Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L05786g34834313110.0
Scas_602.4266613096e-33
Scas_707.46338643111e-32
YPR013C317613082e-32
CAGL0J01595g344593022e-31
Scas_602.4d256642947e-31
YPR015C247642892e-30
KLLA0A04609g423572305e-21
Scas_656.1*102532049e-20
AEL077W336592162e-19
Scas_710.9505622122e-18
ADL040W330562074e-18
KLLA0F20636g285521992e-17
Sklu_2398.2288621974e-17
ADR308C278561941e-16
Kwal_26.8011190541854e-16
Scas_718.36d330641907e-16
AGL207W277561833e-15
KLLA0F11682g374541792e-14
Scas_717.17d350511765e-14
CAGL0M01870g315511731e-13
Sklu_2244.3271541692e-13
ADL042W281521692e-13
Scas_717.18354521703e-13
Kwal_27.10467302541693e-13
Kwal_14.2206254561673e-13
ADL051W173551624e-13
ADL050W146531501e-11
AGR186C287581561e-11
KLLA0F22319g203481503e-11
CAGL0M06831g645561252e-07
Scas_711.56832551208e-07
Scas_697.35839561201e-06
Kwal_14.2543711551191e-06
ACR264W769561191e-06
CAGL0E01331g689691191e-06
CAGL0L03916g642561182e-06
CAGL0M04323g703651182e-06
AGL197W844661172e-06
YOR113W (AZF1)914551163e-06
YNL027W (CRZ1)678561153e-06
CAGL0K12078g463641135e-06
Kwal_47.17888786561146e-06
KLLA0A10373g206601097e-06
KLLA0F01463g781551137e-06
Scas_709.32822561128e-06
YJL056C (ZAP1)880551129e-06
KLLA0E18645g431501101e-05
AEL174W661551102e-05
Kwal_56.23925745661092e-05
Scas_695.2571561083e-05
KLLA0F23782g782551073e-05
CAGL0J05060g713551074e-05
YDR043C (NRG1)231661044e-05
Scas_713.52620511064e-05
ADL198W547561065e-05
AFR471C389521046e-05
Kwal_27.11460531561046e-05
Scas_693.31635561047e-05
CAGL0A01628g424511039e-05
YER028C394571021e-04
Scas_687.33288521011e-04
CAGL0M13189g541551012e-04
KLLA0D16456g854661022e-04
CAGL0C02519g318521002e-04
Sklu_2389.2767811012e-04
Scas_712.42*29057992e-04
YLR131C (ACE2)770541002e-04
YGL035C (MIG1)504511002e-04
CAGL0K03003g647511003e-04
Sklu_2351.654851993e-04
Kwal_23.540042954983e-04
YDR146C (SWI5)70956993e-04
Kwal_14.227846351983e-04
AGL071C39651984e-04
KLLA0B00605g23956964e-04
YMR070W (MOT3)49055975e-04
Scas_717.1752554975e-04
ABR089C57155976e-04
Kwal_47.1904526652956e-04
CAGL0L07480g31456958e-04
CAGL0I02816g29148948e-04
YGL209W (MIG2)38257959e-04
CAGL0F05995g59754950.001
KLLA0F26961g69455950.001
Scas_575.345551940.001
KLLA0E10989g47452940.001
KLLA0E08679g59656940.001
Kwal_26.802150750940.001
Scas_649.2873055940.001
Scas_718.4426654920.002
YKL062W (MSN4)63055930.002
Kwal_26.835169855930.002
Scas_712.232751910.002
CAGL0H07557g47656920.002
Kwal_27.1092526459900.003
Scas_569.229366900.003
Sklu_2443.2221347880.003
Scas_378.120850870.005
Scas_670.243556890.005
YMR037C (MSN2)70462890.006
Sklu_2289.129152870.006
KLLA0F07073g55857880.006
AER159C119147890.006
Scas_631.743349880.007
YGL254W (FZF1)29955870.007
Sklu_2357.715756840.008
AGR031W14062830.008
KLLA0F18524g35759870.008
CAGL0M00594g102056870.010
Kwal_27.1016728553850.012
YDR216W (ADR1)132353860.013
KLLA0B04477g133247860.014
CAGL0K02145g31752840.016
CAGL0K09372g39657840.018
KLLA0B03454g47253840.018
Kwal_47.1724140352840.020
CAGL0H04213g132147830.027
CAGL0K04697g51559830.029
Scas_683.3047861820.031
YDL048C (STP4)49058820.035
YPR186C (PZF1)42949810.041
Scas_707.3128955800.045
YLR375W34358800.047
YBR066C (NRG2)22061790.048
Kwal_47.16621117847810.053
Sklu_2181.141052800.062
Scas_602.954752790.072
AEL278W47655790.076
Scas_703.23134147790.087
CAGL0H04873g45162790.088
Scas_721.92115247790.089
ACL057W52052780.12
Sklu_2206.235860760.15
Scas_683.2587959770.16
CAGL0K02343g116273750.29
YML081W125147750.30
CAGL0E06116g61346740.32
ACR164C86840730.44
Kwal_26.930030461720.46
YER130C44352720.49
YPL230W39144720.53
KLLA0C17072g47452710.68
AFR580C83853720.71
Scas_627.6120760710.80
AFR445C19985690.83
YJR127C (ZMS1)138047701.1
CAGL0K04631g101356701.1
KLLA0F13046g137947701.2
YMR182C (RGM1)21146671.6
KLLA0B07909g92249672.7
Scas_719.68135052673.0
KLLA0C17710g82159653.9
Sklu_1749.260066644.9
Kwal_47.1657788133645.2
YPR022C113366645.7
AGR117C79949646.5
Scas_703.350865636.8
Sklu_2126.544824637.1
CAGL0E03762g58432637.3
YGR067C79453637.3
Kwal_56.2345382849637.4
YER169W (RPH1)79649628.7
CAGL0L11880g98049629.0
Sklu_2359.572258629.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L05786g
         (343 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L05786g complement(636176..637222) some similarities with t...   509   0.0  
Scas_602.4                                                            123   6e-33
Scas_707.46                                                           124   1e-32
YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...   123   2e-32
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...   120   2e-31
Scas_602.4d                                                           117   7e-31
YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...   115   2e-30
KLLA0A04609g complement(411494..412765) some similarities with s...    93   5e-21
Scas_656.1*                                                            83   9e-20
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    88   2e-19
Scas_710.9                                                             86   2e-18
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    84   4e-18
KLLA0F20636g complement(1914452..1915309) some similarities with...    81   2e-17
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                80   4e-17
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    79   1e-16
Kwal_26.8011                                                           76   4e-16
Scas_718.36d                                                           78   7e-16
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    75   3e-15
KLLA0F11682g complement(1068992..1070116) some similarities with...    74   2e-14
Scas_717.17d                                                           72   5e-14
CAGL0M01870g complement(219813..220760) some similarities with t...    71   1e-13
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                70   2e-13
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    70   2e-13
Scas_717.18                                                            70   3e-13
Kwal_27.10467                                                          70   3e-13
Kwal_14.2206                                                           69   3e-13
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    67   4e-13
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    62   1e-11
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    65   1e-11
KLLA0F22319g complement(2086613..2087224) some similarities with...    62   3e-11
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    53   2e-07
Scas_711.56                                                            51   8e-07
Scas_697.35                                                            51   1e-06
Kwal_14.2543                                                           50   1e-06
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    50   1e-06
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    50   1e-06
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    50   2e-06
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    50   2e-06
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    50   2e-06
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    49   3e-06
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    49   3e-06
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    48   5e-06
Kwal_47.17888                                                          49   6e-06
KLLA0A10373g complement(907244..907864) some similarities with c...    47   7e-06
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    48   7e-06
Scas_709.32                                                            48   8e-06
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    48   9e-06
KLLA0E18645g complement(1648263..1649558) some similarities with...    47   1e-05
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    47   2e-05
Kwal_56.23925                                                          47   2e-05
Scas_695.2                                                             46   3e-05
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    46   3e-05
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    46   4e-05
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    45   4e-05
Scas_713.52                                                            45   4e-05
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    45   5e-05
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    45   6e-05
Kwal_27.11460                                                          45   6e-05
Scas_693.31                                                            45   7e-05
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    44   9e-05
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    44   1e-04
Scas_687.33                                                            44   1e-04
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    44   2e-04
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    44   2e-04
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    43   2e-04
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            44   2e-04
Scas_712.42*                                                           43   2e-04
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    43   2e-04
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    43   2e-04
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    43   3e-04
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       43   3e-04
Kwal_23.5400                                                           42   3e-04
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    43   3e-04
Kwal_14.2278                                                           42   3e-04
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    42   4e-04
KLLA0B00605g complement(46736..47455) some similarities with sp|...    42   4e-04
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    42   5e-04
Scas_717.17                                                            42   5e-04
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    42   6e-04
Kwal_47.19045                                                          41   6e-04
CAGL0L07480g complement(822240..823184) some similarities with s...    41   8e-04
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    41   8e-04
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    41   9e-04
CAGL0F05995g complement(598819..600612) some similarities with s...    41   0.001
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    41   0.001
Scas_575.3                                                             41   0.001
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    41   0.001
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    41   0.001
Kwal_26.8021                                                           41   0.001
Scas_649.28                                                            41   0.001
Scas_718.44                                                            40   0.002
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    40   0.002
Kwal_26.8351                                                           40   0.002
Scas_712.2                                                             40   0.002
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    40   0.002
Kwal_27.10925                                                          39   0.003
Scas_569.2                                                             39   0.003
Sklu_2443.22 , Contig c2443 45390-46027                                39   0.003
Scas_378.1                                                             38   0.005
Scas_670.2                                                             39   0.005
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    39   0.006
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          38   0.006
KLLA0F07073g 675221..676897 some similarities with sgd|S0004367 ...    39   0.006
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    39   0.006
Scas_631.7                                                             39   0.007
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    38   0.007
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        37   0.008
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    37   0.008
KLLA0F18524g complement(1701498..1702571) some similarities with...    38   0.008
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    38   0.010
Kwal_27.10167                                                          37   0.012
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    38   0.013
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    38   0.014
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    37   0.016
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    37   0.018
KLLA0B03454g complement(314015..315433) some similarities with s...    37   0.018
Kwal_47.17241                                                          37   0.020
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    37   0.027
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    37   0.029
Scas_683.30                                                            36   0.031
YDL048C (STP4) [816] chr4 complement(366739..368211) Protein wit...    36   0.035
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    36   0.041
Scas_707.31                                                            35   0.045
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    35   0.047
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    35   0.048
Kwal_47.16621                                                          36   0.053
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            35   0.062
Scas_602.9                                                             35   0.072
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    35   0.076
Scas_703.23                                                            35   0.087
CAGL0H04873g complement(465069..466424) some similarities with t...    35   0.088
Scas_721.92                                                            35   0.089
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    35   0.12 
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            34   0.15 
Scas_683.25                                                            34   0.16 
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    33   0.29 
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    33   0.30 
CAGL0E06116g complement(604708..606549) some similarities with t...    33   0.32 
ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH] (640832..64...    33   0.44 
Kwal_26.9300                                                           32   0.46 
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    32   0.49 
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    32   0.53 
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    32   0.68 
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    32   0.71 
Scas_627.6                                                             32   0.80 
AFR445C [3637] [Homologous to ScYHR189W - SH] (1239916..1240515)...    31   0.83 
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    32   1.1  
CAGL0K04631g complement(440721..443762) some similarities with s...    32   1.1  
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    32   1.2  
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    30   1.6  
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    30   2.7  
Scas_719.68                                                            30   3.0  
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...    30   3.9  
Sklu_1749.2 YGL192W, Contig c1749 3200-5002                            29   4.9  
Kwal_47.16577                                                          29   5.2  
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    29   5.7  
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...    29   6.5  
Scas_703.3                                                             29   6.8  
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            29   7.1  
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    29   7.3  
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    29   7.3  
Kwal_56.23453                                                          29   7.4  
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...    28   8.7  
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...    28   9.0  
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          28   9.8  

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/343 (75%), Positives = 259/343 (75%)

Query: 1   MNNYMLMHQNNYQYPVQVQTPVPMXXXXXXXXXXXXXXXXILPLTSNANAGYHNTNVVNS 60
           MNNYMLMHQNNYQYPVQVQTPVPM                ILPLTSNANAGYHNTNVVNS
Sbjct: 1   MNNYMLMHQNNYQYPVQVQTPVPMPNHQHQQAGAAQPANHILPLTSNANAGYHNTNVVNS 60

Query: 61  QERGNITLPPISSIVGNCVPPQAQQQDVCVQAHVAEPYPQYQSITHNNGMIKGGQQYHYY 120
           QERGNITLPPISSIVGNCVPPQAQQQDVCVQAHVAEPYPQYQSITHNNGMIKGGQQYHYY
Sbjct: 61  QERGNITLPPISSIVGNCVPPQAQQQDVCVQAHVAEPYPQYQSITHNNGMIKGGQQYHYY 120

Query: 121 VPPPRAITPCLSSQGSPSFSHSNLVMVPKLDKQTSYLNANGTVVMDRTPXXXXXXXXXXX 180
           VPPPRAITPCLSSQGSPSFSHSNLVMVPKLDKQTSYLNANGTVVMDRTP           
Sbjct: 121 VPPPRAITPCLSSQGSPSFSHSNLVMVPKLDKQTSYLNANGTVVMDRTPSNYSNSSLVSY 180

Query: 181 XXXXAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVFEGRTTDISRTASTSPKTPSLPDS 240
               AE                            TVFEGRTTDISRTASTSPKTPSLPDS
Sbjct: 181 NSQNAESPGMTTPMSTPPSAFSSRSASASGMPMPTVFEGRTTDISRTASTSPKTPSLPDS 240

Query: 241 SKSIRKSTEGXXXXXXXXXXXXXXXXXXXXXXXXXAIDELSKLRKQCPVCGKVCSRPSTL 300
           SKSIRKSTEG                         AIDELSKLRKQCPVCGKVCSRPSTL
Sbjct: 241 SKSIRKSTEGIKKSKSKSQSPKTKSKVTPTSITVSAIDELSKLRKQCPVCGKVCSRPSTL 300

Query: 301 KTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQA 343
           KTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQA
Sbjct: 301 KTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQA 343

>Scas_602.4
          Length = 266

 Score =  123 bits (309), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 55/61 (90%)

Query: 280 LSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           LSKLRKQCP CGK+CSRPSTLK HYLIHTGDTPFKC W +C KAFNVKSNMLRHLK HE+
Sbjct: 195 LSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254

Query: 340 K 340
           K
Sbjct: 255 K 255

>Scas_707.46
          Length = 338

 Score =  124 bits (311), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 51/64 (79%), Positives = 59/64 (92%)

Query: 277 IDELSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336
           ++  S+LRKQCPVCGK+CSRPSTLKTHYLIHTGDTPF+CPWK C K+FNVKSNMLRHLK 
Sbjct: 262 LNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKS 321

Query: 337 HERK 340
           H++K
Sbjct: 322 HQKK 325

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score =  123 bits (308), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 57/61 (93%)

Query: 281 SKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           +KLRKQCPVCGK+CSRPSTLKTHYLIHTGDTPFKC W+ C K+FNVKSNMLRHLK HERK
Sbjct: 250 TKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309

Query: 341 K 341
           +
Sbjct: 310 R 310

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score =  120 bits (302), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 50/59 (84%), Positives = 56/59 (94%)

Query: 281 SKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           ++LRKQCPVCGK+CSRPSTLKTH LIHTGDTPFKC WKDC+KAFNVKSN+LRHLK HE+
Sbjct: 280 TRLRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHEK 338

>Scas_602.4d
          Length = 256

 Score =  117 bits (294), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (87%)

Query: 278 DELSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
            +L K  K+CPVCGK+CSRPSTLKTH+LIHTGDTPFKC +  CKK+FNVKSNM RHLKCH
Sbjct: 188 QQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247

Query: 338 ERKK 341
           ERKK
Sbjct: 248 ERKK 251

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score =  115 bits (289), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 57/64 (89%)

Query: 277 IDELSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336
           +  + KLRKQCP+CGKVCSRPSTL+THYLIHTGDTPFKC W+ C K+FNVKSNMLRHL+ 
Sbjct: 177 LRAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRT 236

Query: 337 HERK 340
           H++K
Sbjct: 237 HQKK 240

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 93.2 bits (230), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 38/57 (66%), Positives = 46/57 (80%)

Query: 284 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           + QC +CG++CSRPSTL+TH  IHTGD P+KCP ++C K FNVKSNMLRH K HE K
Sbjct: 340 KNQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRHEFK 396

>Scas_656.1*
          Length = 102

 Score = 83.2 bits (204), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 42/53 (79%)

Query: 285 KQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           +QCP+CGK+ +R S+L+TH L+HTGD PFKC W +C K FNVKSNM RH K H
Sbjct: 40  RQCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLH 92

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 87.8 bits (216), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (74%)

Query: 283 LRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           +R QCPVCGKVC RPS+L+ H  IHTG  PF C W  C+K FNVKSNM+RH + H+ ++
Sbjct: 272 VRNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQLQR 330

>Scas_710.9
          Length = 505

 Score = 86.3 bits (212), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (72%)

Query: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           K +KQC +CGKV +R S+L+TH LIHTG  PF C W  CKK FNVKSNM RHLK H  K+
Sbjct: 444 KRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLHLIKE 503

Query: 342 QA 343
            +
Sbjct: 504 DS 505

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 84.3 bits (207), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 35/56 (62%), Positives = 43/56 (76%)

Query: 285 KQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           K C VCG+ C+RPSTLKTH LIHTG+ PF+C W  C K FNV+SNM RH+  H+R+
Sbjct: 258 KTCLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSHKRR 313

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 31/52 (59%), Positives = 40/52 (76%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHE 338
           C  CGK  +RPS L+TH L+H+GD PF+C W+ C K FNVKSN++RHLK H+
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLHK 285

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 80.5 bits (197), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 42/62 (67%)

Query: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           KL+  CP CGK   RPS LKTH +IH G +P+ C W  C K FNVK N+LRH + H +KK
Sbjct: 215 KLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTKKK 274

Query: 342 QA 343
           +A
Sbjct: 275 EA 276

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 38/56 (67%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           C VCG+ C RPSTLKTH L HTG  PF C    C K+FNV+SNMLRH + H R  +
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHSRGSE 261

>Kwal_26.8011
          Length = 190

 Score = 75.9 bits (185), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           QC +C K+ SR S L+ H L HTG  PF+CP+  C K FNVKSNM+RHLK H++
Sbjct: 129 QCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTHKQ 182

>Scas_718.36d
          Length = 330

 Score = 77.8 bits (190), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 276 AIDELSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLK 335
           A DE  KL   C VCGK   RPS+L+TH  I +G+ P+KCP+ +C K+FN KSNMLRH K
Sbjct: 232 AFDE--KLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYK 289

Query: 336 CHER 339
            H R
Sbjct: 290 LHFR 293

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 40/56 (71%)

Query: 284 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           R  C  CGK  +R S+L+TH  IHTGD PF CP+K+C K+FN +SNMLRH K H R
Sbjct: 182 RYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFR 237

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%)

Query: 284 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           + +C  CGK  +RPS+L TH  IHTGD P+KC + +C K FN KSNMLRH K H
Sbjct: 303 KYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLH 356

>Scas_717.17d
          Length = 350

 Score = 72.4 bits (176), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 37/51 (72%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           C VCGK  +R ++L+TH LIHTG  PFKC W +CK + +VKSN+ RH K H
Sbjct: 287 CVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSH 337

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 36/51 (70%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           C VC K   RPS+L TH  IHTG+ P+ CP+ +C K+FN KSNMLRH K H
Sbjct: 175 CKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLH 225

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 36/54 (66%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           CP C K   RPS L+TH +IH G  PF C W +C K FNVKSN+LRH + H R+
Sbjct: 218 CPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSHNRE 271

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 37/52 (71%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHE 338
           C +CGK   RPS L+TH ++H  D P+ C  + C+K FNVKSNMLRH++ H+
Sbjct: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKHK 278

>Scas_717.18
          Length = 354

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 39/52 (75%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           +CP+C K+ +R ++L++H LIHTG+ P+KC W +C  + +VKSN+ RH K H
Sbjct: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348

>Kwal_27.10467
          Length = 302

 Score = 69.7 bits (169), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 36/54 (66%)

Query: 284 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           R  C  CGKV +RPS+L TH   HTGD P+ CP+ +C K FN +SNM RH K H
Sbjct: 197 RYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLH 250

>Kwal_14.2206
          Length = 254

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 38/56 (67%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           +C +CGK  SRPS L TH LIHTG  P+ C   +C K FNVKSN++RH K H + +
Sbjct: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 67.0 bits (162), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (70%)

Query: 285 KQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           K C +C K  +R ++L+TH LIHT   P++CP++ C K FNVKSN+ RH + H+R
Sbjct: 116 KTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIHKR 170

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 36/53 (67%)

Query: 285 KQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           K CPVC K  +R ++L TH LIH    P+ C + +C K+FNVKSN+ RHL+ H
Sbjct: 76  KTCPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIH 128

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 283 LRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           + K CP+CGK  +R STL+ H LIHT   PFKC +  C K FNVKSN+ RH + H +K
Sbjct: 165 VSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHERIHRQK 220

>KLLA0F22319g complement(2086613..2087224) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 203

 Score = 62.4 bits (150), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%)

Query: 291 GKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHE 338
           GK  SRPSTLKTH ++H+   PFKC + DC K++NVKSN+ RH K H+
Sbjct: 152 GKEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKHK 199

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           C VCGKV SRP  LK+H   HT + P++C    C KAF  + +  RH   H  KK+
Sbjct: 523 CEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLHTGKKR 576

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 26/63 (41%), Gaps = 7/63 (11%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWK-------DCKKAFNVKSNMLRHLKCHE 338
           QC +CGK  +R    K H  +HTG   + C  K        C K F     + RH K   
Sbjct: 550 QCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHFKTSS 609

Query: 339 RKK 341
            +K
Sbjct: 610 GRK 612

>Scas_711.56
          Length = 832

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           +C +CGK  +  S+LK H   HTG+ P  C  K C KAFN  SN+ +H+K H ++
Sbjct: 755 KCDICGKRFAISSSLKIHIRTHTGEKPLHC--KICGKAFNESSNLSKHMKTHLKR 807

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           QC +C K  S   TLK H   H+G+ PFKC    C K F + S++  H++ H  +K
Sbjct: 727 QCSICKKHFSNEETLKQHERTHSGEKPFKCDI--CGKRFAISSSLKIHIRTHTGEK 780

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 290 CGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           C K+ S+   L  H  +H+G  PF+C    CKK F+ +  + +H + H  +K
Sbjct: 703 CHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERTHSGEK 752

 Score = 32.3 bits (72), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 19/29 (65%)

Query: 309 GDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           G + ++C W +C K F+ +  ++RH++ H
Sbjct: 692 GQSQYECHWANCHKIFSQRQRLVRHMRVH 720

>Scas_697.35
          Length = 839

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           QC  CGK  ++   L+TH  +HTG+ P++C    C K F+ K N+  HL  H++ K
Sbjct: 544 QCGYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CDKKFSRKGNLAAHLLTHQKVK 597

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 22/48 (45%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           +C +C K  SR   L  H L H    PF C   +C ++F    NM  H
Sbjct: 572 ECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAH 619

 Score = 36.6 bits (83), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           +CP C ++ ++ + L+ H   H G  P++C +  C K F    N+  H + H  +K
Sbjct: 516 KCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLRTHQRLHTGEK 569

>Kwal_14.2543
          Length = 711

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           +C  CGK  +  S+L+ H   HTG+ P +C  K C K FN  SN+ +H++ HERK
Sbjct: 635 KCSHCGKGFATSSSLRIHIRTHTGEKPLEC--KVCGKRFNESSNLSKHMRTHERK 687

 Score = 32.7 bits (73), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 19/33 (57%)

Query: 309 GDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           G + + C W++C +    +  +LRHL+ H R K
Sbjct: 572 GKSSYVCGWENCGRVITQRQKLLRHLRVHTRYK 604

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 290 CGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           CG+V ++   L  H  +HT   P KC    C K F+ +  + +H++ H  +K
Sbjct: 583 CGRVITQRQKLLRHLRVHTRYKPCKCV--HCLKTFSTQDILQQHMRTHSGEK 632

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           QC  CGK  ++   L+TH  +HTG+ P++C    C K F+ K N+  H+  HE  K
Sbjct: 516 QCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTHENYK 569

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 23/48 (47%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           +C  CGK  SR   L  H L H    PF+C   DC K+F    NM  H
Sbjct: 544 ECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAH 591

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           +CP C K  ++ + L+ H   H G  PF+C +  C K F    N+  H++ H
Sbjct: 488 KCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 537

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 277 IDELSKLRKQC--PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHL 334
           + EL     +C  P CGK   R   +++H   H  D P++C +  C KAF    +++RH 
Sbjct: 548 VKELPDRMYECLYPQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHK 607

Query: 335 KCHERKKQA 343
           K H+ K  A
Sbjct: 608 KTHQEKSYA 616

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           +C  CGK  ++   L+TH  +HTG+ PFKC    C K F  + N+  H   HE  K
Sbjct: 509 ECEFCGKRFTQAGNLRTHRRLHTGERPFKC--DKCDKTFARRGNLTAHEFTHESIK 562

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           QC  C K+ S+ + L  H   H G  PF+C +  C K F    N+  H + H
Sbjct: 481 QCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLH 530

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 20/48 (41%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           +C  C K  +R   L  H   H    P+ C   +C K F+   NM  H
Sbjct: 537 KCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKSH 584

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 277 IDELSKLRKQC--PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHL 334
           + EL     +C  P CGK   R   +K+H   H  D P+KC ++ C KAF    ++ RH 
Sbjct: 515 VKELPDKNFECLFPNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHK 574

Query: 335 KCHER 339
           K H++
Sbjct: 575 KTHDK 579

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 277 IDELSKLRKQC--PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHL 334
           I +L     QC  P CGK+ +R   +++H   H  D PF+C  + C KAF    +++RH 
Sbjct: 666 IKKLQDKTFQCLYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHK 725

Query: 335 KCHERK 340
           K H  K
Sbjct: 726 KTHAEK 731

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 22/46 (47%)

Query: 292 KVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           K  + P      Y+    D  F+C + +C K FN + N+  H++ H
Sbjct: 653 KASNLPQGEIDQYIKKLQDKTFQCLYPECGKLFNRRYNIRSHIQTH 698

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           C  CGK  ++   L+TH  +HTG+ P+ C    C K F+ K N+  HL  H++ K
Sbjct: 623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQKLK 675

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 284 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           + +CP C ++ S+ + L+ H   H G  PF C +  C K F    N+  H + H  +K
Sbjct: 592 KHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEK 647

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 21/47 (44%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           C +C K  SR   L  H + H    PF C  ++C K F    NM  H
Sbjct: 651 CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 697

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           C VCGK  +RP  LK+H   HT + PF C    C KAF  + +  RH   H  KK+
Sbjct: 571 CDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKKR 624

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 9/63 (14%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKC--------PWKDCKKAFNVKSNMLRHLKCHE 338
           C +CGK  +R    K H  +HTG   + C        PW  C K F     + RH K   
Sbjct: 599 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWG-CGKKFARSDALGRHFKTES 657

Query: 339 RKK 341
            ++
Sbjct: 658 GRR 660

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 278 DELSKLRKQ-CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336
           D++   RK  C VCGK  +    L  H  IHTG+    CP++ C + FN   N L+H K 
Sbjct: 394 DDIELRRKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKT 453

Query: 337 HERK 340
           H ++
Sbjct: 454 HLKR 457

>Kwal_47.17888
          Length = 786

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           QC  CGK  ++   L+TH  +HTG+ P++C  + C + F+ K N+  H   HE  K
Sbjct: 532 QCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLTHENLK 585

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 21/48 (43%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           +C  CG+  SR   L  H L H    PF C    C K+F    NM  H
Sbjct: 560 ECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAH 607

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           +CP C K  ++ + L+ H   H G  PF+C +  C K F    N+  H++ H  +K
Sbjct: 504 ECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLHTGEK 557

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 284 RKQCPV--CGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           R  CP+  CGK  SRP  L+ H   HT + PF CP   C KAF   S++  H+  H + K
Sbjct: 7   RYVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHMLSHSKVK 66

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 288 PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           P C K   RPS L+ H L H+   P+ C    C K F  K    RH + H
Sbjct: 43  PGCDKAFLRPSHLRVHMLSHSKVKPYNC--SVCGKGFATKQQFQRHQQTH 90

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           +C +C K  S  S+L+ H   HTG+ P  CP   C K FN  SN+ +H++ H+R+
Sbjct: 721 KCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPI--CNKRFNESSNLAKHIRTHKRE 773

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           +C  CGK  +    L  H  +H+G+ PFKC    C K+++  S++  H++ H  +K
Sbjct: 693 RCAECGKCFNTQDILTQHLRVHSGERPFKCHL--CPKSYSTSSSLRIHIRTHTGEK 746

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 290 CGKVCSRPSTLKTH---YLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           C K      +L  H   + + +G + +KC W+ C K F  K  ++RHLK H + K
Sbjct: 636 CNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHLKVHSKYK 690

 Score = 35.0 bits (79), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 280 LSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           LS  + +   C KV  +   L  H  +H+   PF+C   +C K FN +  + +HL+ H  
Sbjct: 659 LSSYKCEWEGCNKVFVQKQKLIRHLKVHSKYKPFRCA--ECGKCFNTQDILTQHLRVHSG 716

Query: 340 KK 341
           ++
Sbjct: 717 ER 718

>Scas_709.32
          Length = 822

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 286 QCPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           +C  CGK   R   LK H   +H+ + PF CP   C K F+   N+ +H+K H+++
Sbjct: 766 KCETCGKAFRRSEHLKRHIRSVHSSERPFACPT--CDKKFSRSDNLAQHIKTHKKR 819

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           +C +C K  +  S+LK H   HTG+ P +C  K C K FN  SN+ +H+K H++K
Sbjct: 797 KCHICNKKFAISSSLKIHIRTHTGEKPLQC--KICGKRFNESSNLSKHIKTHQKK 849

 Score = 36.2 bits (82), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           +C  C +  S   TL  H   H+G+ P+KC    C K F + S++  H++ H  +K
Sbjct: 769 KCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTHTGEK 822

 Score = 35.8 bits (81), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 290 CGKVCSRPSTLKTHY-LIHT--GDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           C K  S    L  H   +H   G + ++C W DC + F  +  ++RHLK H + K
Sbjct: 712 CNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYK 766

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLK 335
           QC +C K   R S LK H L H+    F CPW  C      K N+L+HLK
Sbjct: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
            C  C K  S  S+L+ H   HTG+ P  C    C K FN  SN+ +H+K HERK
Sbjct: 573 HCHYCRKQFSTSSSLRVHIRTHTGEKPLSCTV--CGKRFNESSNLSKHMKIHERK 625

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           CP C K  S    L  H   H+G+ PF C +  C+K F+  S++  H++ H  +K
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTHTGEK 598

>Kwal_56.23925
          Length = 745

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 277 IDELSKLRKQC--PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHL 334
           + EL     +C  P CGK   R   +++H   H  D P+ C ++ C KAF    +++RH 
Sbjct: 577 VKELPDKTFECLHPDCGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHK 636

Query: 335 KCHERK 340
           K H  K
Sbjct: 637 KTHAEK 642

>Scas_695.2
          Length = 571

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           C +C K  +RP  LK+H   HT + PF C    C KAF  + +  RH   H  KK+
Sbjct: 454 CELCDKTFTRPYNLKSHLRTHTNEXPFVCNI--CGKAFARQHDRKRHEDLHTGKKR 507

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 26/63 (41%), Gaps = 9/63 (14%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKC--------PWKDCKKAFNVKSNMLRHLKCHE 338
           C +CGK  +R    K H  +HTG   + C        PW  C K F     + RH K   
Sbjct: 482 CNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWG-CHKKFARSDALGRHFKTDS 540

Query: 339 RKK 341
            +K
Sbjct: 541 GRK 543

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           C  CGK  ++   L+TH  +HTG+ P++C  + C + F+ K N+  H   H+  K
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYEC--ERCGRKFSRKGNLAAHKLTHDNLK 605

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 22/48 (45%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           +C  CG+  SR   L  H L H    PF+C   DC K F    NM  H
Sbjct: 580 ECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAH 627

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           QCP C K  ++ + L+ H   H G  PF C +  C K F    N+  H++ H  +K
Sbjct: 524 QCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLHTGEK 577

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           +C +C K  +  ++LK H   HTG+ P KC  K C + FN  SN+ +H+K H +K
Sbjct: 626 ECHICHKRFAISNSLKIHIRTHTGEKPLKC--KVCGRCFNESSNLSKHMKTHMKK 678

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           QCP C K  S   TL  H  +H+G+ P++C    C K F + +++  H++ H  +K
Sbjct: 598 QCPQCQKCFSTEDTLNQHKRVHSGEKPYECHI--CHKRFAISNSLKIHIRTHTGEK 651

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 309 GDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           G + + C W+ C K F+ +  ++RHLK H + K
Sbjct: 563 GKSQYTCEWEGCNKTFSQRQKLVRHLKVHSKYK 595

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 290 CGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           C K  S+   L  H  +H+   P++CP   C+K F+ +  + +H + H  +K
Sbjct: 574 CNKTFSQRQKLVRHLKVHSKYKPYQCP--QCQKCFSTEDTLNQHKRVHSGEK 623

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 278 DELSKLRKQ-CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336
           ++L + RK  C +C +  +    L  H  IHTG+    CP+K C + F+   N L+H + 
Sbjct: 166 EDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225

Query: 337 HERKKQ 342
           H +K Q
Sbjct: 226 HLKKGQ 231

>Scas_713.52
          Length = 620

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 290 CGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           CGK+  R   +++H   H  D P+ C +  C+KAF    +++RH K H  +
Sbjct: 487 CGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSHANR 537

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 292 KVCSRPSTLKTH----YLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           ++ ++PSTL       Y+    D  F+C ++DC K F  + N+  H++ H   K
Sbjct: 455 RITNKPSTLPRGTIDLYVKELPDKLFECLYEDCGKIFKRRYNVRSHIQTHLEDK 508

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           C +C K  +RP  LK+H   HT + PF C    C KAF  + +  RH   H  KK+
Sbjct: 428 CNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHDRKRHEDLHSGKKR 481

 Score = 34.7 bits (78), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 25/62 (40%), Gaps = 7/62 (11%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWK-------DCKKAFNVKSNMLRHLKCHER 339
           C VCGK  +R    K H  +H+G   + C  K        C K F     + RH K    
Sbjct: 456 CSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFKTESG 515

Query: 340 KK 341
           ++
Sbjct: 516 RR 517

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHE 338
           CP+C +   R      H   HTG+ P  C +  C K F+ +  + RH + HE
Sbjct: 24  CPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIHE 75

>Kwal_27.11460
          Length = 531

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           C +C K  +RP  LK+H   HT + PF C    C KAF  + +  RH   H  +K+
Sbjct: 415 CELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRHEDLHTGQKR 468

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 25/62 (40%), Gaps = 7/62 (11%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWK-------DCKKAFNVKSNMLRHLKCHER 339
           C +CGK  +R    K H  +HTG   + C  K        C K F     + RH K    
Sbjct: 443 CAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFKTEGG 502

Query: 340 KK 341
           K+
Sbjct: 503 KR 504

>Scas_693.31
          Length = 635

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%)

Query: 288 PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQA 343
           P CGK   R    ++H   H  D P+ C + +C KAF    +++RH K H  K  A
Sbjct: 494 PNCGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKKVHSEKSYA 549

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           CP+CG+   R      H   HTG+ P  C +  C K F+    + RH + H
Sbjct: 45  CPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 95

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           +C +C +   R    K H   HTG+ P KC  + C K+F+    + RHL+ H +  Q
Sbjct: 18  RCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGVQ 74

>Scas_687.33
          Length = 288

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           +CP+C +   R    K H   HTG+ P  C +  C K+F+    + RH++ H
Sbjct: 18  RCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIH 69

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 286 QCPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           QC  C K   R   LK H   +H+ + PF C +  C+K F+   N+ +HLK H+R
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTHKR 537

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 277 IDELSKLRKQCPV--CGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHL 334
           I E+   + QC    C K  +R    +TH   H  D P+KC +  C+KAF    ++LRH 
Sbjct: 685 ILEIGPKQFQCKFKDCQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHK 744

Query: 335 KCHERK 340
           K H  K
Sbjct: 745 KSHLEK 750

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 304 YLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           Y++  G   F+C +KDC+K FN + N   H++ H
Sbjct: 684 YILEIGPKQFQCKFKDCQKRFNRRYNARTHIQTH 717

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           +C +C +   R    K H+  HTG+ P KC +  C K+F+    + RH + H
Sbjct: 21  RCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTH 72

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 34/81 (41%), Gaps = 26/81 (32%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPW--------------------------KD 319
           +CP C K  S    L+ H   H+G+ PFKC +                          K 
Sbjct: 659 KCPHCTKKFSTEDILQQHIRTHSGERPFKCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI 718

Query: 320 CKKAFNVKSNMLRHLKCHERK 340
           C K FN  SN+ +H+K HERK
Sbjct: 719 CGKRFNESSNLSKHMKTHERK 739

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 290 CGKVCSRPSTLKTHYL---IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           C +V   P  L  H     I  G + ++C W  C K+F  +  +LRHLK H
Sbjct: 602 CSQVFPNPEALNNHIESQHIPRGQSSYQCSWDTCSKSFTQRQKLLRHLKVH 652

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 289 VCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
            C K  ++   L  H  +H+G  PFKCP   C K F+ +  + +H++ H  ++
Sbjct: 634 TCSKSFTQRQKLLRHLKVHSGYKPFKCP--HCTKKFSTEDILQQHIRTHSGER 684

>Scas_712.42*
          Length = 290

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           +C  C +   R    K H   HTG+ P  C +  C K F+    + RHL+ H    Q
Sbjct: 19  RCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTHTSTSQ 75

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%)

Query: 288 PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           P C KV  R   +++H   H  D P+ C +  C KAF    +++RH   H  KK
Sbjct: 608 PNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAKK 661

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 292 KVCSRPSTLK----THYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           K+  +P+TL       Y+    D  F+C + +C K F  + N+  H++ H
Sbjct: 578 KITKKPTTLPPGTIDQYVKELPDKLFECLYPNCNKVFKRRYNIRSHIQTH 627

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           CP+C +   R      H  IHTG+ P  C +  C K F+    + RH + H
Sbjct: 40  CPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336
           +C +C K+  R S LK H L H+    F CPW  C      + N+L+H+K 
Sbjct: 535 RCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPW--CNSRHKRRDNLLQHMKL 583

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           CP+C +   R      H   HTG+ P  C +  C K F+    + RH + H
Sbjct: 36  CPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH 86

>Kwal_23.5400
          Length = 429

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           QC VC +  SR + L+ H   H+ D PFKC +  C K    K  + RH   H R
Sbjct: 82  QCTVCARQFSRKTHLERHMFSHSEDKPFKCSY--CGKGVTTKQQLRRHEITHTR 133

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 290 CGKVCSRPSTLKTH-YLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           C K  SRPS L  H  ++H G  PF+C    C + F+ K+++ RH+  H   K
Sbjct: 57  CSKAFSRPSQLTEHQEVVHQGIKPFQCTV--CARQFSRKTHLERHMFSHSEDK 107

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 3/52 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDT---PFKCPWKDCKKAFNVKSNMLRHLK 335
           C +CGK   RP  LK H   H        ++C    C +AF   S + +H+K
Sbjct: 166 CEICGKRFQRPYRLKNHIAKHHNPDVVQKYQCSQGSCIEAFKTWSALQQHMK 217

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%)

Query: 288 PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQA 343
           P C K   R   +++H   H  D P+ C    C KAF    +++RH K H+ K  A
Sbjct: 555 PGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQEKAYA 610

>Kwal_14.2278
          Length = 463

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           CP+C +   R      H   HTG+ P  C +  C K F+    + RH + H
Sbjct: 25  CPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIH 75

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336
           +C  C K   R S LK H L H+   P+ CPW  C      K N+ +HLK 
Sbjct: 186 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKL 234

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           C +CG    R      H   HTG+ PF C    C K F+    + RH+K H + ++
Sbjct: 14  CEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFKSRK 69

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336
           K   QC  C K   R S LK H L H+    F CPW  C      K N+L+H+K 
Sbjct: 343 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 395

>Scas_717.17
          Length = 525

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           C +C K   R S LK H L H+ +  + CPW  C      + N+L+H+K    K
Sbjct: 390 CHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKHSK 441

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 286 QCPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           +C  C K   R   LK H   +H+ D PF C +  C K F+   N+ +HLK H +
Sbjct: 505 KCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTHRK 557

>Kwal_47.19045
          Length = 266

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           +C +CGK   R    + H   HTG+ P  C +  C K F+    + RH++ H
Sbjct: 15  KCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTH 66

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           C +C    +    L  H  IHTG+    CP + C ++F+   N L+H + H +KK+
Sbjct: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKKE 309

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           +C +C K  SR   L  H + H    PF C   +C K+F+   NM  H
Sbjct: 12  ECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSH 59

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           +C  C +   R    K H   HTG+ P  C +  C K+F+    + RH++ H  + Q
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQ 74

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           C +C K   R   LK H   +H+ D PF C    C+K F+   N+ +H+K H++
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHL--CEKKFSRSDNLSQHIKTHKK 588

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 286 QCPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           +C  C K   R   LK H   +H+ + PF C +  C K F+   N+ +HLK H++
Sbjct: 622 KCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTHKK 674

>Scas_575.3
          Length = 455

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           CP+C +   R      H   HTG+ P +C +  C K F+    + RH + H
Sbjct: 70  CPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIH 120

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHE 338
           CP+C +   R      H   HTG+ P  C +  C K F+    + RH + H+
Sbjct: 28  CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD 79

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           C +C K  +RP  LK+H   HT + P+ C    C KAF    +  RH   H  K++
Sbjct: 471 CDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLHTGKRR 524

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 24/63 (38%), Gaps = 9/63 (14%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKC--------PWKDCKKAFNVKSNMLRHLKCHE 338
           C VCGK  +R      H  +HTG   + C         W  C K F     + RH K   
Sbjct: 499 CSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWG-CGKKFARSDALGRHFKTEL 557

Query: 339 RKK 341
            KK
Sbjct: 558 GKK 560

>Kwal_26.8021
          Length = 507

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLK 335
           +C +C K   R S  K H L H+   P+ CPW  C+     + N+ +H+K
Sbjct: 390 RCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMK 437

>Scas_649.28
          Length = 730

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 286 QCPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           +C  C K   R   LK H   +H+ + PF C +  C+K F+   N+ +HLK H++
Sbjct: 674 KCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHKK 726

>Scas_718.44
          Length = 266

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           C +C    +    L  H  IHTG+    CP++ C + F+   N L+H + H +K
Sbjct: 212 CKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLKK 265

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 286 QCPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           +C  C K   R   LK H   +H+ + PF C +  C+K F+   N+ +HLK H++
Sbjct: 574 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKK 626

>Kwal_26.8351
          Length = 698

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 286 QCPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           +C  C K   R   LK H   +H+ + PF C +  C K F+   N+ +HLK H++
Sbjct: 642 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHKK 694

>Scas_712.2
          Length = 327

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 290 CGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           CGK   RP  LK H   H+   P KC +  C+K F     + RHL  H +K
Sbjct: 50  CGKRFMRPCHLKVHKWTHSKVKPLKCAF--CEKGFITNQQLKRHLNTHAKK 98

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 24/52 (46%)

Query: 290 CGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           C +  +RP  L+ H   HT + P+ C  + C K F    ++  H   H + K
Sbjct: 20  CHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRFMRPCHLKVHKWTHSKVK 71

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 288 PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQA 343
           P CGK   RP  L+ H   H    P KC +  C++ F     + RH   HER+  A
Sbjct: 92  PNCGKRFLRPCHLRVHKWTHAQVKPLKCSY--CERRFITNQQLKRHTNTHERRIAA 145

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 31/76 (40%), Gaps = 19/76 (25%)

Query: 276 AIDELSKLRK-----------QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAF 324
            +DE  K +K           Q   C +  S PS L  H   HT + P+ C   +C K F
Sbjct: 39  VVDEAKKAKKGRTKSGRKYVCQIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRF 98

Query: 325 NVKSNMLR--HLKCHE 338
                 LR  HL+ H+
Sbjct: 99  ------LRPCHLRVHK 108

>Kwal_27.10925
          Length = 264

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%)

Query: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           + R  C +C K  +    L  H  IHTG+    CP + C + F+   N ++H K H R+
Sbjct: 198 RRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTHLRR 256

>Scas_569.2
          Length = 293

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 278 DELSKLRKQ-CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336
           +EL K RK  C VC K  +    L  H  IHTG+    C +  C   F+   N ++H + 
Sbjct: 220 EELEKRRKYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279

Query: 337 HERKKQ 342
           H + ++
Sbjct: 280 HFKVRE 285

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           CP+C +  +R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 50  CPICTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 94

>Scas_378.1
          Length = 208

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLK 335
           QC +C K   R S LK H L H+    + CP   C      K N+L+HLK
Sbjct: 85  QCHMCVKSFRRHSWLKRHLLAHSSQRHYSCP--KCVSKHKRKDNLLQHLK 132

>Scas_670.2
          Length = 435

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           + +KQCP+C    +  +T K  +L+   D P KCP   C++ F   ++++RH K H
Sbjct: 249 RRKKQCPICSGYYANLTTHKATHLV-PEDRPHKCPI--CQRGFGRNNDLIRHQKRH 301

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 279 ELSKLRKQCPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           EL +    C +C K   R   LK H   +H+ + PF C    C K F+   N+ +H+K H
Sbjct: 641 ELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTH 698

Query: 338 ER 339
           ++
Sbjct: 699 KK 700

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%)

Query: 290 CGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           CGK+ SRP  L+ H   HT + PF C    C K F   S++  H   H + K
Sbjct: 15  CGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSHSQVK 66

 Score = 35.8 bits (81), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 2/51 (3%)

Query: 288 PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHE 338
           P CGK   R S LK H   H+   P  CP   C K F     + RH K H+
Sbjct: 43  PGCGKGFLRASHLKVHKWSHSQVKPLACPV--CSKGFTTNQQLSRHKKTHK 91

>KLLA0F07073g 675221..676897 some similarities with sgd|S0004367
           Saccharomyces cerevisiae YLR375w STP3 involved in
           pre-tRNA splicing and in uptake of branched-chain amino
           acids, hypothetical start
          Length = 558

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 5/57 (8%)

Query: 284 RKQCPVCGKVCSRPSTLKTHYLIHTGDT-PFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           +KQCP+CG   S  ST K+ +L  + +T PFKC  + C + F   ++++RH K H +
Sbjct: 383 KKQCPLCGLFFSNLSTHKSTHL--SPETRPFKC--EVCSRGFARSNDLIRHKKLHWK 435

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           CPVC +  +R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 82  CPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 126

>Scas_631.7
          Length = 433

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 290 CGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           C K  +RPS L  H L  H G  PFKC  + C K F+ K+++ RHL  H
Sbjct: 64  CTKAFTRPSLLSEHQLTFHQGIKPFKC--EQCDKQFSRKTHLERHLISH 110

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAF 324
           C  CGK  +    LK H + HT    FKCP+++C +A+
Sbjct: 118 CLHCGKGVTTRQQLKRHEVTHTK--SFKCPYENCDEAY 153

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTG---DTPFKCPWKDCKKAFNVKSNMLRHLK 335
           C  CGK   RP  L+ H   H      TP++C + +C ++F   +    H+K
Sbjct: 173 CKHCGKKFQRPYRLQNHIAKHHNPDVKTPYQCTFANCHRSFRTWTLYQSHVK 224

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           +C  C K  SR + L+ H + H+   PF C    C K    +  + RH
Sbjct: 89  KCEQCDKQFSRKTHLERHLISHSDSKPFCCL--HCGKGVTTRQQLKRH 134

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 288 PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           P CGK   RP  L+ H   H+   P  C    C+K F     + RHL  HERK +
Sbjct: 47  PGCGKKFIRPCHLRVHKWTHSQIKPKACTL--CQKRFVTNQQLRRHLNSHERKSK 99

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 37.0 bits (84), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%)

Query: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           + R  C +C +  +    L  H  IHTG+    CP++ C + F+   N ++H + H
Sbjct: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 36.6 bits (83), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 280 LSKLRKQ-CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHE 338
           + K RK  C  CGK  +    L  H  IHTG+    C +  C + F+   N L+H + H 
Sbjct: 74  VEKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133

Query: 339 RK 340
           ++
Sbjct: 134 KR 135

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 280 LSKLRKQ-CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           L++ RK  C +C +  +    L  H  IHTG+   +C +  C + F+   N ++H + H
Sbjct: 278 LAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 27/56 (48%), Gaps = 3/56 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHL-KCHERKK 341
           CP+C +   R   LK H   HT + PF C    C K F  K  +LRHL K H   K
Sbjct: 29  CPICSRGFVRQEHLKRHQNSHTHEKPFLCL--ICGKCFARKDLVLRHLQKLHRDYK 82

>Kwal_27.10167
          Length = 285

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 288 PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           P CGK   R   +  H   H+   P KC  ++C K F  K  + RHL  H+++
Sbjct: 70  PNCGKRFLRVCHMNVHRWTHSKIKPLKC--EECSKGFTTKQQLSRHLATHKKR 120

 Score = 34.7 bits (78), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 287 CPV--CGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           CP+  C K   +PS+L+ H   H  + PF CP  +C K F    +M  H   H + K
Sbjct: 37  CPITSCNKRYRKPSSLREHVNSHNNNRPFACPEPNCGKRFLRVCHMNVHRWTHSKIK 93

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 282 KLRK-QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           KLR   C VC +  +R   LK HY  HT + P+ C    C + F  +  ++RH
Sbjct: 100 KLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDLLIRH 150

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           CP+C +  +R   L+ H   HT + PF C +  C + F  +  +LRH
Sbjct: 85  CPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVLRH 129

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           C  C +   R   LK H   +H G+ P++C    C K F+   N+ +H+K H
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYECHI--CNKKFSRSDNLNQHIKTH 315

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 25/57 (43%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342
           +C  C +   R    K H   HTG+ P  C +  C K+F+    + RH + H    Q
Sbjct: 18  KCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTHTGVSQ 74

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 290 CGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           C K  +RPS L  H L +H G  PFKC    C K F  KS++ RH+  H   K
Sbjct: 113 CNKSFTRPSLLTEHQLTVHHGIKPFKCD--TCGKEFAKKSHLNRHMFSHTDDK 163

 Score = 35.4 bits (80), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           +C  CGK  ++ S L  H   HT D PF C    C K    +  + RH
Sbjct: 138 KCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSI--CGKGVTTRQQLKRH 183

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 8/57 (14%)

Query: 287 CPVCGKVCSRPSTLKTHYLIH-----TGDTPFKCPWKDCKKAFNVKSNMLRHLK-CH 337
           CP C K   RP  LK H   H     TG   ++C +  C   F+  S++ +H+K CH
Sbjct: 222 CPHCNKTFQRPYRLKNHIDKHHNPESTG--MYQCDFLSCTDVFSTWSSLQQHIKQCH 276

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 14/21 (66%)

Query: 287 CPVCGKVCSRPSTLKTHYLIH 307
           CP+CGK C   S L+ H +IH
Sbjct: 281 CPICGKPCVAESGLRNHMMIH 301

>Kwal_47.17241
          Length = 403

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           C  C +   R   LK H   +H G+ PF C    C K F+   N+ +H+K H
Sbjct: 348 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHI--CGKKFSRSDNLNQHIKTH 397

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 36.6 bits (83), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           CP+C +   R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 35  CPICTRGFVRLEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 79

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 281 SKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           +K ++QCP+C K  +  ST K+ +L  + D P KC    C+  F   ++++RH K H +
Sbjct: 320 TKKKRQCPICHKYFANLSTHKSTHLT-SQDRPHKCII--CQSGFARNNDLIRHRKRHWK 375

>Scas_683.30
          Length = 478

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 281 SKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           ++ +KQCP C    +  ST K+ +L    D P KCP   C++ F   ++++RH K H + 
Sbjct: 283 TRRKKQCPTCLNYYANLSTHKSTHLT-PEDRPHKCPI--CERGFARNNDLIRHKKRHWKD 339

Query: 341 K 341
           +
Sbjct: 340 E 340

>YDL048C (STP4) [816] chr4 complement(366739..368211) Protein with
           strong similarity to Stp1p, which is involved in tRNA
           splicing and branched-chain amino acid uptake [1473 bp,
           490 aa]
          Length = 490

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 284 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           +K+CP+C    +  ST K+ +L    D P KCP   C++ F   ++++RH K H + +
Sbjct: 276 KKECPICHNFYANLSTHKSTHLT-PEDRPHKCPI--CQRGFARNNDLIRHKKRHWKDE 330

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 290 CGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           C K  +RPS L  H L +H G   F+C    C K+F  KS++ RHL  H
Sbjct: 56  CDKAFTRPSILTEHQLSVHQGLRAFQCD--KCAKSFVKKSHLERHLYTH 102

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTG---DTPFKCPWKDCKKAFNVKSNMLRHLK 335
           CP C K   RP  L+ H   H     + P++C +  C K F + S +  H+K
Sbjct: 165 CPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIK 216

 Score = 32.0 bits (71), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           QC  C K   + S L+ H   H+   PF+C +  C K    +  + RH
Sbjct: 81  QCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRH 126

>Scas_707.31
          Length = 289

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 287 CPVCGKVCSRPSTLKTHY-LIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340
           C +C K   R   LK H+  IH    PF+C    C K F+   N+ +H++ HE++
Sbjct: 225 CHLCKKRFKRHEHLKRHFRTIHLRVRPFEC--SVCHKRFSRNDNLNQHVRIHEQQ 277

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 284 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           +KQCP+C    +  +T K  +L    D P KCP   C + F   +++LRH K H + +
Sbjct: 141 KKQCPICRNFYANLTTHKATHLT-PEDRPHKCPI--CHRGFARNNDLLRHKKRHWKDE 195

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 28/61 (45%)

Query: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           + R  C +C    +    L  H  IHTG+    CP + C + F+   N  +H + H  KK
Sbjct: 150 RTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTHANKK 209

Query: 342 Q 342
           +
Sbjct: 210 K 210

>Kwal_47.16621
          Length = 1178

 Score = 35.8 bits (81), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           C +C +  +R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 80  CSICTRGFARQEHLKRHQRAHTNEKPFLCAF--CGRCFARRDLVLRH 124

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 35.4 bits (80), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           C  C +   R   LK H   +H G+ P+ C    C K F+   N+ +H+K H
Sbjct: 356 CEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEI--CGKKFSRSDNLNQHIKTH 405

>Scas_602.9
          Length = 547

 Score = 35.0 bits (79), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           C  C +   R   LK H   +H G+ P+ C    C K F+   N+ +H+K H
Sbjct: 497 CDYCERRFKRQEHLKRHVRSLHIGEKPYACHI--CNKNFSRSDNLTQHIKTH 546

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 35.0 bits (79), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH-LKCHERK 340
           C VCGK  +    L+ H + HT    FKCP + C +AF     +  H L  HE+K
Sbjct: 180 CTVCGKGVTTRQQLRRHEITHT--KSFKCPHEGCGEAFYKHPQLRSHVLAVHEQK 232

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           QC  CG+  ++ S L+ H   H+   PF C    C K    +  + RH
Sbjct: 151 QCEQCGRGFTKKSHLERHLFSHSETKPFSCTV--CGKGVTTRQQLRRH 196

>Scas_703.23
          Length = 1341

 Score = 35.0 bits (79), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           CP C +   R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 74  CPTCTRGFVRQEHLKRHQRSHTNEKPFLCVF--CGRCFARRDLVLRH 118

>CAGL0H04873g complement(465069..466424) some similarities with
           tr|Q05937 Saccharomyces cerevisiae YLR375w STP3 or
           tr|Q07351 Saccharomyces cerevisiae YDL048c STP4,
           hypothetical start
          Length = 451

 Score = 35.0 bits (79), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHT--GDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           + RKQCP+C       + L TH  IH      PF C    C++ F  +++++RH K H +
Sbjct: 261 RRRKQCPICHGFF---ANLTTHKAIHLEPDIKPFVCSV--CQRGFVRQNDVMRHEKMHWK 315

Query: 340 KK 341
            K
Sbjct: 316 DK 317

>Scas_721.92
          Length = 1152

 Score = 35.0 bits (79), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           C VC +  +R   L  H   HT + P++C    C K F  +  +LRH
Sbjct: 80  CDVCSRAFARQEHLDRHARSHTNEKPYQCGI--CTKKFTRRDLLLRH 124

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           C  C +   R   LK H   +H G+ P+ C    C K F+   N+ +H+K H
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGCDI--CGKKFSRSDNLNQHIKTH 511

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           + +K+CPVC    +  ST K+ +L    D P KC    C + F   +++LRH K H + +
Sbjct: 158 RRKKECPVCHNFYANLSTHKSTHLT-PEDRPHKCSV--CSRGFARSNDLLRHKKRHWKDE 214

>Scas_683.25
          Length = 879

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 284 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNM-LRHLKCHERKK 341
           R  C  C K  SR      H   HTG  P+KC  K C   F V+S++ LRH+K   +K+
Sbjct: 14  RFICSFCAKGFSRAEHKIRHERSHTGLKPYKC--KVCTHCF-VRSDLALRHIKTVHKKE 69

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 31/73 (42%), Gaps = 8/73 (10%)

Query: 276 AIDELSKLRKQCP--VCGKVCSRPSTLKTHYLIHTGDTPFKCPW------KDCKKAFNVK 327
            + E  + R +CP   C K  SR   L  H L H     FKC +      + C K F  +
Sbjct: 36  VVGEDGQYRYKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRR 95

Query: 328 SNMLRHLKCHERK 340
             + RH K HE K
Sbjct: 96  DLLNRHEKRHENK 108

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           C +C +   R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 107

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 288 PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           P C    SR   L  H   HTG+ PFKC    C K F+   N+ +H
Sbjct: 31  PGCEMSFSRAEHLARHIRRHTGEKPFKCDI--CLKYFSRIDNLKQH 74

>ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH]
           (640832..643438) [2607 bp, 868 aa]
          Length = 868

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 2/40 (5%)

Query: 113 GGQQYHYYVPPPRAITPCLSSQGSPS--FSHSNLVMVPKL 150
           GG Q  +YVP P    P L S G P    S   +  +PKL
Sbjct: 29  GGAQLRFYVPLPAGSRPMLRSGGFPGMVMSQRGISFIPKL 68

>Kwal_26.9300
          Length = 304

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           + +K+CP+C    +  ST ++ +L    + P KCP   C + F   +++LRH K H + +
Sbjct: 143 RRKKECPICHNFYANLSTHRSSHL-QPENKPHKCP--VCGRGFTRHNDLLRHRKRHWKDE 199

Query: 342 Q 342
            
Sbjct: 200 D 200

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 3/52 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           C  C +   R   LK H   +H  + PF C    C K F+   N+ +H+K H
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI--CNKNFSRSDNLNQHVKTH 440

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 290 CGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           C    +R   L  H   HTG+ PF+CP   C K F+   N+ +H
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCPA--CLKFFSRVDNLKQH 90

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 3/52 (5%)

Query: 287 CPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           C  C +   R   LK H   +H  + P+ C    C K F+   N+ +HLK H
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGCHL--CGKKFSRSDNLSQHLKTH 469

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 32.3 bits (72), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 2/53 (3%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           C  C +  SR      H   HTG  PF C  K C  +F  +  + RH++   R
Sbjct: 10  CSFCAQAFSRSEHKTRHERSHTGVKPFSC--KVCNHSFVRRDLLQRHIRTVHR 60

>Scas_627.6
          Length = 1207

 Score = 32.0 bits (71), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 6/60 (10%)

Query: 288 PVCGKVCSRPSTLKTHYLIHTGDTPFKCPW------KDCKKAFNVKSNMLRHLKCHERKK 341
           P C K  +R   L  H L H     F CP+        C K F  K  ++RH K H + K
Sbjct: 47  PDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRHQKRHTKSK 106

>AFR445C [3637] [Homologous to ScYHR189W - SH] (1239916..1240515)
           [600 bp, 199 aa]
          Length = 199

 Score = 31.2 bits (69), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 81  PQAQQQDVCVQAHVAEPYPQYQSITHNNGMIKGGQQYHYYVPPPRAITPCLSSQGSPSFS 140
           PQ +   +C+   +  P PQY++  HN G+I       +Y  P +   PC   + + S+ 
Sbjct: 10  PQRRTLHLCLTG-LGNPEPQYRNTRHNAGLILLDLLKAHYA-PGKPWMPCTVPRVAASYC 67

Query: 141 HSNLVMVPKLDKQTSYLNANGTVVM 165
           H++   +  L    +++N +G  V+
Sbjct: 68  HASRHDLLLLRSDGAFMNRSGQNVV 92

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           CP C +   R   LK H   HT + P+ C +  C + F  +  +LRH
Sbjct: 153 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRH 197

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%)

Query: 284 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           R  C  C K  SR      H   H G  PF+C  + C  +F  +  + RH++   R
Sbjct: 11  RHFCSFCNKAFSRSEHKTRHERSHAGVKPFEC--QVCSHSFVRRDLLQRHIRTVHR 64

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           C VC +  +R   L  H   HT + P+ C    C++ F  +  ++RH
Sbjct: 127 CKVCTRAFARQEHLTRHERSHTKEKPYVCGI--CERRFTRRDLLIRH 171

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 288 PVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           P C    +R   L  H   HTG+ PF+C    C K F+   N+ +H
Sbjct: 25  PDCNMSFNRTEHLARHIRKHTGEKPFQC--NICLKFFSRIDNLRQH 68

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 2/49 (4%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLK 335
           C  C K  SR      H   HTG  PF C    C  +F  +  + RH++
Sbjct: 10  CSFCAKPFSRSEHKARHERSHTGSKPFSC--SICSHSFVRRDLLQRHIR 56

>Scas_719.68
          Length = 1350

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333
           K  K  P    +C+R   LK H   HT + PF C +  C + F  +  +LR+
Sbjct: 34  KTDKPRPFLCPICTRTEHLKRHQRSHTREKPFVCVF--CGRCFARRDLVLRY 83

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 277 IDELSKLRKQCPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHL 334
           +D+ SK+   C  C +  S    L  H   +H+G+ P  CP   C K F  + ++L+HL
Sbjct: 748 LDDGSKVY-VCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHL 803

>Sklu_1749.2 YGL192W, Contig c1749 3200-5002
          Length = 600

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 2/66 (3%)

Query: 81  PQAQQQDVCVQAHVAEP--YPQYQSITHNNGMIKGGQQYHYYVPPPRAITPCLSSQGSPS 138
           P  QQQ   +Q + A P  YP +Q  + N G+    Q  HYY    R +T   S   + +
Sbjct: 535 PALQQQTQLMQYYHANPQQYPPFQQHSSNGGIYNPDQTSHYYAYGNRTVTIPASQTFNGT 594

Query: 139 FSHSNL 144
           F  S +
Sbjct: 595 FGLSAM 600

>Kwal_47.16577
          Length = 881

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 18/33 (54%)

Query: 309 GDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341
           G  PF CP+  C K+F+   ++ RH   H  +K
Sbjct: 9   GSGPFFCPFPGCSKSFSRSDHLGRHKANHSSEK 41

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 27/66 (40%), Gaps = 8/66 (12%)

Query: 284 RKQCP--VCGKVCSRPSTLKTHYLIHTGDTPFKCPW------KDCKKAFNVKSNMLRHLK 335
           R +CP   C K  SR   L  H L H     + C +        C K F  K  ++RH K
Sbjct: 30  RFRCPHPECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRHEK 89

Query: 336 CHERKK 341
            H + K
Sbjct: 90  RHSKVK 95

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score = 29.3 bits (64), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%)

Query: 287 CPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHL 334
           C  C +  S    L  H   +H+G+ P  CP   C K F  + ++L+HL
Sbjct: 734 CQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHL 780

>Scas_703.3
          Length = 508

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 7/65 (10%)

Query: 279 ELSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCP--W--KDCKKAFNVKSNMLRHL 334
           EL    K C +CGK       L THY++  G     C   W  K+CKK  + + + L+H+
Sbjct: 157 ELMSKGKCCTLCGKSLYE---LSTHYIMMNGLDCNDCTAVWCSKNCKKMDSCRHSFLKHV 213

Query: 335 KCHER 339
              +R
Sbjct: 214 NLKKR 218

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 12/24 (50%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGD 310
           C  CGK   RP  LK H  +H  D
Sbjct: 120 CSTCGKKFKRPQDLKKHLRVHLDD 143

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 13/32 (40%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWK 318
           C  C K   RP  LK H  IH  D     P K
Sbjct: 221 CSTCSKRFKRPQDLKKHLKIHLSDLGIDAPKK 252

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 2/56 (3%)

Query: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337
           +L+ Q   C     +   + +H  +H    PF C    C K F    ++ +HLK H
Sbjct: 188 QLKCQWDNCTSKTEKRDHMTSHLRVHVPLKPFAC--STCSKRFKRPQDLKKHLKIH 241

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%)

Query: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339
           C  C K  SR      H   H G  PF+C  + CK +F  +  + RH++   R
Sbjct: 10  CSFCLKPFSRSEHKIRHERSHAGVKPFQC--QVCKHSFVRRDLLQRHIRTVHR 60

>Kwal_56.23453
          Length = 828

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%)

Query: 287 CPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHL 334
           C  C +  S    L  H   +H+G+ P  CP   C K F  + ++L+HL
Sbjct: 737 CQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHL 783

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score = 28.5 bits (62), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%)

Query: 287 CPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHL 334
           C  C +  S    L  H   +H+G+ P  CP   C K F  + ++L+HL
Sbjct: 711 CKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQHL 757

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score = 28.5 bits (62), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%)

Query: 287 CPVCGKVCSRPSTLKTHYL-IHTGDTPFKCPWKDCKKAFNVKSNMLRHL 334
           C  C +  S    L  H   +H+G+ P  CP   C K F  + ++L+HL
Sbjct: 904 CQECKRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQHL 950

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 28.5 bits (62), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 6/58 (10%)

Query: 288 PVCGKVCSRPSTLKTHYLIHTGDTPFKCPW---KD---CKKAFNVKSNMLRHLKCHER 339
           P C K  +R   L  H L H     F+C +   +D   C + F  +  ++RH K H R
Sbjct: 21  PNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVRHEKRHSR 78

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.129    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,876,197
Number of extensions: 309897
Number of successful extensions: 1402
Number of sequences better than 10.0: 178
Number of HSP's gapped: 1351
Number of HSP's successfully gapped: 242
Length of query: 343
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 241
Effective length of database: 13,065,073
Effective search space: 3148682593
Effective search space used: 3148682593
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)