Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L05808g66552809e-35
AER370W80160571.5
Scas_465.370830526.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L05808g
         (65 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L05808g complement(639685..639885) no similarity, hypotheti...   112   9e-35
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    27   1.5  
Scas_465.3                                                             25   6.0  

>CAGL0L05808g complement(639685..639885) no similarity,
          hypothetical start
          Length = 66

 Score =  112 bits (280), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 55/55 (100%), Positives = 55/55 (100%)

Query: 1  MSAKISRKQSKSAIRDQGQDKRNPVDDKRLPAFQNTQMKRLVSPLEILSIFYDQL 55
          MSAKISRKQSKSAIRDQGQDKRNPVDDKRLPAFQNTQMKRLVSPLEILSIFYDQL
Sbjct: 1  MSAKISRKQSKSAIRDQGQDKRNPVDDKRLPAFQNTQMKRLVSPLEILSIFYDQL 55

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
           complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 26.6 bits (57), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 6/60 (10%)

Query: 2   SAKISRKQS------KSAIRDQGQDKRNPVDDKRLPAFQNTQMKRLVSPLEILSIFYDQL 55
           SA++S   S      KSA+R+    K +P D+K+    +    KRL   L  + +F + +
Sbjct: 320 SARLSTGHSYVCLAMKSALREGFHRKLSPEDEKKYSPLEQEMRKRLFYTLYKMEVFVNTM 379

>Scas_465.3
          Length = 708

 Score = 24.6 bits (52), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 2/30 (6%)

Query: 24  PVDDKRLPAFQNTQMKRLVSPL--EILSIF 51
           P D+  LP  QNT+++R++S +  E  S+F
Sbjct: 604 PTDEVILPELQNTKIQRILSSMWREESSLF 633

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,645,021
Number of extensions: 47054
Number of successful extensions: 147
Number of sequences better than 10.0: 5
Number of HSP's gapped: 147
Number of HSP's successfully gapped: 5
Length of query: 65
Length of database: 16,596,109
Length adjustment: 38
Effective length of query: 27
Effective length of database: 15,280,625
Effective search space: 412576875
Effective search space used: 412576875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)