H +TH +K
Sbjct: 688 CTYCTKQFATSSSLRIHIRTHTGEKPLKC--KICGKRFNESSNLSKHMKTHERK 739

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C  C   F+T   L +H + H+GE+   C +  C + F+   +   H RTH+ +K
Sbjct: 660 CPHCTKKFSTEDILQQHIRTHSGERPFKCTY--CTKQFATSSSLRIHIRTHTGEK 712

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           C +C   ++TS  L  H + HTGEK   CP   CN+ F+   N  +H RTH ++
Sbjct: 722 CHLCPKSYSTSSSLRIHIRTHTGEKPLSCP--ICNKRFNESSNLAKHIRTHKRE 773

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 5/86 (5%)

Query: 228 KVYSNRSSVIKLKDNTQKIEQRRKHICQI--CLTGFTTSGHLSRHAK---IHTGEKSHVC 282
           KV  N++   ++  + Q  E+ +  IC+   C   F ++  L+ H +   + +G  S+ C
Sbjct: 605 KVLDNKTMAKQVTAHKQLHEEPQSCICKWAGCNKEFDSAKSLNEHIENFHVPSGLSSYKC 664

Query: 283 PHEGCNQSFSRHDNCLQHYRTHSKKK 308
             EGCN+ F +    ++H + HSK K
Sbjct: 665 EWEGCNKVFVQKQKLIRHLKVHSKYK 690

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRH 294
           C  C  G TT   L RH   HT  KS +CP EGCN  F +H
Sbjct: 110 CSYCGKGVTTRQQLKRHEVTHT--KSFICPEEGCNLRFYKH 148

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKKE 309
           C +C    +    L  H  IHTG+    CP + C ++F+   N L+H + H +KK+
Sbjct: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342

>Scas_719.68
          Length = 1350

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 240 KDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQ 299
           K  T K ++ R  +C IC    T + HL RH + HT EK  VC    C + F+R D  L+
Sbjct: 29  KSRTIKTDKPRPFLCPIC----TRTEHLKRHQRSHTREKPFVCVF--CGRCFARRDLVLR 82

Query: 300 H 300
           +
Sbjct: 83  Y 83

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 254 CQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           C+ C   F    HL RH + +H  EK + C    C + FSR DN  QH +TH+
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGC--HLCGKKFSRSDNLSQHLKTHT 470

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           C +CL  FT    L+ H  IH   + ++C +  CN+SF+   N  +H R H
Sbjct: 78  CPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIH 128

>Scas_602.4d
          Length = 256

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C +C    +    L  H  IHTG+    C + GC +SF+   N  +H + H +KK
Sbjct: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251

>Scas_710.9
          Length = 505

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 244 QKIEQR-RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYR 302
           Q+++ R RK  C++C    T +  L  H  IHTG +   C   GC ++F+   N  +H +
Sbjct: 438 QELQTRKRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLK 497

Query: 303 THSKKKE 309
            H  K++
Sbjct: 498 LHLIKED 504

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           C   F  + HL+RH + HTGEK   C    C + FSR DN  QH
Sbjct: 27  CNMSFNRTEHLARHIRKHTGEKPFQC--NICLKFFSRIDNLRQH 68

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 16/112 (14%)

Query: 207 LNVNGKQDKKVLLGHISKPSNKVYSNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGH 266
           LN+N     +V +    KP + + S +    K K  T   +  ++ +C  C   F   G+
Sbjct: 155 LNINLPVQPEVQVKQEPKPVDSITSIKKDT-KAKSETLD-DDEKEFVCHYCDAKFRIRGY 212

Query: 267 LSRHAKIHTGEKSHVCP-HEG-------CNQS--FSRHDNCLQHYRTHSKKK 308
           L+RH K H  EK++ CP + G       C+ S  FSR D     Y+TH K +
Sbjct: 213 LTRHIKKHAIEKAYHCPFYNGQEVPSKRCHNSGGFSRRDT----YKTHMKAR 260

>Scas_707.31
          Length = 289

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 250 RKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           +++ C +C   F    HL RH + IH   +   C    C++ FSR+DN  QH R H ++
Sbjct: 221 KQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFEC--SVCHKRFSRNDNLNQHVRIHEQQ 277

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 58/128 (45%), Gaps = 22/128 (17%)

Query: 200 FKTFNGCLN---VNGKQDKKVLLGHISKPSNK------VYS-NRSSVIKLKDNTQKIE-- 247
           F   +G L    +NG   KKV  GH  +P  +      +YS  RSS +K   N  + E  
Sbjct: 606 FHGVSGTLGGSVMNGVGCKKVFDGH--RPPGQYMGQSSIYSPERSSPMKKASNLPQGEID 663

Query: 248 ------QRRKHICQI--CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQ 299
                 Q +   C    C   F    ++  H + H  ++   C HEGC ++F R+ + ++
Sbjct: 664 QYIKKLQDKTFQCLYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIR 723

Query: 300 HYRTHSKK 307
           H +TH++K
Sbjct: 724 HKKTHAEK 731

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 250 RKHICQI--CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           RK++CQI  C   F+    L++H   HT E+ +VC    C + F R  +   H  TH++ 
Sbjct: 55  RKYVCQIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRFLRPCHLRVHKWTHAQV 114

Query: 308 K 308
           K
Sbjct: 115 K 115

>Scas_712.2
          Length = 327

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 243 TQKIEQRRKHICQI--CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           T+K  +++ + CQ   C   FT    L +H   HT E+ ++C  EGC + F R  +   H
Sbjct: 4   TEKRSKKKVYKCQFEGCHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRFMRPCHLKVH 63

Query: 301 YRTHSKKK 308
             THSK K
Sbjct: 64  KWTHSKVK 71

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRT-HSK 306
           C   F+ + HL+RH + HTGEK   C  + C + FSR DN  QH  T H+K
Sbjct: 33  CEMSFSRAEHLARHIRRHTGEKPFKC--DICLKYFSRIDNLKQHKDTVHAK 81

>CAGL0K06413g 627811..628890 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1, hypothetical
           start
          Length = 359

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 10/78 (12%)

Query: 236 VIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEG--------C 287
           ++K ++ ++   ++ + +C  C   F   G+L+RH K H  +K++ CP+          C
Sbjct: 25  LVKEEEVSKTRHEQEEFVCHYCDARFKIRGYLTRHIKKHALQKAYYCPYYNEKAPPDLRC 84

Query: 288 --NQSFSRHDNCLQHYRT 303
             N  FSR D    H +T
Sbjct: 85  HNNGGFSRRDTYKAHMKT 102

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 47/100 (47%), Gaps = 3/100 (3%)

Query: 209 VNGKQDKKVLLGHISKPSNKVYSNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLS 268
           V  +QD  + +    K  +K  S+ +    ++D  Q++ + +K+ C  C   F  S  L 
Sbjct: 83  VTTQQDDDIGIQQPRKKRHKSTSSSTEADSVED-VQQLNEDKKYQCDKCELVFRRSSDLR 141

Query: 269 RHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           RH + H     ++C    C + F+R D   +HY T + K+
Sbjct: 142 RHERAHLPILPNICSL--CGKGFARKDALKRHYDTLTCKR 179

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 237 IKL-KDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHD 295
           IKL K   +K   R +  C +C    +    L  H  IHTG+    C  + C ++F+   
Sbjct: 268 IKLTKRQLKKATTRLRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKS 327

Query: 296 NCLQHYRTHSK 306
           N L+H ++H K
Sbjct: 328 NLLRHLKSHEK 338

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 10/70 (14%)

Query: 244 QKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCP--------HEGCNQS--FSR 293
           +K E   K +C  C   F   G+L+RH K H  EK++ CP         + C+ +  FSR
Sbjct: 234 EKKETDMKFVCHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSR 293

Query: 294 HDNCLQHYRT 303
            D+   H R+
Sbjct: 294 RDSYKTHLRS 303

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 254 CQICLTGFTTSGHLSRHA-KIHTGEKSHVCPHEGCNQSFSRHDNCLQHYR 302
           C+IC   F +S HL RH   +H+ EK + CP   C++ F R D+  QH +
Sbjct: 564 CEICDHNFPSSYHLIRHRNSVHSAEKPYNCP--ICSKGFKRKDHVSQHLK 611

>Scas_602.4
          Length = 266

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 7/86 (8%)

Query: 222 ISKPSNKVYSNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHV 281
           I+K S+KV S      K + N   + + RK  C  C    +    L  H  IHTG+    
Sbjct: 177 INKNSSKVPS------KKRANRTLLSKLRKQ-CPACGKICSRPSTLKAHYLIHTGDTPFK 229

Query: 282 CPHEGCNQSFSRHDNCLQHYRTHSKK 307
           C    CN++F+   N L+H + H KK
Sbjct: 230 CTWGNCNKAFNVKSNMLRHLKAHEKK 255

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%)

Query: 246 IEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           I   + + C IC   F+  G+L+ H   H   +  +C  + CN+SFS+  N   H
Sbjct: 5   ITGEKPYECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSH 59

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRT 303
           C  C   F+ S  L RH K H     ++CP   C + F+R D   +HY T
Sbjct: 100 CAKCSLEFSRSSDLRRHEKTHFAILPNICPQ--CGKGFARKDALKRHYDT 147

>Kwal_47.18337
          Length = 536

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 10/65 (15%)

Query: 249 RRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQ----------SFSRHDNCL 298
           +++ +C  C   F   G+L+RH K H  EK++ CP    +            FSR D   
Sbjct: 154 QKRFVCHYCNAEFYIRGYLTRHIKKHAVEKAYYCPFFNADAPKDARCHTTGGFSRRDTYK 213

Query: 299 QHYRT 303
            H R+
Sbjct: 214 THLRS 218

>Scas_660.12
          Length = 367

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 14/68 (20%)

Query: 251 KHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEG--------CNQS--FSRHDNCLQH 300
           +++C  C   F   G+L+RH K H  EK++ CP           C+ S  FSR D     
Sbjct: 95  EYVCHYCQAKFRIKGYLTRHIKKHAVEKAYHCPFFSTESPPELRCHNSGGFSRRDT---- 150

Query: 301 YRTHSKKK 308
           Y+TH K +
Sbjct: 151 YKTHLKAR 158

>Kwal_14.2543
          Length = 711

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           C  C  GF TS  L  H + HTGEK   C  + C + F+   N  +H RTH +K
Sbjct: 636 CSHCGKGFATSSSLRIHIRTHTGEKPLEC--KVCGKRFNESSNLSKHMRTHERK 687

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C  CL  F+T   L +H + H+GEK + C H  C + F+   +   H RTH+ +K
Sbjct: 608 CVHCLKTFSTQDILQQHMRTHSGEKPYKCSH--CGKGFATSSSLRIHIRTHTGEK 660

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 5/64 (7%)

Query: 250 RKHICQI--CLTGFTTSGHLSRHAK---IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           +KHIC+   C+  F++   L+ H +   I  G+ S+VC  E C +  ++    L+H R H
Sbjct: 541 QKHICRWDACMQEFSSCEELNTHIEKEHIPRGKSSYVCGWENCGRVITQRQKLLRHLRVH 600

Query: 305 SKKK 308
           ++ K
Sbjct: 601 TRYK 604

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 267 LSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           L RH ++HT  K   C H  C ++FS  D   QH RTHS +K
Sbjct: 593 LLRHLRVHTRYKPCKCVH--CLKTFSTQDILQQHMRTHSGEK 632

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C +C         L  H  IHTG +  +C   GC + F+   N ++HYR H  ++
Sbjct: 276 CPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQLQR 330

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 252 HICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYR 302
           H C +C   F     L RH   H+ ++  +CP   CN    R DN LQH +
Sbjct: 534 HRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCP--WCNSRHKRRDNLLQHMK 582

>Kwal_56.23925
          Length = 745

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 30/51 (58%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           C   F    ++  H + H  ++ + C  EGC+++F R+ + ++H +TH++K
Sbjct: 592 CGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKKTHAEK 642

>Scas_656.1*
          Length = 102

 Score = 35.4 bits (80), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%)

Query: 246 IEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           I +R    C IC    T S  L  H  +HTG++   C    C ++F+   N  +HY+ H 
Sbjct: 34  IYRRPSRQCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLHL 93

Query: 306 K 306
           K
Sbjct: 94  K 94

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 29/51 (56%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           C   F    ++  H + H  ++ + C H GC+++F R+ + ++H ++H +K
Sbjct: 557 CTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQEK 607

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 260 GFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
            FT + H +RH + HTGEK   C  + C + FSR DN  QH
Sbjct: 2   AFTRAEHHARHIRKHTGEKPFQC--DICMKFFSRIDNLKQH 40

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 249 RRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEG--------CNQS--FSRHDNCL 298
             + IC  C   F   G+L+RH K H  EK++ CP           C+ S  FSR D   
Sbjct: 157 EEEFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDT-- 214

Query: 299 QHYRTHSKKK 308
             Y+TH K +
Sbjct: 215 --YKTHLKAR 222

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 26/56 (46%)

Query: 252 HICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           + C  C   F     L  H  IH G     C    C++ F+   N L+HYR+H+++
Sbjct: 216 YCCPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSHNRE 271

>Scas_641.24
          Length = 532

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 14/66 (21%)

Query: 253 ICQICLTGFTTSGHLSRHAKIHTGEKSHVCP--------HEGCNQS--FSRHDNCLQHYR 302
           IC  C   F   G+L+RH K H  EK++ CP           C+ +  FSR D     Y+
Sbjct: 184 ICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRDT----YK 239

Query: 303 THSKKK 308
           TH K +
Sbjct: 240 THLKAR 245

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQH 300
           C   FT   HL+RH + HTGE+   C    C + FSR DN  QH
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPFQC--HLCLRFFSRLDNLKQH 69

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 36.2 bits (82), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 246 IEQR-RKHICQI--CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYR 302
           +E+R ++++C I  C   ++    L +H + HT EK   CP  GC+++F R  +   H  
Sbjct: 1   MEKRPKRYVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHML 60

Query: 303 THSKKK 308
           +HSK K
Sbjct: 61  SHSKVK 66

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 14/67 (20%)

Query: 252 HICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEG--------CNQS--FSRHDNCLQHY 301
           +IC  C   F   G+L+RH K H   K++ CP           C+ S  FSR D     Y
Sbjct: 204 YICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDT----Y 259

Query: 302 RTHSKKK 308
           +TH K +
Sbjct: 260 KTHLKSR 266

>Scas_378.1
          Length = 208

 Score = 36.2 bits (82), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYR 302
           C +C+  F     L RH   H+ ++ + CP   C     R DN LQH +
Sbjct: 86  CHMCVKSFRRHSWLKRHLLAHSSQRHYSCP--KCVSKHKRKDNLLQHLK 132

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 2/56 (3%)

Query: 247 EQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYR 302
           + +  H CQ C   F     L RH   H+ ++  +CP   C     R DN LQH +
Sbjct: 341 DHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP--WCLSRQKRKDNLLQHMK 394

>YDL048C (STP4) [816] chr4 complement(366739..368211) Protein with
           strong similarity to Stp1p, which is involved in tRNA
           splicing and branched-chain amino acid uptake [1473 bp,
           490 aa]
          Length = 490

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 7/72 (9%)

Query: 239 LKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTG--EKSHVCPHEGCNQSFSRHDN 296
           LKD+ +  +QR+K  C IC   +    +LS H   H    ++ H CP   C + F+R+++
Sbjct: 264 LKDSAKITKQRKKKECPICHNFY---ANLSTHKSTHLTPEDRPHKCP--ICQRGFARNND 318

Query: 297 CLQHYRTHSKKK 308
            ++H + H K +
Sbjct: 319 LIRHKKRHWKDE 330

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPH------EGCNQSFSRHDNCLQHYRTHSKKK 308
           C   F+   HLSRH   H  ++ +VC +        CN++F R D  ++H + HSK K
Sbjct: 38  CNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRHEKRHSKVK 95

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 282 CPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           CPH  CN++FSR ++  +H   H  K+
Sbjct: 33  CPHPECNKTFSRQEHLSRHKLNHWPKE 59

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 36.2 bits (82), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 30/51 (58%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           C   F    ++  H + H  ++ + C ++GC+++F R+ + ++H +TH +K
Sbjct: 563 CGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKKTHQEK 613

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSK 306
           C   F    ++  H + H  +K + C  EGC ++F R+ +  +H +TH K
Sbjct: 530 CGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTHDK 579

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 35.8 bits (81), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEK----SHVCPHEG--CNQSFSRHDNCLQHYRTHSK 306
           C   FT   HLSRH   H  ++     +V P +G  CN++F R D  ++H + HS+
Sbjct: 23  CSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVRHEKRHSR 78

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 276 GEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           G+  +VCPH  C++SF+R ++  +H   H  K+
Sbjct: 12  GKPRYVCPHPNCSKSFTRQEHLSRHKLNHWPKE 44

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 34.7 bits (78), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRT 303
           C  C   F+ S  L RH K+H+    H+C +  C + F+R D   +H  T
Sbjct: 97  CAKCQLKFSRSSDLRRHEKVHSLVLPHICSN--CGKGFARKDALKRHSNT 144

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 234 SSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSR 293
           SS   L  +T+     + + C IC   F  S  L  H + HTGEK   C  + C + F+ 
Sbjct: 778 SSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQC--KICGKRFNE 835

Query: 294 HDNCLQHYRTHSKK 307
             N  +H +TH KK
Sbjct: 836 SSNLSKHIKTHQKK 849

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C+ C   F++   L +H + H+GEK + C    CN+ F+   +   H RTH+ +K
Sbjct: 770 CKTCKRCFSSEETLVQHTRTHSGEKPYKC--HICNKKFAISSSLKIHIRTHTGEK 822

 Score = 32.7 bits (73), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 7/80 (8%)

Query: 234 SSVIKLKDNTQKIEQRR-----KHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCN 288
           SS  +L D+ + +   R     + +   C   F     L RH K+H+  K + C  + C 
Sbjct: 717 SSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC--KTCK 774

Query: 289 QSFSRHDNCLQHYRTHSKKK 308
           + FS  +  +QH RTHS +K
Sbjct: 775 RCFSSEETLVQHTRTHSGEK 794

>Scas_631.7
          Length = 433

 Score = 35.4 bits (80), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRH 294
           C  C  G TT   L RH   HT  KS  CP+E C++++ +H
Sbjct: 118 CLHCGKGVTTRQQLKRHEVTHT--KSFKCPYENCDEAYYKH 156

>Scas_711.56
          Length = 832

 Score = 35.4 bits (80), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           C IC   F  S  L  H + HTGEK   C  + C ++F+   N  +H +TH K+
Sbjct: 756 CDICGKRFAISSSLKIHIRTHTGEKPLHC--KICGKAFNESSNLSKHMKTHLKR 807

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C   F+    L RH ++H+G K   C    C + FS  +   QH RTHS +K
Sbjct: 703 CHKIFSQRQRLVRHMRVHSGYKPFQC--SICKKHFSNEETLKQHERTHSGEK 752

 Score = 32.3 bits (72), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C IC   F+    L +H + H+GEK   C  + C + F+   +   H RTH+ +K
Sbjct: 728 CSICKKHFSNEETLKQHERTHSGEKPFKC--DICGKRFAISSSLKIHIRTHTGEK 780

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 34.7 bits (78), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C  C   F  SG L RH K+H     ++C    C + F+R D   +H+ T + K+
Sbjct: 149 CTKCELVFRRSGDLRRHEKVHLPILPNICSL--CGKGFARKDALKRHFGTLTCKR 201

>Kwal_47.16577
          Length = 881

 Score = 35.0 bits (79), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           C   F+ S HL RH   H+ EK + C    C + FSR D   +H+  H
Sbjct: 20  CSKSFSRSDHLGRHKANHSSEK-YKCEWPACGREFSRLDVKKKHFGRH 66

 Score = 32.7 bits (73), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 276 GEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           G     CP  GC++SFSR D+  +H   HS +K
Sbjct: 9   GSGPFFCPFPGCSKSFSRSDHLGRHKANHSSEK 41

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 35.0 bits (79), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 257 CLTGFTTSGHLSRHAK---IHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C   F ++G L+ H +   +  G+  + C  EGCN++FS+    ++H + HSK K
Sbjct: 541 CNERFKSAGDLNDHLEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLKVHSKYK 595

 Score = 35.0 bits (79), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 45/83 (54%), Gaps = 7/83 (8%)

Query: 227 NKVYSNRSSVIKLKDNTQKIEQRRK-HICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHE 285
           NK +S R  +++      K+  + K + C  C   F+T   L++H ++H+GEK + C   
Sbjct: 575 NKTFSQRQKLVR----HLKVHSKYKPYQCPQCQKCFSTEDTLNQHKRVHSGEKPYEC--H 628

Query: 286 GCNQSFSRHDNCLQHYRTHSKKK 308
            C++ F+  ++   H RTH+ +K
Sbjct: 629 ICHKRFAISNSLKIHIRTHTGEK 651

 Score = 34.7 bits (78), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           C IC   F  S  L  H + HTGEK   C  + C + F+   N  +H +TH KK
Sbjct: 627 CHICHKRFAISNSLKIHIRTHTGEKPLKC--KVCGRCFNESSNLSKHMKTHMKK 678

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C   F+    L RH K+H+  K + CP   C + FS  D   QH R HS +K
Sbjct: 574 CNKTFSQRQKLVRHLKVHSKYKPYQCPQ--CQKCFSTEDTLNQHKRVHSGEK 623

>AFR531W [3723] [Homologous to ScAFR531W]
           complement(1389487..1390311) [825 bp, 274 aa]
          Length = 274

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 10/59 (16%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPH--EGC----NQSFSRHDNCLQHYRTHSK 306
           C  C + F   G+L+RH K H   K   CP+  E C    +  FSR D     +RTH K
Sbjct: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHLK 212

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 58/133 (43%), Gaps = 11/133 (8%)

Query: 179 SPATSPKPKRKNSTGTMSRSPFKTFNGCLNVNGKQDKKVLL---GHISKPSNKVYSNRSS 235
           +P  S   K K    TMS  P  +    +N +G  D+ V +   G  +K S+KV    S+
Sbjct: 72  TPMLSDVYKAKQEETTMS--PVISEKNAVN-SGDSDRSVRVKSEGSSTK-SHKVVKKTST 127

Query: 236 VIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHD 295
             K KD ++  E    H C  C   F  S  L RH + H     ++C    C + F+R D
Sbjct: 128 --KPKDKSKSEEDTVYHYCSQCSLKFNRSSDLRRHERAHLLVLPYICTQ--CGKGFARKD 183

Query: 296 NCLQHYRTHSKKK 308
              +H  T + K+
Sbjct: 184 ALKRHSGTMTCKR 196

>Scas_568.5
          Length = 199

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           +++ C  C   F  S  L RH K H     H+C    C + F+R D   +H+ T +
Sbjct: 116 KRYPCSKCELIFLRSSDLRRHEKAHLLVLPHICSQ--CGKGFARKDALKRHFNTQT 169

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 250 RKHICQI--CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           +K++C +  C   ++    L +H + HT E+  VC   GC + F R  +   H  +HS+ 
Sbjct: 6   KKYLCSVDGCGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSHSQV 65

Query: 308 K 308
           K
Sbjct: 66  K 66

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 14/21 (66%)

Query: 254 CQICLTGFTTSGHLSRHAKIH 274
           C +C  GFTT+  LSRH K H
Sbjct: 70  CPVCSKGFTTNQQLSRHKKTH 90

>Kwal_26.9300
          Length = 304

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 249 RRKHICQICLTGFTT-SGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           RRK  C IC   +   S H S H  +    K H CP   C + F+RH++ L+H + H K 
Sbjct: 143 RRKKECPICHNFYANLSTHRSSH--LQPENKPHKCP--VCGRGFTRHNDLLRHRKRHWKD 198

Query: 308 KE 309
           ++
Sbjct: 199 ED 200

>Scas_713.52
          Length = 620

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 12/55 (21%), Positives = 29/55 (52%)

Query: 253 ICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           + + C   F    ++  H + H  +K + C   GC ++F R+ + ++H ++H+ +
Sbjct: 483 LYEDCGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSHANR 537

>Scas_683.30
          Length = 478

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 249 RRKHICQICLTGFTTSGHLSRHAKIHTG--EKSHVCPHEGCNQSFSRHDNCLQHYRTHSK 306
           RRK  C  CL  +    +LS H   H    ++ H CP   C + F+R+++ ++H + H K
Sbjct: 284 RRKKQCPTCLNYY---ANLSTHKSTHLTPEDRPHKCP--ICERGFARNNDLIRHKKRHWK 338

Query: 307 KK 308
            +
Sbjct: 339 DE 340

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 35/88 (39%), Gaps = 4/88 (4%)

Query: 224 KPSNKVYSN----RSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKS 279
           KPS++  +     R  V+ +              C +C    T    L  H  IHTGE  
Sbjct: 226 KPSHRCVAGNAQLRRPVLPIVGPAASPRYETNKTCLVCGRRCTRPSTLKTHMLIHTGELP 285

Query: 280 HVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
             C   GC++ F+   N  +H  +H ++
Sbjct: 286 FQCSWPGCSKRFNVRSNMNRHVNSHKRR 313

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           C  C   F+TS  L  H + HTGEK   C    C + F+   N  +H + H +K
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSC--TVCGKRFNESSNLSKHMKIHERK 625

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C  C   F+T   L++H + H+GE+   C +  C + FS   +   H RTH+ +K
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTHTGEK 598

>Kwal_34.15946
          Length = 279

 Score = 32.0 bits (71), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 10/59 (16%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEG----CNQS--FSRHDNCLQHYRTHSK 306
           C  C + F   G+L+RH K H   K   CP       C+ S  FSR D     Y+TH K
Sbjct: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHLK 229

>Scas_670.2
          Length = 435

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 248 QRRKHICQICLTGFTTSGHLSRHAKIHT--GEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305
           +RRK  C IC +G+    +L+ H   H    ++ H CP   C + F R+++ ++H + H 
Sbjct: 248 KRRKKQCPIC-SGYY--ANLTTHKATHLVPEDRPHKCPI--CQRGFGRNNDLIRHQKRHW 302

Query: 306 K 306
           K
Sbjct: 303 K 303

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%)

Query: 243 TQKIEQRRKHICQICLTGFTTSGHLSRHAKIH 274
           T  + + R H C IC  GF  +  L RH K H
Sbjct: 270 THLVPEDRPHKCPICQRGFGRNNDLIRHQKRH 301

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 2/56 (3%)

Query: 247 EQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYR 302
           E    + C +C   F     L RH   H+  K   CP   C+ +  R DN LQH +
Sbjct: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCP--WCSSTHKRKDNLLQHLK 354

>Scas_721.56
          Length = 199

 Score = 31.2 bits (69), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 2/55 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C  C   F  S  L RH K H     ++C    C + F+R D   +++ T + K+
Sbjct: 117 CNKCELYFIRSSDLRRHEKTHLSILPNICSQ--CGKGFARKDALKRYFGTLTCKR 169

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 31.6 bits (70), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 27/52 (51%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C   F    ++  H + H  ++ + C   GC ++F R+ + ++H  +H+ KK
Sbjct: 610 CNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAKK 661

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 11/72 (15%)

Query: 247 EQRRKHICQI-----------CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHD 295
           EQ  K+I +I           C   F    +   H + H  ++ + C   GC ++F R+ 
Sbjct: 679 EQIDKYILEIGPKQFQCKFKDCQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNH 738

Query: 296 NCLQHYRTHSKK 307
           + L+H ++H +K
Sbjct: 739 DLLRHKKSHLEK 750

>Scas_693.31
          Length = 635

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 10/38 (26%), Positives = 23/38 (60%)

Query: 270 HAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           H + H  ++ + C    C+++F R+ + ++H + HS+K
Sbjct: 509 HIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKKVHSEK 546

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 48/112 (42%), Gaps = 23/112 (20%)

Query: 169 STEAIVNGVPSPATSPKP--KRKNSTGTMSRSPFKTFNGCLNVNGKQDKKVLLGHISKPS 226
           ST++IV G+PSP T+      ++ ST   S SP         +N  +        +SKP 
Sbjct: 116 STDSIV-GLPSPTTASASFFIQQRSTSVDSGSP--------QINSNR--------VSKPR 158

Query: 227 NK----VYSNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIH 274
            K    V  N  + +    +T    + R H C +C  GF  S  L RH K H
Sbjct: 159 RKKECPVCHNFYANLSTHKSTHLTPEDRPHKCSVCSRGFARSNDLLRHKKRH 210

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 2/51 (3%)

Query: 252 HICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYR 302
           H C  C   F     L RH   H+  K + CP   C+    R DN  QH +
Sbjct: 185 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCP--WCHSRHKRKDNLSQHLK 233

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 276 GEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           G+  + CPH  C++SFSR ++  +H   H  K+
Sbjct: 41  GQYRYKCPHPTCDKSFSRQEHLSRHKLNHWPKE 73

>Scas_604.4
          Length = 585

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304
           C T      H++ H ++H   K   C  + C + F R  +  +H RTH
Sbjct: 224 CFTKTVKRDHITSHLRVHVPLKPFAC--KKCTKKFKRPQDLKKHLRTH 269

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 2/55 (3%)

Query: 253 ICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           IC +C   FT    L  H  IHT  K   C    C++ F+   N  +H R H +K
Sbjct: 168 ICPLCGKSFTRRSTLQIHLLIHTNLKPFKC--SFCDKEFNVKSNLNRHERIHRQK 220

>KLLA0E13519g complement(1190615..1191307) some similarities with
           sgd|S0006226 Saccharomyces cerevisiae YPR022c,
           hypothetical start
          Length = 230

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 19/29 (65%)

Query: 280 HVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           +VCPH  C ++FSR+++  +H   H  K+
Sbjct: 18  YVCPHPDCEKTFSRYEHLQRHKLNHWPKQ 46

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 257 CLTGFTTSGHLSRHAKIHTGEK----SHVCPHEG--CNQSFSRHDNCLQHYRTHS 305
           C   F+   HL RH   H  ++     +V P +G  CN++F R D  ++H R H+
Sbjct: 25  CEKTFSRYEHLQRHKLNHWPKQIFRCEYVYPDDGIVCNRTFVRKDLLVRHQRRHT 79

>Kwal_26.8021
          Length = 507

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 2/50 (4%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRT 303
           C +C   F       RH   H+  K + CP   C     R DN  QH +T
Sbjct: 391 CSMCDKSFKRRSWHKRHLLSHSSFKPYSCP--WCQSRHKRRDNLFQHMKT 438

>Kwal_27.11824
          Length = 199

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 2/59 (3%)

Query: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           +K  C  C   F  S  L RH + H     ++C    C + F+R D   +H+ T + K+
Sbjct: 117 KKFPCAKCELVFRRSSDLRRHERAHLPILPNICSL--CGKGFARKDALKRHFDTLTCKR 173

>AEL054C [2452] [Homologous to ScYCR024C - SH] (535735..537168)
           [1434 bp, 477 aa]
          Length = 477

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 124 IVVEEADQIQESPK-PKRVKRRTKSASSMKKAPIKVVFDSSNSHNMSTEAIVNGVPSPAT 182
           I V +  Q+Q++PK P  V+ R +S  +MK A    + D S+ + +      +G P+P T
Sbjct: 20  ITVRDLLQLQDAPKQPLDVQGRVRSFRAMKNASFLDLEDGSSKNALKVVISHHGRPNPVT 79

>Kwal_23.4090
          Length = 2050

 Score = 30.0 bits (66), Expect = 3.0,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 38/77 (49%), Gaps = 12/77 (15%)

Query: 116 PNNIVPPKIVVEEADQIQESPKPKRVKRRTKSASSMKKAPIKVVFDSSNSHNMSTE---- 171
           PN  +PP ++ + A+  + +P P        S S++ K  ++   D +N+H + TE    
Sbjct: 318 PNTSLPPSMLEDSAENGEGTPSP------MLSISNLTKEQVQTYIDQTNAH-LPTEKHIV 370

Query: 172 -AIVNGVPSPATSPKPK 187
            +++NG  +   +  P+
Sbjct: 371 ISLINGARNLVVTGPPQ 387

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 12/68 (17%)

Query: 215 KKVLLGHISKP--------SNKVYSNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGH 266
           KK LL   SK          +K ++N S+      +T    Q R H C IC +GF  +  
Sbjct: 310 KKALLADYSKTKKKRQCPICHKYFANLST----HKSTHLTSQDRPHKCIICQSGFARNND 365

Query: 267 LSRHAKIH 274
           L RH K H
Sbjct: 366 LIRHRKRH 373

>KLLA0F07073g 675221..676897 some similarities with sgd|S0004367
           Saccharomyces cerevisiae YLR375w STP3 involved in
           pre-tRNA splicing and in uptake of branched-chain amino
           acids, hypothetical start
          Length = 558

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 233 RSSVIKLKDNTQKIEQ---RRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQ 289
           +S+ +K+++N   + +   R+K  C +C   F+    LS H   H   ++     E C++
Sbjct: 362 KSAKMKIENNANMVSKKQPRKKKQCPLCGLFFSN---LSTHKSTHLSPETRPFKCEVCSR 418

Query: 290 SFSRHDNCLQHYRTHSK 306
            F+R ++ ++H + H K
Sbjct: 419 GFARSNDLIRHKKLHWK 435

>KLLA0C03564g complement(323354..327553) some similarities with
            sp|P25357 Saccharomyces cerevisiae YCR033w singleton,
            hypothetical start
          Length = 1399

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 38/87 (43%), Gaps = 17/87 (19%)

Query: 167  NMSTEAIVNGVPSPATSPKPKRKNSTGTMSRSPFKTFN-------GCLNVNGKQDKKVLL 219
            N+S+  IVN +PSPAT  KP  K S   +   P +T         G  N     D K  L
Sbjct: 1090 NVSSAIIVNSLPSPATVNKPAEKPSIEPL---PLQTIPQQQKPAVGFFN-----DSK--L 1139

Query: 220  GHISKPSNKVYSNRSSVIKLKDNTQKI 246
              I KPS  +  N  S  +L   TQ +
Sbjct: 1140 SSIHKPSFSLTGNEDSFSRLPTPTQGL 1166

>Kwal_23.5526
          Length = 378

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 9/102 (8%)

Query: 160 FDSSNSHNMSTEAIVNGVPSPATSPKPKRKNSTGTMSRSPFKTFNGCLNVNGKQDKKVLL 219
            DS+++  + TE +V+   SP    + K+  +TG    SP  T + C  V+   + + + 
Sbjct: 282 LDSTHASTVPTEVLVSAAGSPI---EEKKSCATGYPPLSPLNTAHYC--VSNDPEPEQVP 336

Query: 220 GHISKPSNKVYSN----RSSVIKLKDNTQKIEQRRKHICQIC 257
            H  K  +K+ S       S+ +LK+   + ++   H C IC
Sbjct: 337 EHGEKKPSKIPSRPKNPSRSITELKEKPSRSKKTSSHCCVIC 378

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
           C+ C   F  S  L RH + H     ++C    C + F+R D   +H+ T + K+
Sbjct: 206 CEKCHMVFRRSSDLRRHERQHLPILPNIC--TLCGKGFARKDALKRHFDTQTCKR 258

>Sklu_2154.3 , Contig c2154 4677-5249 reverse complement
          Length = 190

 Score = 28.9 bits (63), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 10/59 (16%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEG----CNQS--FSRHDNCLQHYRTHSK 306
           C  C + F   G+L+RH K H   K + CP+      C+ +  FSR D     ++TH K
Sbjct: 80  CPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FKTHLK 134

>AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C
           (STP4) - SH] complement(1496510..1497469) [960 bp, 319
           aa]
          Length = 319

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 14/27 (51%)

Query: 248 QRRKHICQICLTGFTTSGHLSRHAKIH 274
           + R H C IC  GF  S  L RH K H
Sbjct: 150 EARPHKCDICSRGFARSNDLQRHKKRH 176

>AAL016C [171] [Homologous to ScYCL014W (BUD3) - SH]
           (311460..315896) [4437 bp, 1478 aa]
          Length = 1478

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 11/100 (11%)

Query: 132 IQESPKPKRVKRRTKSASSM-----KKAPIKVVFDSSNSHNMSTEAIVNGVPSPAT--SP 184
           +Q    PK V   +KS  ++     KK P  +V  + NS  +S   I++  P   +  +P
Sbjct: 718 VQTLLDPKGVHSASKSKCALRTSKKKKMPANLVSTNDNSRTLSPGTIISRTPRTISTITP 777

Query: 185 KPKRKNSTGTMSRSPFKTFNGCLNVNGKQDKK-VLLGHIS 223
           K +++ S G  S SP +   G ++   ++ K+  +LG IS
Sbjct: 778 KQEKRKSVGQASNSPAR---GSISTTPRKHKRESILGKIS 814

>Kwal_27.10167
          Length = 285

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 36/90 (40%), Gaps = 4/90 (4%)

Query: 223 SKPSNKVYSNRSSVIKLKDNTQKI--EQRRKHICQI--CLTGFTTSGHLSRHAKIHTGEK 278
           S P N + +  +S   +   T  +  E  +K+IC I  C   +     L  H   H   +
Sbjct: 4   SSPRNLISALVTSSYTIPSTTWSMSRECDKKYICPITSCNKRYRKPSSLREHVNSHNNNR 63

Query: 279 SHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308
              CP   C + F R  +   H  THSK K
Sbjct: 64  PFACPEPNCGKRFLRVCHMNVHRWTHSKIK 93

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 249 RRKHICQICLTGFTTSGHLSRHAKIHTG--EKSHVCPHEGCNQSFSRHDNCLQHYRTHSK 306
           R+K  C IC   +     L+ H   H    ++ H CP   C++ F+R+++ L+H + H K
Sbjct: 139 RKKKQCPICRNFYAN---LTTHKATHLTPEDRPHKCP--ICHRGFARNNDLLRHKKRHWK 193

Query: 307 KK 308
            +
Sbjct: 194 DE 195

>Sklu_1899.3 YFL034W, Contig c1899 4517-7375 reverse complement
          Length = 952

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 124 IVVEEADQIQESPKPKRVKRRTKSASSMKKAPIKV 158
           +V EE ++I +SP P+ VKR+ K    + +A  K+
Sbjct: 790 VVSEEFEEIDDSPDPEEVKRQRKLVHDLDEAQKKL 824

>Sklu_2254.4 YDR501W, Contig c2254 4846-6654
          Length = 602

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 172 AIVNGVPSPATSPKPKRKNSTGTMSRSPFKTFNGCLNVNGKQDKKVLLGHISKPSNKVYS 231
           A V   P+P  S       ST   S SP +  N  L ++  + ++ L   ++KP  + ++
Sbjct: 65  AAVREYPTPNPS-------STLGRSSSPARAANVSLTLSDFEFERELEDELTKPGKRAHA 117

Query: 232 NRSSVIKLKDNTQKIEQRRKHICQICL 258
                +  +D+++    R+K +C I L
Sbjct: 118 PVQIALDPRDSSRLAIGRKKSVCDIAL 144

>YKR048C (NAP1) [3299] chr11 complement(525029..526282) Nucleosome
           assembly protein that plays a role in assembly of
           histones into octamer, required for full expression of
           Clb2p functions [1254 bp, 417 aa]
          Length = 417

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 133 QESPKPKRVKRRTKSASSMKKAPIKVVFDSSNSHNMSTEAIVNGVPS 179
           QE PKP+++ +  +   S+ +  + +V +   + N S E  V G+PS
Sbjct: 142 QEQPKPEQIAKGQEIVESLNETEL-LVDEEEKAQNDSEEEQVKGIPS 187

>Scas_717.60d
          Length = 167

 Score = 28.1 bits (61), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 1/48 (2%)

Query: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHY 301
           C+ C   F TS  L +H K    ++   C +  C ++F R D    HY
Sbjct: 101 CKECSKAFVTSQKLKKHTKDAHSKRMFPCEY-NCGKAFKRKDQRKSHY 147

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 254 CQI--CLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307
           CQ   C T      H++ H ++H   K   C    CN+ F R  +  +H + H+++
Sbjct: 149 CQWGDCQTKTVKRDHITSHLRVHVQLKPFAC--STCNKKFKRPQDLKKHLKVHNEE 202

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.126    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,611,850
Number of extensions: 395299
Number of successful extensions: 2035
Number of sequences better than 10.0: 251
Number of HSP's gapped: 1894
Number of HSP's successfully gapped: 313
Length of query: 309
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 208
Effective length of database: 13,099,691
Effective search space: 2724735728
Effective search space used: 2724735728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 61 (28.1 bits)