Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L05830g2162139821e-137
Kwal_14.2186465491245e-08
ADL029W53538810.017
Kwal_33.15434505101700.44
YKL124W (SSH4)57937616.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L05830g
         (213 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L05830g 649514..650164 no similarity, hypothetical start         382   e-137
Kwal_14.2186                                                           52   5e-08
ADL029W [1713] [Homologous to ScYGL170C (SPO74) - SH] complement...    36   0.017
Kwal_33.15434                                                          32   0.44 
YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confer...    28   6.2  

>CAGL0L05830g 649514..650164 no similarity, hypothetical start
          Length = 216

 Score =  382 bits (982), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 191/213 (89%), Positives = 191/213 (89%)

Query: 1   MAHSRTFTEQLHHLRCLNDEILKTTDDINESLVESEITHIESKSVGESIXXXXXXXXXMK 60
           MAHSRTFTEQLHHLRCLNDEILKTTDDINESLVESEITHIESKSVGESI         MK
Sbjct: 1   MAHSRTFTEQLHHLRCLNDEILKTTDDINESLVESEITHIESKSVGESITTATTTTFTMK 60

Query: 61  QNSEIVHYLLPFLNSLIKSFYSFYEHINDVEQLDFQFSQFRKSMTFSPVCKFSHNTTQTK 120
           QNSEIVHYLLPFLNSLIKSFYSFYEHINDVEQLDFQFSQFRKSMTFSPVCKFSHNTTQTK
Sbjct: 61  QNSEIVHYLLPFLNSLIKSFYSFYEHINDVEQLDFQFSQFRKSMTFSPVCKFSHNTTQTK 120

Query: 121 DLVGTEVVNKNEWYEYHNGNMTKLFEXXXXXXXXXXXXXNAYNNKHNSLKTNYQLDILYS 180
           DLVGTEVVNKNEWYEYHNGNMTKLFE             NAYNNKHNSLKTNYQLDILYS
Sbjct: 121 DLVGTEVVNKNEWYEYHNGNMTKLFEILDTILILQTQLLNAYNNKHNSLKTNYQLDILYS 180

Query: 181 IFIDPKSYGLKESDHVKSLRLEMFNVLLELFKS 213
           IFIDPKSYGLKESDHVKSLRLEMFNVLLELFKS
Sbjct: 181 IFIDPKSYGLKESDHVKSLRLEMFNVLLELFKS 213

>Kwal_14.2186
          Length = 465

 Score = 52.4 bits (124), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 34/49 (69%)

Query: 163 NNKHNSLKTNYQLDILYSIFIDPKSYGLKESDHVKSLRLEMFNVLLELF 211
           N +  S K + QL+ L++IF+DP+ YGL   DH+K LR EM  ++LE++
Sbjct: 238 NRELQSKKISSQLEFLFTIFLDPEQYGLLRQDHIKKLRQEMLEIMLEIW 286

>ADL029W [1713] [Homologous to ScYGL170C (SPO74) - SH]
           complement(648582..650189) [1608 bp, 535 aa]
          Length = 535

 Score = 35.8 bits (81), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 170 KTNYQLDILYSIFIDPKSYGLKESDHVKSLRLEMFNVL 207
           K + QL+ L +IF DPK  GL+  D+V+ LR ++  V+
Sbjct: 283 KVSQQLEYLATIFRDPKECGLRTEDYVEHLRKQLIEVI 320

>Kwal_33.15434
          Length = 505

 Score = 31.6 bits (70), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 45/101 (44%), Gaps = 23/101 (22%)

Query: 59  MKQNSEIVHYLL------PFLNSLIKSFYSFYEHINDVE----QLDFQFSQFRKSM---- 104
           +++N    H+++      P  NS    FY  Y+    VE    +LD +   FR       
Sbjct: 276 IRKNYGATHFIVGRDHAGPGKNSAGVDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPD 335

Query: 105 --TFSPVCKFSHNTTQTKDLVGTEVVNK-------NEWYEY 136
              ++P+ +   +TT+T ++ GTE+ N+        EW+ Y
Sbjct: 336 EDRYAPIDQIDLSTTKTLNISGTELRNRLRSGGAIPEWFSY 376

>YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confers
           resistance to immunosuppressive drug leflunomide upon
           overproduction [1740 bp, 579 aa]
          Length = 579

 Score = 28.1 bits (61), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 67  HYLLPFLNSLIKSFYSFYEHINDVEQLDFQFSQFRKS 103
           ++LLP +N  I  + +F       ++LD QFS+F KS
Sbjct: 178 YFLLPSINDNIDEYGNFLPSFIVQDKLDIQFSKFNKS 214

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,748,852
Number of extensions: 264114
Number of successful extensions: 841
Number of sequences better than 10.0: 9
Number of HSP's gapped: 841
Number of HSP's successfully gapped: 9
Length of query: 213
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 116
Effective length of database: 13,238,163
Effective search space: 1535626908
Effective search space used: 1535626908
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)