Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L01837g2242219641e-134
YKL041W (VPS24)2242227391e-100
Scas_625.72242217198e-97
Sklu_1576.22232217042e-94
Kwal_26.81562222216355e-84
ABR049C2232216103e-80
KLLA0F25366g2242226071e-79
YKL002W (DID4)2321521571e-12
KLLA0B13343g2361571385e-10
Scas_668.262331541342e-09
ABR002C2341561281e-08
CAGL0K02827g153111897e-04
Kwal_26.792314873780.023
Kwal_26.763569177642.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L01837g
         (221 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L01837g 211118..211792 highly similar to sp|P36095 Saccharo...   375   e-134
YKL041W (VPS24) [3217] chr11 (359787..360461) Protein involved i...   289   e-100
Scas_625.7                                                            281   8e-97
Sklu_1576.2 YKL041W, Contig c1576 607-1278 reverse complement         275   2e-94
Kwal_26.8156                                                          249   5e-84
ABR049C [640] [Homologous to ScYKL041W (VPS24) - SH] (482245..48...   239   3e-80
KLLA0F25366g 2361279..2361953 similar to sp|P36095 Saccharomyces...   238   1e-79
YKL002W (DID4) [3255] chr11 (437421..437480,437549..438187) Clas...    65   1e-12
KLLA0B13343g join(complement(1171345..1171404), similar to sp|P3...    58   5e-10
Scas_668.26                                                            56   2e-09
ABR002C [593] [Homologous to ScYKL002W (DID4) - SH] (400237..400...    54   1e-08
CAGL0K02827g 254429..254890 highly similar to sp|P36108 Saccharo...    39   7e-04
Kwal_26.7923                                                           35   0.023
Kwal_26.7635                                                           29   2.7  

>CAGL0L01837g 211118..211792 highly similar to sp|P36095
           Saccharomyces cerevisiae YKL041w VPS24, start by
           similarity
          Length = 224

 Score =  375 bits (964), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 192/221 (86%), Positives = 192/221 (86%)

Query: 1   MDYVKTAIWGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNKTQSLIKKSAKKNDVRN 60
           MDYVKTAIWGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNKTQSLIKKSAKKNDVRN
Sbjct: 1   MDYVKTAIWGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNKTQSLIKKSAKKNDVRN 60

Query: 61  VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVR 120
           VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVR
Sbjct: 61  VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVR 120

Query: 121 LPQLQGTMIELEKELMKSGIISEMIDETMESIGXXXXXXXXXXXXXXKIVEQYTSEKLAK 180
           LPQLQGTMIELEKELMKSGIISEMIDETMESIG              KIVEQYTSEKLAK
Sbjct: 121 LPQLQGTMIELEKELMKSGIISEMIDETMESIGDTDELNDEVDEEVNKIVEQYTSEKLAK 180

Query: 181 VENVPTTELPKSXXXXXXXXXXXXXXXADKMLNDMRDRLRA 221
           VENVPTTELPKS               ADKMLNDMRDRLRA
Sbjct: 181 VENVPTTELPKSEQEEQEVPEEEIEDEADKMLNDMRDRLRA 221

>YKL041W (VPS24) [3217] chr11 (359787..360461) Protein involved in
           sorting of proteins in the pre-vacuolar endosome,
           component of ESCRT-III complex with Did4p, Vps20p, and
           Snf7p [675 bp, 224 aa]
          Length = 224

 Score =  289 bits (739), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 150/222 (67%), Positives = 168/222 (75%), Gaps = 2/222 (0%)

Query: 1   MDYVKTAIWGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNKTQSLIKKSAKKNDVRN 60
           MDY+K AIWGPD KEQQR I+S+LRKN R I+KSLREL+ LQNKTQ LIKKSAKKNDVR 
Sbjct: 1   MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT 60

Query: 61  VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVR 120
           VRLYAKELY INKQY RMYTS+AQL+SV MKIDEA RM TLSNQMA S GLM EVNSLVR
Sbjct: 61  VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR 120

Query: 121 LPQLQGTMIELEKELMKSGIISEMIDETMESIGXX-XXXXXXXXXXXXKIVEQYTSEKLA 179
           LPQL+ TMIELEKELMKSGIISEM+D+TMES+G               KIVEQYT+EK  
Sbjct: 121 LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK 180

Query: 180 KVENVPTTELPKSXXXXXXXXXXXXXXXADKMLNDMRDRLRA 221
            V+ VPT EL  +               AD+M+N+MR+RLRA
Sbjct: 181 NVDQVPTVELA-ANEEEQEIPDEKVDEEADRMVNEMRERLRA 221

>Scas_625.7
          Length = 224

 Score =  281 bits (719), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 169/221 (76%)

Query: 1   MDYVKTAIWGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNKTQSLIKKSAKKNDVRN 60
           MDY+K  IWGPD KEQQR IK++LRKN+R ++KSLR+L+ LQNKTQ LIK++AKKND++ 
Sbjct: 1   MDYIKKTIWGPDPKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKT 60

Query: 61  VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVR 120
           VR+YA+ELY INKQY+RMY+SK QL SVS +IDEA R++T+S++MA STGLM EVNSLVR
Sbjct: 61  VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR 120

Query: 121 LPQLQGTMIELEKELMKSGIISEMIDETMESIGXXXXXXXXXXXXXXKIVEQYTSEKLAK 180
           LP+LQGTMIELEKELMKSGIISEM+DETM+S+               KIVEQYT+EK  K
Sbjct: 121 LPELQGTMIELEKELMKSGIISEMVDETMDSVMESEELDEEVDAEVNKIVEQYTNEKFEK 180

Query: 181 VENVPTTELPKSXXXXXXXXXXXXXXXADKMLNDMRDRLRA 221
           + NVPTTELP                 ADKML +M++RL A
Sbjct: 181 INNVPTTELPAHEEEEKEIPEDQVDEEADKMLREMKERLNA 221

>Sklu_1576.2 YKL041W, Contig c1576 607-1278 reverse complement
          Length = 223

 Score =  275 bits (704), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 165/221 (74%), Gaps = 1/221 (0%)

Query: 1   MDYVKTAIWGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNKTQSLIKKSAKKNDVRN 60
           MDY+K  +WGPD KEQ R IKS++RKN R IDKSLREL+ LQNKTQ LIK++AKKND+++
Sbjct: 1   MDYLKKVMWGPDPKEQHRKIKSIVRKNGRNIDKSLRELTVLQNKTQQLIKRAAKKNDIKS 60

Query: 61  VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVR 120
           VR+YAKE+Y +NKQY RMYTSKAQLESV MKIDEAFRM+ LS  MA+S GLM EVNSLV+
Sbjct: 61  VRIYAKEIYQVNKQYIRMYTSKAQLESVGMKIDEAFRMKNLSENMAASAGLMREVNSLVK 120

Query: 121 LPQLQGTMIELEKELMKSGIISEMIDETMESIGXXXXXXXXXXXXXXKIVEQYTSEKLAK 180
           LPQLQ +M+ELEKE+MKSG+ISEMID+T+E                 KIV QYTS+K   
Sbjct: 121 LPQLQSSMMELEKEIMKSGVISEMIDDTLEVADEDEEMESEIDEEVNKIVSQYTSDKFEI 180

Query: 181 VENVPTTELPKSXXXXXXXXXXXXXXXADKMLNDMRDRLRA 221
           V+NVPTTELP S               AD MLN+MR+RL+A
Sbjct: 181 VDNVPTTELP-SKQEQELVPEEQIEDEADNMLNEMRERLKA 220

>Kwal_26.8156
          Length = 222

 Score =  249 bits (635), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 158/221 (71%), Gaps = 2/221 (0%)

Query: 1   MDYVKTAIWGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNKTQSLIKKSAKKNDVRN 60
           MDY+K AIWGPD KEQ R I+ L+R+N R +DKSLREL+ALQ KTQ LIK++AK+ND R+
Sbjct: 1   MDYLKKAIWGPDPKEQHRKIRGLVRRNGRSLDKSLRELAALQTKTQGLIKRAAKQNDTRS 60

Query: 61  VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVR 120
           VR+YA+ELY I+KQY RMY SKAQL+SV MKIDEAFRM+ L   +A S GLM EVNSLVR
Sbjct: 61  VRIYARELYQIDKQYKRMYISKAQLQSVGMKIDEAFRMQDLQENIALSAGLMREVNSLVR 120

Query: 121 LPQLQGTMIELEKELMKSGIISEMIDETMESIGXXXXXXXXXXXXXXKIVEQYTSEKLAK 180
           LP LQ TM+ LEKEL+K+G+I EM+D++ME                 KIV QYTS KL K
Sbjct: 121 LPYLQSTMMLLEKELVKNGLIGEMLDDSMELATEDEEMEEEVEQEVNKIVNQYTSAKLDK 180

Query: 181 VENVPTTELPKSXXXXXXXXXXXXXXXADKMLNDMRDRLRA 221
           ++N+PT+E P +               AD MLN+MR+RL+A
Sbjct: 181 IDNIPTSEPPMA--HEEIVPEDKIDDEADNMLNEMRERLKA 219

>ABR049C [640] [Homologous to ScYKL041W (VPS24) - SH]
           (482245..482916) [672 bp, 223 aa]
          Length = 223

 Score =  239 bits (610), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 156/221 (70%), Gaps = 1/221 (0%)

Query: 1   MDYVKTAIWGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNKTQSLIKKSAKKNDVRN 60
           M+++KTAIWG D +EQ R +K++LRKN RQ+DKSLREL+AL+ KTQ LIKKSAK NDV+ 
Sbjct: 1   MNFIKTAIWGVDPREQHRKMKAILRKNHRQLDKSLRELAALKGKTQVLIKKSAKTNDVKT 60

Query: 61  VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVR 120
           VR+YAKELY INKQY R+YTSKAQL+SV MKI+EAF M  +   MA S GLM EVNSLV 
Sbjct: 61  VRIYAKELYQINKQYDRIYTSKAQLQSVGMKIEEAFHMNKMQQTMAQSAGLMREVNSLVS 120

Query: 121 LPQLQGTMIELEKELMKSGIISEMIDETMESIGXXXXXXXXXXXXXXKIVEQYTSEKLAK 180
           +PQL+ TM+ELEKEL++SGI+SEM+++++E+I               +IV QYT  K   
Sbjct: 121 VPQLRSTMMELEKELLRSGIVSEMVNDSLENID-MTVDDEEVDEQVEQIVMQYTGAKFNA 179

Query: 181 VENVPTTELPKSXXXXXXXXXXXXXXXADKMLNDMRDRLRA 221
           V+NVP T+L +                AD ML +MR+RL A
Sbjct: 180 VDNVPETQLERQDALEEVVPEEDIKDEADNMLREMRERLNA 220

>KLLA0F25366g 2361279..2361953 similar to sp|P36095 Saccharomyces
           cerevisiae YKL041w VPS24 endosomal Vps protein complex
           subunit singleton, start by similarity
          Length = 224

 Score =  238 bits (607), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 126/222 (56%), Positives = 158/222 (71%), Gaps = 2/222 (0%)

Query: 1   MDYVKTAIWGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNKTQSLIKKSAKKNDVRN 60
           M+++KTAIWGPD KEQ R +KS+LRKN RQ+ KSL ELS+L+ KTQ LIK++AK+ND++ 
Sbjct: 1   MNFIKTAIWGPDPKEQHRKLKSILRKNDRQLSKSLNELSSLKAKTQQLIKQAAKQNDIKT 60

Query: 61  VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVR 120
           VRLYAKELYH+NKQY+RMYTSKAQL+SV MKI+E F+M  L ++MA S  LM +VNSLVR
Sbjct: 61  VRLYAKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVR 120

Query: 121 LPQLQGTMIELEKELMKSGIISEMIDETMESIGXXXXXXXXXXXXXXKIVEQYTSEKLAK 180
           LPQL+GTMIELEKEL+KSGII+EM+D+ MES                +IV +YTSEKL K
Sbjct: 121 LPQLRGTMIELEKELVKSGIITEMMDDAMESY-EDMEEEEEINEQVDQIVAEYTSEKLGK 179

Query: 181 VENVPTTELPKSXXXXXXXXXXXX-XXXADKMLNDMRDRLRA 221
           VE  P   L +                 AD M+  M++RL A
Sbjct: 180 VEETPNVVLSEPPPAEQEVVPESNIDAEADNMIKAMKERLNA 221

>YKL002W (DID4) [3255] chr11 (437421..437480,437549..438187) Class E
           vacuolar protein-sorting (vps) factor involved in
           endosome to vacuole transport, component of ESCRT-III
           complex with Vps24p, Vps20p, and Snf7p, has similarity
           to human BC-2 breast adenocarcinoma marker protein [699
           bp, 232 aa]
          Length = 232

 Score = 65.1 bits (157), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 81/152 (53%), Gaps = 12/152 (7%)

Query: 8   IWGPDVKEQQRNIKSLLRKNSRQIDKSLRELS------ALQNKT-QSLIKKSAKKNDVRN 60
           ++G +V  Q+R     L+KN R ++++ REL        LQ+K   S IKKSAK   V  
Sbjct: 7   VFGKNVTPQER-----LKKNQRALERTQRELEREKRKLELQDKKLVSEIKKSAKNGQVAA 61

Query: 61  VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVR 120
            ++ AK+L        +    KAQL+++S++I        ++  M+ +TGL+  +N  + 
Sbjct: 62  AKVQAKDLVRTRNYIQKFDNMKAQLQAISLRIQAVRSSDQMTRSMSEATGLLAGMNRTMN 121

Query: 121 LPQLQGTMIELEKELMKSGIISEMIDETMESI 152
           LPQLQ   +E EK+    G   E +DE ++++
Sbjct: 122 LPQLQRISMEFEKQSDLMGQRQEFMDEAIDNV 153

>KLLA0B13343g join(complement(1171345..1171404), similar to
           sp|P36108 Saccharomyces cerevisiae YKL002w class E
           vacuolar-protein sorting and endocytosis factor
           singleton, start by similarity
          Length = 236

 Score = 57.8 bits (138), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 82/157 (52%), Gaps = 24/157 (15%)

Query: 8   IWGPDVKEQQRNIKSLLRKNSRQIDKSLRELS-------ALQNKTQSLIKKSAKKNDVRN 60
           ++G  +  Q+R     +RKN R ++++ REL        A + K    IKKSAK   V  
Sbjct: 7   VFGSSMTPQER-----MRKNQRALERAQRELEREKKKLEAQEKKLIQEIKKSAKNGQVNA 61

Query: 61  VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASS----TGLMMEVN 116
            ++ AK+L    K   +    K QL+++S+++ +A R    S+QMA S    TGL+  +N
Sbjct: 62  AKIQAKDLVRTRKYTEKFGNMKTQLQAISLRV-QAVRS---SDQMAVSMREATGLLAGMN 117

Query: 117 SLVRLPQLQGTMIELEK--ELM--KSGIISEMIDETM 149
             + LPQLQ   +E EK  +LM  +   + E ID+ M
Sbjct: 118 RSMNLPQLQRISMEFEKQSDLMEQRQEFMDESIDDVM 154

>Scas_668.26
          Length = 233

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 77/154 (50%), Gaps = 16/154 (10%)

Query: 7   AIWGPDVKEQQRNIKSLLRKNSRQIDKSLREL-------SALQNKTQSLIKKSAKKNDVR 59
           A +G  +  Q+R     L+KN R ++++ REL       +  + K    IKKSAK+  + 
Sbjct: 6   AFFGKSMTPQER-----LKKNQRALERAQRELEREKRKLATQEKKIIQEIKKSAKQGQIN 60

Query: 60  NVRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLV 119
             ++ AK+L        +    + QL+++S++I        +++ M  +TGL+  +N  +
Sbjct: 61  AAKIQAKDLVRTRNYMEKFDNMRTQLQAISLRIQAVRSSDQMTSSMREATGLLAGMNRSM 120

Query: 120 RLPQLQGTMIELEK--ELM--KSGIISEMIDETM 149
            LPQLQ   +E EK  +LM  +   + E ID  M
Sbjct: 121 NLPQLQNISMEFEKQTDLMDQRQEFMDEAIDNAM 154

>ABR002C [593] [Homologous to ScYKL002W (DID4) - SH]
           (400237..400881,400948..401007) [705 bp, 234 aa]
          Length = 234

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 81/156 (51%), Gaps = 24/156 (15%)

Query: 9   WGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNKTQSL-------IKKSAKKNDVRNV 61
           +G  V  Q+R     L+KN   +D++ REL   + K ++        IKKSAK   +   
Sbjct: 8   FGKSVTPQER-----LKKNQNALDRTQRELEREKRKLEAQEKRLVQDIKKSAKNGQINAA 62

Query: 62  RLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASS----TGLMMEVNS 117
           ++ AK+L    +   +    K QL+++S++I +A R    S+QMA S    TGL+  +N 
Sbjct: 63  KIQAKDLVRTKRYIEKFNGMKTQLQAISLRI-QAVRS---SDQMAISMREATGLLSSMNR 118

Query: 118 LVRLPQLQGTMIELEK--ELM--KSGIISEMIDETM 149
            + LPQLQ   +E E+  ++M  +   + E ID+ M
Sbjct: 119 SMNLPQLQRISMEFERQNDMMDQRQEFMDEAIDDAM 154

>CAGL0K02827g 254429..254890 highly similar to sp|P36108
           Saccharomyces cerevisiae YKL002w, start by similarity
          Length = 153

 Score = 38.9 bits (89), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 57/111 (51%), Gaps = 5/111 (4%)

Query: 82  KAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVRLPQLQGTMIELEK--ELMKSG 139
           KAQL+++S++I        ++  M  +TGL+  +N  + LPQLQ   +E EK  +LM   
Sbjct: 2   KAQLQAISLRIQAVRSSDQMTRSMREATGLLAGMNRSMNLPQLQKISMEFEKQSDLMDQ- 60

Query: 140 IISEMIDETMESI-GXXXXXXXXXXXXXXKIVEQYTSEKLAKVENVPTTEL 189
              E +DE ++++ G              K++++   +  ++++N P  EL
Sbjct: 61  -RQEFMDEAIDNVMGDELEENEDADEIVNKVLDEIGIDLNSQLQNTPQHEL 110

>Kwal_26.7923
          Length = 148

 Score = 34.7 bits (78), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 4/73 (5%)

Query: 82  KAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVRLPQLQGTMIELEK--ELM--K 137
           K QL+++S++I        ++  M  +TGL+  +N  + LPQ+Q    E EK  +LM  +
Sbjct: 2   KTQLQAISLRIQAVRSSDQMTTSMREATGLLASMNRSMNLPQIQLISAEFEKQSDLMDQR 61

Query: 138 SGIISEMIDETME 150
              + E ID+ M+
Sbjct: 62  QEFMDEAIDDAMD 74

>Kwal_26.7635
          Length = 691

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 74  QYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLM---MEVNSLVRLPQLQGTMIE 130
           +Y  MY         S  +DEAF     +    + +G+M   +    ++RLP    + ++
Sbjct: 100 EYDGMYDGNGS----SSVMDEAFDSNNSTTDEPNFSGIMTIKVYGGEVLRLPFPITSNVQ 155

Query: 131 LEKELMKSGIISEMIDE 147
           + K+L+ SG+I++  DE
Sbjct: 156 ILKKLLHSGVINQDTDE 172

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.125    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,260,201
Number of extensions: 173150
Number of successful extensions: 892
Number of sequences better than 10.0: 67
Number of HSP's gapped: 875
Number of HSP's successfully gapped: 67
Length of query: 221
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 123
Effective length of database: 13,203,545
Effective search space: 1624036035
Effective search space used: 1624036035
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)