Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L07436g51550722700.0
YDL106C (PHO2)5593848121e-102
Sklu_2101.44912537431e-92
KLLA0D10043g4882326779e-83
Scas_613.114932486613e-80
AFL202C4812136542e-79
Kwal_23.34944662336103e-73
KLLA0B01584g464561343e-08
Kwal_47.18450370561244e-07
YML027W (YOX1)385561201e-06
Sklu_797.1386561121e-05
CAGL0G07249g345561102e-05
AFR643C102611004e-05
ADL394C10261995e-05
YDR451C (YHP1)353451022e-04
Scas_641.12413561004e-04
AER456W5747894e-04
Kwal_33.129919150880.001
AER314W43152950.001
KLLA0C03135g22854890.005
KLLA0B14553g22854890.005
Kwal_26.759552465790.14
Scas_720.112335690.72
YGL096W (TOS8)27666664.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L07436g
         (507 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L07436g 818510..820057 similar to sp|P07269 Saccharomyces c...   879   0.0  
YDL106C (PHO2) [763] chr4 complement(270222..271901) Homeodomain...   317   e-102
Sklu_2101.4 YDL106C, Contig c2101 7279-8754 reverse complement        290   1e-92
KLLA0D10043g 849549..851015 some similarities with sp|P07269 Sac...   265   9e-83
Scas_613.11                                                           259   3e-80
AFL202C [2993] [Homologous to ScYDL106C (PHO2) - SH] (56150..575...   256   2e-79
Kwal_23.3494                                                          239   3e-73
KLLA0B01584g complement(125027..126421) weakly similar to sp|P34...    56   3e-08
Kwal_47.18450                                                          52   4e-07
YML027W (YOX1) [3938] chr13 (221406..222563) Protein involved in...    51   1e-06
Sklu_797.1 YML027W, Contig c797 554-1714 reverse complement            48   1e-05
CAGL0G07249g complement(688189..689226) similar to sp|P34161 Sac...    47   2e-05
AFR643C [3835] [Homologous to ScYCR097W (HMRA1) - SH] (1607899.....    43   4e-05
ADL394C [1347] [Homologous to ScYCR097W (HMRA1) - NSH] (18058..1...    43   5e-05
YDR451C (YHP1) [1270] chr4 complement(1361108..1362169) Protein ...    44   2e-04
Scas_641.12                                                            43   4e-04
AER456W [2956] [Homologous to ScYCR097W (HMRA1) - NSH] complemen...    39   4e-04
Kwal_33.12991                                                          39   0.001
AER314W [2815] [Homologous to ScYML027W (YOX1) - SH; ScYDR451C (...    41   0.001
KLLA0C03135g complement(279869..280555) gi|10643642|gb|AAG21094....    39   0.005
KLLA0B14553g complement(1278622..1279308) sp|Q9HG12 Kluyveromyce...    39   0.005
Kwal_26.7595                                                           35   0.14 
Scas_720.1                                                             31   0.72 
YGL096W (TOS8) [1887] chr7 (325332..326162) Protein with weak si...    30   4.6  

>CAGL0L07436g 818510..820057 similar to sp|P07269 Saccharomyces
           cerevisiae YDL106c GRF10 homeodomain protein,
           hypothetical start
          Length = 515

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/507 (86%), Positives = 440/507 (86%)

Query: 1   MDGHTKSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKV 60
           MDGHTKSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKV
Sbjct: 1   MDGHTKSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKV 60

Query: 61  RXXXXXXXXXXXXXXXESRVVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
           R               ESRVVS                                      
Sbjct: 61  RKKGKLDGDKPKLHDGESRVVSGTGAGAGTATAGPGAGAGVTRTQGTATRTTATTDVTTV 120

Query: 121 XXSGPPYFDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMN 180
             SGPPYFDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMN
Sbjct: 121 DTSGPPYFDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMN 180

Query: 181 QLMSDATDLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSFDKTDEEINN 240
           QLMSDATDLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSFDKTDEEINN
Sbjct: 181 QLMSDATDLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSFDKTDEEINN 240

Query: 241 RTDPANKQAELKLKVNKPPKFAVYFLNQPENNNTNQWCLCEDFSEGKQVNDAFVGGSNVP 300
           RTDPANKQAELKLKVNKPPKFAVYFLNQPENNNTNQWCLCEDFSEGKQVNDAFVGGSNVP
Sbjct: 241 RTDPANKQAELKLKVNKPPKFAVYFLNQPENNNTNQWCLCEDFSEGKQVNDAFVGGSNVP 300

Query: 301 HVLKGLESSLKILNSLILDYISTNDTITSAPLPPPPTNVGSDILHPQMHPAPHGLMAYNA 360
           HVLKGLESSLKILNSLILDYISTNDTITSAPLPPPPTNVGSDILHPQMHPAPHGLMAYNA
Sbjct: 301 HVLKGLESSLKILNSLILDYISTNDTITSAPLPPPPTNVGSDILHPQMHPAPHGLMAYNA 360

Query: 361 GMSGQMAPSSHTSETLHSIANAXXXXXXXXXXXXYAALPHIQPQPSVDSTYFFNQYNPQP 420
           GMSGQMAPSSHTSETLHSIANA            YAALPHIQPQPSVDSTYFFNQYNPQP
Sbjct: 361 GMSGQMAPSSHTSETLHSIANAGGSISPPGFGGPYAALPHIQPQPSVDSTYFFNQYNPQP 420

Query: 421 VAHEHIMSGPETISTYDGHTILQHPPAMQGMIQANHNPIINSAYAHNPMDNMLVGVPSVN 480
           VAHEHIMSGPETISTYDGHTILQHPPAMQGMIQANHNPIINSAYAHNPMDNMLVGVPSVN
Sbjct: 421 VAHEHIMSGPETISTYDGHTILQHPPAMQGMIQANHNPIINSAYAHNPMDNMLVGVPSVN 480

Query: 481 NSESMLTFTNESGMTNNIPEFLRNPSE 507
           NSESMLTFTNESGMTNNIPEFLRNPSE
Sbjct: 481 NSESMLTFTNESGMTNNIPEFLRNPSE 507

>YDL106C (PHO2) [763] chr4 complement(270222..271901) Homeodomain
           protein required for expression of phosphate pathway and
           other genes [1680 bp, 559 aa]
          Length = 559

 Score =  317 bits (812), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/384 (45%), Positives = 224/384 (58%), Gaps = 57/384 (14%)

Query: 3   GHTKSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVRX 62
           G  + KRTRAKGE+LD+LK  F++NP PSL ER +IS+L GMPEKNVRIWFQNRRAK+R 
Sbjct: 75  GPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRK 134

Query: 63  XXXXXXXXXXXXXXESRVVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 122
                         +SR ++                                        
Sbjct: 135 KQHGSNKDTIPSS-QSRDIANDYDRGSTDNNLVTTTSTSSIFHDEDLT------------ 181

Query: 123 SGPPYFDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMNQL 182
               +FD++PLN NNNYYF D+ SITVGSWNRMKSG+L   +   +K+L NLSP+ +N +
Sbjct: 182 ----FFDRIPLNSNNNYYFFDICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNI 237

Query: 183 MSDATDLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSFDKTDEEINN-- 240
           MS+ATDLMV+ISKKN EINYFFSAMANNTKILFRIFF +++V +CSL+ +  D+ IN+  
Sbjct: 238 MSNATDLMVLISKKNSEINYFFSAMANNTKILFRIFFPLSSVTNCSLTLETDDDIINSNN 297

Query: 241 -----------------------------RTDPANKQAELKLKVNKPPKFAVYFLNQPEN 271
                                        + +  +   ELKL V + P FAVYFLN   +
Sbjct: 298 TSDKNNSNTNNDDDNDDNSNEDNDNSSEDKRNAKDNFGELKLTVTRSPTFAVYFLNNAPD 357

Query: 272 ---NNTNQWCLCEDFSEGKQVNDAFVGGSNVPHVLKGLESSLKILNSLILDYISTNDTIT 328
              N  NQW +C+DFSEG+QVNDAFVGGSN+PH LKGL+ SL+ +NSLILDY S+N+ + 
Sbjct: 358 EDPNLNNQWSICDDFSEGRQVNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEILP 417

Query: 329 SAPLPPPPTNVGSDILHPQMHPAP 352
           +     P   V      PQ + AP
Sbjct: 418 TINTAIPTAAV------PQQNIAP 435

>Sklu_2101.4 YDL106C, Contig c2101 7279-8754 reverse complement
          Length = 491

 Score =  290 bits (743), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 149/253 (58%), Positives = 183/253 (72%), Gaps = 19/253 (7%)

Query: 128 FDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMNQLMSDAT 187
           FD++PLNINNNYYF+DV S+TVGSW R+KSG+L   SLP +KDL NLSP+S+N +MS++T
Sbjct: 153 FDRIPLNINNNYYFLDVSSLTVGSWKRLKSGNLDKESLPNIKDLSNLSPISINDIMSNST 212

Query: 188 DLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSFD------KTDEEINNR 241
           DLMV+ISKKNFEINYFFSA+ANNTKILFRIFF IN+V +CSLSF+      + +++    
Sbjct: 213 DLMVLISKKNFEINYFFSAIANNTKILFRIFFPINSVVNCSLSFEADSIRKENEDQDEQD 272

Query: 242 TDPANKQAELKLKVNKPPKFAVYFLNQPENNNTNQWCLCEDFSEGKQVNDAFVGGSNVPH 301
            DP+ K  ELKL V+K PKFAVYF +  E+  +NQW +CEDFSEG+QV+DAFVGGSN+PH
Sbjct: 273 QDPSEKTCELKLTVSKSPKFAVYFSDAVEHFTSNQWSICEDFSEGRQVSDAFVGGSNLPH 332

Query: 302 VLKGLESSLKILNSLILDYISTNDTITSAPLPPPPT-------NVGSDILHPQMHPAPHG 354
           VL GLE SLK +NSLILDY STN  I      PPPT       +  S IL P+  PA  G
Sbjct: 333 VLNGLEDSLKFMNSLILDYNSTNQII------PPPTVTQPHAVSQQSMILQPEPRPAEQG 386

Query: 355 LMAYNAGMSGQMA 367
              +      Q A
Sbjct: 387 QQQFFDDFDAQNA 399

 Score = 92.8 bits (229), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%)

Query: 2   DGHTKSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           DG  K+KRTRA GE+L ILK  F +NPNP+ Q R RIS++T +PEKNVRIWFQNRRAK R
Sbjct: 68  DGKPKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFR 127

>KLLA0D10043g 849549..851015 some similarities with sp|P07269
           Saccharomyces cerevisiae YDL106c GRF10 homeodomain
           protein singleton, hypothetical start
          Length = 488

 Score =  265 bits (677), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 134/232 (57%), Positives = 173/232 (74%), Gaps = 22/232 (9%)

Query: 128 FDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMNQLMSDAT 187
           FDK+PL IN++YYFID+ S+TVGSW R+KSG+L ++SLP ++ L NLSP+S+N +M++AT
Sbjct: 176 FDKIPLAINSSYYFIDISSLTVGSWKRLKSGNLRSDSLPQIQKLSNLSPISINTIMANAT 235

Query: 188 DLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSFDKTDE----------- 236
           DLMV+ISKKNFEINYFFSA+ANNTKILFRIFF INTV +CSLS D T+            
Sbjct: 236 DLMVLISKKNFEINYFFSAIANNTKILFRIFFPINTVVNCSLSLDNTESLKGDAKNSNSP 295

Query: 237 ---EINNRTDPANKQAELKLKVNKPPKFAVYFLNQPENNNTNQWCLCEDFSEGKQVNDAF 293
              + NN T+ ++K AEL+L ++K PKFAVYF    ++ ++NQW +CEDFSEG+QVNDAF
Sbjct: 296 SSLDGNNDTN-SSKLAELRLSLSKSPKFAVYFSETIDDASSNQWSICEDFSEGRQVNDAF 354

Query: 294 VGGSNVPHVLKGLESSLKILNSLILDYISTNDTITSAPLPPPPTNVGSDILH 345
           +GGSN+PHVL GL+ SLK +NSLILD  ST          PP T +   I+H
Sbjct: 355 IGGSNIPHVLTGLDESLKFMNSLILDMNSTEHF-------PPTTQLQHGIMH 399

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 39/53 (73%), Positives = 46/53 (86%)

Query: 9   RTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           RTRA GE+L+ILK  FQLNP+P+ Q R RISE+TG+PEKNVRIWFQNRR+K R
Sbjct: 101 RTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYR 153

>Scas_613.11
          Length = 493

 Score =  259 bits (661), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 139/248 (56%), Positives = 171/248 (68%), Gaps = 20/248 (8%)

Query: 127 YFDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMNQLMSDA 186
           +FD++P+ IN NY FIDV SITVGSWNR K GSL    LP+V+ L NLSPVSMN +MS++
Sbjct: 184 FFDRIPVRINKNYNFIDVCSITVGSWNRKKYGSLLPEDLPIVEKLSNLSPVSMNNIMSNS 243

Query: 187 TDLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSFDKTDE-----EINNR 241
           TDL+V+ SKKN EINYFFSAMAN+TKILFRIFF I++V +CSLS +  D+      + N 
Sbjct: 244 TDLIVLTSKKNDEINYFFSAMANDTKILFRIFFPISSVKNCSLSLETDDDIITNNNVTNS 303

Query: 242 TDPANKQAELKLKVNKPPKFAVYFLNQPENNNT---NQWCLCEDFSEGKQVNDAFVGGSN 298
           +D + +  ELKL + KPP FAVYF+   EN      NQW +CEDFSEGKQV DAF+GGSN
Sbjct: 304 SDTSERLGELKLILTKPPTFAVYFIKSDENETVPSINQWSICEDFSEGKQVTDAFIGGSN 363

Query: 299 VPHVLKGLESSLKILNSLILDYISTNDTITSAPLPPPPTNVGSDIL--HPQMHPAPHGLM 356
           +PHVL GL+ SLK LNS IL+Y STN+      LPP    V S  L  H  M P     M
Sbjct: 364 LPHVLSGLQDSLKFLNSHILEYKSTNEI-----LPPSTITVPSHQLQSHDLMTP-----M 413

Query: 357 AYNAGMSG 364
            Y++  +G
Sbjct: 414 QYSSSSTG 421

 Score = 93.6 bits (231), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (87%)

Query: 6   KSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           KS+R RAKGE L+ILKS F+LNPNPS +ER +IS L GMPEK+VRIWFQNRRAKV+
Sbjct: 94  KSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRRAKVK 149

>AFL202C [2993] [Homologous to ScYDL106C (PHO2) - SH] (56150..57595)
           [1446 bp, 481 aa]
          Length = 481

 Score =  256 bits (654), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 131/213 (61%), Positives = 161/213 (75%), Gaps = 10/213 (4%)

Query: 128 FDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMNQLMSDAT 187
           +DK+PLNIN+NYYFID  S+TVGSW R+KSG+L   SL  +K L NLSP S+N +MS+AT
Sbjct: 143 YDKIPLNINDNYYFIDANSLTVGSWKRLKSGNLHRESLSNIKYLSNLSPTSINMIMSNAT 202

Query: 188 DLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSF----DKTDEE-----I 238
           DLMV+ISKKNFE+NYFFSA+ANNTKILFRIFF IN+V +CSL       K DE+     +
Sbjct: 203 DLMVLISKKNFEVNYFFSAIANNTKILFRIFFPINSVLNCSLLLHAEGGKKDEDDANNVV 262

Query: 239 NNRTDPANKQ-AELKLKVNKPPKFAVYFLNQPENNNTNQWCLCEDFSEGKQVNDAFVGGS 297
              T PA +Q  ELKL V+KPP FAVYF +  +   +NQW +CEDFSEG+QV+DA+VGGS
Sbjct: 263 QETTAPAAEQVCELKLNVSKPPNFAVYFSDMNDELTSNQWSICEDFSEGRQVSDAYVGGS 322

Query: 298 NVPHVLKGLESSLKILNSLILDYISTNDTITSA 330
           N PHVL GLE+SLK ++SLILDY ST   +  A
Sbjct: 323 NFPHVLTGLEASLKFMSSLILDYNSTTHVVPHA 355

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%)

Query: 3   GHTKSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           G  KSKRTRA GE+L++LK  F +NPNP+ Q R RISE TG+PEKNVRIWFQNRRAK R
Sbjct: 58  GKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYR 116

>Kwal_23.3494
          Length = 466

 Score =  239 bits (610), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 163/233 (69%), Gaps = 12/233 (5%)

Query: 128 FDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMNQLMSDAT 187
           FD++PL+ N+NY FIDV S+TVGSW R+KSG+L  + LP V+ L NLSPVS+N++M++AT
Sbjct: 137 FDRIPLDSNSNYCFIDVKSLTVGSWKRLKSGNLKQDDLPTVQRLSNLSPVSINEIMANAT 196

Query: 188 DLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSFDKTDEEINNRTDPANK 247
           DLMV+ISKKN EINYFFSA+ANNTKILFRIFF I T   C+LS   TD   + R+D  NK
Sbjct: 197 DLMVLISKKNHEINYFFSAIANNTKILFRIFFPITTTVDCALSA-TTDGAESVRSDAHNK 255

Query: 248 QAELKLKVNKPPKFAVYFLNQPENNNTNQWCLCEDFSEGKQVNDAFVGGSNVPHVLKGLE 307
             EL+L ++K P FAVYF +  +  ++NQW +CEDFSE +QV++AF+GG N+PH+L GLE
Sbjct: 256 LCELRLNLSKAPTFAVYFSDGADQFSSNQWSICEDFSEERQVSEAFIGGLNIPHILTGLE 315

Query: 308 SSLKILNSLILDYISTNDTITSAPLPPPPTNVGSDILHPQMH-----PAPHGL 355
           SSL  + S I D+ S       A +    +++   +  P+ H     P PH L
Sbjct: 316 SSLSFMCSSIQDHNS------GAHVLSHKSHLRDSVGAPEAHNIVINPEPHAL 362

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%)

Query: 2   DGHTKSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           D   ++KRTRA GE+L++LK  F  NPNP+ Q R RISELTG+PEKNVRIWFQNRRAK R
Sbjct: 50  DDRPRTKRTRATGEALNVLKREFDQNPNPNAQNRKRISELTGLPEKNVRIWFQNRRAKHR 109

>KLLA0B01584g complement(125027..126421) weakly similar to sp|P34161
           Saccharomyces cerevisiae YML027w YOX1 homoeodomain
           protein, start by similarity
          Length = 464

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 6   KSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           + KR R      DILK  F++NP PS + R+ +S +  M EK V++WFQNRR   R
Sbjct: 210 RRKRRRTSKNESDILKKEFEVNPAPSKERRSELSIICNMSEKAVQVWFQNRRQNFR 265

>Kwal_47.18450
          Length = 370

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 6   KSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           + KR R     L+IL+S F+L P P   +R  +SE   M EK ++IWFQN+R  V+
Sbjct: 160 RRKRRRTSKHELNILQSEFELCPTPDKFKRIELSERCCMSEKAIQIWFQNKRQSVK 215

>YML027W (YOX1) [3938] chr13 (221406..222563) Protein involved in
           transcriptional derepression during the M/G1 phase of
           the cell cycle along with Yhp1p, contains homeodomain
           [1158 bp, 385 aa]
          Length = 385

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%)

Query: 6   KSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           + KR R   + L IL++ F+  P PS ++R  ++E   M EK V+IWFQN+R  V+
Sbjct: 177 RRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVK 232

>Sklu_797.1 YML027W, Contig c797 554-1714 reverse complement
          Length = 386

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 6   KSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           + KR R     L+IL++ F+    P  Q+R  +++   M EK V+IWFQN+R  V+
Sbjct: 170 RRKRRRTSKNELNILQAEFEACSTPDKQKRIELAQRCSMSEKAVQIWFQNKRQSVK 225

>CAGL0G07249g complement(688189..689226) similar to sp|P34161
           Saccharomyces cerevisiae YML027w YOX1 homoeodomain
           protein, start by similarity
          Length = 345

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%)

Query: 6   KSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           + KR R   + L+IL++ FQ    P  Q R  +++   M EK V++WFQN+R  ++
Sbjct: 155 RRKRRRTSSQELNILQAEFQRCSTPDKQTRINLAQRCNMTEKAVQVWFQNKRQAMK 210

>AFR643C [3835] [Homologous to ScYCR097W (HMRA1) - SH]
          (1607899..1608207) [309 bp, 102 aa]
          Length = 102

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 34/61 (55%)

Query: 1  MDGHTKSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKV 60
          + G  + +RT    E+ + L+S F+    P+ +ER  I+E  G+    +RIWF N+R + 
Sbjct: 36 LTGDKQRRRTVLPKETKEFLESVFERKRWPNAKERRAIAEKCGLTPIQIRIWFTNKRMRS 95

Query: 61 R 61
          +
Sbjct: 96 K 96

>ADL394C [1347] [Homologous to ScYCR097W (HMRA1) - NSH]
          (18058..18366) [309 bp, 102 aa]
          Length = 102

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 33/61 (54%)

Query: 1  MDGHTKSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKV 60
          + G  + +RT    E  + L+S F+    P+ +ER  I+E  G+    +RIWF N+R + 
Sbjct: 36 LTGDNQRRRTVLPKEPKEFLESVFERKRCPNAKERRAIAEKCGLTPIQIRIWFTNKRMRS 95

Query: 61 R 61
          +
Sbjct: 96 K 96

>YDR451C (YHP1) [1270] chr4 complement(1361108..1362169) Protein
           involved in transcriptional derepression during the M/G1
           phase of the cell cycle along with Yox1p, contains a
           homeodomain [1062 bp, 353 aa]
          Length = 353

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%)

Query: 17  LDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           L IL+++F   P P+  +R  +SE   M EK+V+IWFQN+R   +
Sbjct: 185 LGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAK 229

>Scas_641.12
          Length = 413

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 6   KSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           + KR R     L IL++ F+    PS Q R  +++   M +K V+IWFQN+R  ++
Sbjct: 184 RRKRRRTSSHELSILQAEFEKCSTPSKQVRLELAKRCSMTDKAVQIWFQNKRQSMK 239

>AER456W [2956] [Homologous to ScYCR097W (HMRA1) - NSH]
          complement(1512285..1512285,1512359..1512531) [174 bp,
          57 aa]
          Length = 57

 Score = 38.9 bits (89), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 28/47 (59%)

Query: 15 ESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
          E+ + L+S F+    P+ +ER  I+E  G+    +RIWF N+R + +
Sbjct: 5  ETKEFLESVFERKRCPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSK 51

>Kwal_33.12991
          Length = 91

 Score = 38.5 bits (88), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 8  KRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRR 57
          +RT    ++   L+S F+   +P+ +ER  I++  G+    VR+WF NRR
Sbjct: 40 RRTLFSKDTRLFLESVFEKKKSPNSRERKAIADKCGLTPVQVRVWFTNRR 89

>AER314W [2815] [Homologous to ScYML027W (YOX1) - SH; ScYDR451C
           (YHP1) - SH] complement(1218410..1219705) [1296 bp, 431
           aa]
          Length = 431

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 6   KSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRR 57
           + KR R     L IL+  F     PS ++R  ++    M EK V+IWFQN+R
Sbjct: 198 RRKRRRTSKHELTILQQEFDQCRTPSKEKRIELATRCNMTEKAVQIWFQNKR 249

>KLLA0C03135g complement(279869..280555)
           gi|10643642|gb|AAG21094.1|AF195067_2 Kluyveromyces
           lactis a1p, start by similarity
          Length = 228

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%)

Query: 8   KRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           KR+  K ES  IL+  F++   P+  ER  I++   +    VRIWF N+R + +
Sbjct: 158 KRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKRMRAK 211

>KLLA0B14553g complement(1278622..1279308) sp|Q9HG12 Kluyveromyces
           lactis A1p, start by similarity
          Length = 228

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%)

Query: 8   KRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61
           KR+  K ES  IL+  F++   P+  ER  I++   +    VRIWF N+R + +
Sbjct: 158 KRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKRMRAK 211

>Kwal_26.7595
          Length = 524

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 224 VASCSLSFDKTDEEINNRTDPANKQAELKLKVNKPPKFAVYFLNQPENNNTNQWCLCEDF 283
           VASC  S+ K  +E+ N  DP  K  EL+LK  K    ++Y+  +    +  Q  L +DF
Sbjct: 15  VASCKNSYLKRQKEVANSRDPLKKDLELRLKALK----SLYYGIKDREEDIIQ-ALQKDF 69

Query: 284 SEGKQ 288
              +Q
Sbjct: 70  RRSRQ 74

>Scas_720.1
          Length = 123

 Score = 31.2 bits (69), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 27  NPNPSLQERNRISELTGMPEKNVRIWFQN-RRAKV 60
           NP P++QE+  + ELTG+ +  +  WF N RR KV
Sbjct: 71  NPYPNVQEKKLLLELTGLTKVQLSNWFINVRRRKV 105

>YGL096W (TOS8) [1887] chr7 (325332..326162) Protein with weak
           similarity to Cup9p, contains a homeodomain [831 bp, 276
           aa]
          Length = 276

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 11/66 (16%)

Query: 6   KSKRTRAKGESLDILKSSFQL----------NPNPSLQERNRISELTGMPEKNVRIWFQN 55
           K K+ +A G+  ++ K++  +          NP P++QE+  +   TG+ +  +  WF N
Sbjct: 188 KEKKHKAHGKRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFIN 247

Query: 56  -RRAKV 60
            RR K+
Sbjct: 248 ARRRKI 253

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,106,851
Number of extensions: 704205
Number of successful extensions: 2376
Number of sequences better than 10.0: 43
Number of HSP's gapped: 2435
Number of HSP's successfully gapped: 50
Length of query: 507
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 401
Effective length of database: 12,926,601
Effective search space: 5183567001
Effective search space used: 5183567001
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 64 (29.3 bits)