Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L01793g35935418430.0
Kwal_26.81903243693703e-41
ABR054C3142902751e-27
YKL042W (SPC42)3633832561e-24
KLLA0F04862g3162562461e-23
Scas_711.453352972242e-20
Scas_625.7d3023322101e-18
Kwal_56.2437580686770.16
YKL179C (COY1)679146740.33
YPR190C (RPC82)65433700.98
KLLA0D10285g51564691.3
AFR103W74485691.4
YOR232W (MGE1)228134634.8
YPR106W (ISR1)443105636.5
CAGL0J02992g23093627.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L01793g
         (354 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L01793g 206723..207802 weakly similar to sp|P36094 Saccharo...   714   0.0  
Kwal_26.8190                                                          147   3e-41
ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH] (494105..49...   110   1e-27
YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the s...   103   1e-24
KLLA0F04862g 476880..477830 some similarities with sp|P36094 Sac...    99   1e-23
Scas_711.45                                                            91   2e-20
Scas_625.7d                                                            86   1e-18
Kwal_56.24375                                                          34   0.16 
YKL179C (COY1) [3093] chr11 complement(110469..112508) Golgi mem...    33   0.33 
YPR190C (RPC82) [5604] chr16 complement(917071..919035) RNA poly...    32   0.98 
KLLA0D10285g 869754..871301 similar to sp|Q04489 Saccharomyces c...    31   1.3  
AFR103W [3295] [Homologous to ScYJL083W - SH; ScYKR019C (IRS4) -...    31   1.4  
YOR232W (MGE1) [5023] chr15 (774573..775259) Protein that partic...    29   4.8  
YPR106W (ISR1) [5527] chr16 (740057..741388) Serine-threonine pr...    29   6.5  
CAGL0J02992g 286008..286700 similar to sp|P40040 Saccharomyces c...    28   7.9  

>CAGL0L01793g 206723..207802 weakly similar to sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42, start by
           similarity
          Length = 359

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/354 (100%), Positives = 354/354 (100%)

Query: 1   MNISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYSGINPPVYKNGLHSNLD 60
           MNISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYSGINPPVYKNGLHSNLD
Sbjct: 1   MNISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYSGINPPVYKNGLHSNLD 60

Query: 61  DDKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVMNRK 120
           DDKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVMNRK
Sbjct: 61  DDKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVMNRK 120

Query: 121 LEDELRGSERSSNALNKDRNDDRNDSILENSFENAEDYIQIPKLRYNSKGKQDKSPQTND 180
           LEDELRGSERSSNALNKDRNDDRNDSILENSFENAEDYIQIPKLRYNSKGKQDKSPQTND
Sbjct: 121 LEDELRGSERSSNALNKDRNDDRNDSILENSFENAEDYIQIPKLRYNSKGKQDKSPQTND 180

Query: 181 LNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSATPPERNNKPIMSSPKIRDPSEE 240
           LNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSATPPERNNKPIMSSPKIRDPSEE
Sbjct: 181 LNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSATPPERNNKPIMSSPKIRDPSEE 240

Query: 241 DILCQESAELKSLENQIELVKKKLLIKRENELRKLSLENELIELMDQLSTDASPYRYGKS 300
           DILCQESAELKSLENQIELVKKKLLIKRENELRKLSLENELIELMDQLSTDASPYRYGKS
Sbjct: 241 DILCQESAELKSLENQIELVKKKLLIKRENELRKLSLENELIELMDQLSTDASPYRYGKS 300

Query: 301 KGNFISTSKHEKHDENLSDIYGDYTGKNSLRKHNIKPFNPIKMDNILETPTPPN 354
           KGNFISTSKHEKHDENLSDIYGDYTGKNSLRKHNIKPFNPIKMDNILETPTPPN
Sbjct: 301 KGNFISTSKHEKHDENLSDIYGDYTGKNSLRKHNIKPFNPIKMDNILETPTPPN 354

>Kwal_26.8190
          Length = 324

 Score =  147 bits (370), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 131/369 (35%), Positives = 181/369 (49%), Gaps = 75/369 (20%)

Query: 1   MNISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYSGINPPVYKNGLHSNLD 60
           MNISPTP+RYNSRG  Y     R     F P+ +             PP+        + 
Sbjct: 1   MNISPTPRRYNSRGYDY----PRETDEAFHPFNQ------------EPPM--------IP 36

Query: 61  DDKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVMNRK 120
            D++VPEE ++   +IN LI QNKEL   +  +++EI+RLN+++G  R KL KY+ +N+K
Sbjct: 37  SDRIVPEEYRVNSQMINKLIKQNKELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNKK 96

Query: 121 LEDELRGSERSSNALNKDRNDDRNDSILENSFENAEDYIQIPKLRYNSKGKQDKSPQTND 180
           L        R                     F   ED +Q+ K   N + ++ + P T D
Sbjct: 97  LGQTSTHPPR---------------------FSPDEDVLQVNK---NRQPRESREPDTRD 132

Query: 181 --LNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSATPPERNNKPIMSS----PKI 234
             L +R+  +   LE       T + + +   SPP  S          P  +S    P  
Sbjct: 133 SQLENRIGDIYSKLEAL-----TNLMAGTTLQSPPAVSQDQRDHVLRVPTSASVSHRPLH 187

Query: 235 RDPSEEDILCQESAELKSLENQIELVKKKLLIKRENELRKLSLENELIELMDQLS-TDAS 293
              SE+DIL QESAELKSLE+QI+L+K+KLLIKRENELRKLSL  EL++LMD+L  +  S
Sbjct: 188 GGASEDDILTQESAELKSLEDQIDLLKRKLLIKRENELRKLSLNKELLDLMDKLDVSKPS 247

Query: 294 PYRYGKSKGNFIS--TSKHEKH---DENLSDIYGDY-TGK----NSLRKHNIKPFNPIKM 343
           P     S    +S  T+ H  H     + S + G + TG     NS R     P+  + M
Sbjct: 248 PEPASTSPPAPVSANTTPHCDHCHKSASQSALNGHHNTGAPGAPNSTRN---PPY--MSM 302

Query: 344 DNILETPTP 352
              LETPTP
Sbjct: 303 AQALETPTP 311

>ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH]
           (494105..495049) [945 bp, 314 aa]
          Length = 314

 Score =  110 bits (275), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 140/290 (48%), Gaps = 56/290 (19%)

Query: 1   MNISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYSGINPPVYKNGLHSNLD 60
           MNISPTPKRY          Q+   +P            N  Y    P  +++    N D
Sbjct: 1   MNISPTPKRY----------QSSNHMPRA---------VNHNYHSAVPAYHEHAAGQNAD 41

Query: 61  DDKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVMNRK 120
             ++VP+E K+   +I+ LI QNK+L   +  +  E+E+LN+++G  R KL KY+ +N+K
Sbjct: 42  --RIVPDEYKINSNMISSLIKQNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKK 99

Query: 121 LEDELRGSERSSNALNKDRNDDRNDSILENSFENAEDYIQIPKLRYNSKGKQDKSPQTND 180
           L+ + + +              R  S  E + E A DY+Q+P  R     + DK  +  +
Sbjct: 100 LQAQAQAA--------------RVPSPPEPAAEPAADYLQLP--RRAPAAENDK--KIGE 141

Query: 181 LNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSATPPERNNKPIMSSPKIRDPSEE 240
           L D+L QL +++ +   ++        +       +                     S++
Sbjct: 142 LYDKLEQLTKVVHQQHLHDPPAPARPRSPARSRSPARTAV-----------------SDD 184

Query: 241 DILCQESAELKSLENQIELVKKKLLIKRENELRKLSLENELIELMDQLST 290
           DI+  ES+ELK LE Q++ +K+K+LIK ENELRKLSL  +L +LM +L  
Sbjct: 185 DIMISESSELKRLEEQVDQLKRKVLIKSENELRKLSLNQQLADLMHKLGV 234

>YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the
           spindle pole body [1092 bp, 363 aa]
          Length = 363

 Score =  103 bits (256), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 118/383 (30%), Positives = 177/383 (46%), Gaps = 50/383 (13%)

Query: 1   MNISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYSGINP-PVYK--NGLHS 57
           MN SPTPKRY+S+  R Y                    +N  Y   NP P+ +  N + S
Sbjct: 1   MNGSPTPKRYSSKSSRLYDDY-----------------YNIPYQYSNPTPMNRDYNDVGS 43

Query: 58  NLDDDKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVM 117
            ++ DKLVPEE K     IN  + QNKEL   +  ++ EI  L  I    R+KL KY  +
Sbjct: 44  RINADKLVPEEYKRNTEFINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDI 103

Query: 118 NRKLEDELRGSERSSNALNKDRNDDRNDSILENSFENAED-------------YIQIPKL 164
            +KLED+    +   + L K +  D N +  E  F   +D              I +PK 
Sbjct: 104 TKKLEDQNLNLQIKISDLEK-KLSDANSTFKEMRFPKVKDPMVDDDPVSENYDQINVPKH 162

Query: 165 RY-NSKG---KQDKSPQTNDLNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSATP 220
           R  ++ G     +K   T+D + RL  + + L           + N++ MSP      T 
Sbjct: 163 RAPDATGNPRTTNKVSNTSDQDSRLKAIERTLSVLTNYVMRSEDGNNDRMSPLPSPLNTI 222

Query: 221 PERNNK-----PIMSSPKIR-DPSEEDILCQESAELKSLENQIELVKKKLLIKRENELRK 274
              NN+     P   +P ++ +PS++DI+  ESAELK +E +IE +K+K+L++++++LRK
Sbjct: 223 LPINNRLNFQEPKRYNPTVKVNPSDDDIMMYESAELKRVEEEIEELKRKILVRKKHDLRK 282

Query: 275 LSLENELIELMDQLSTDASPYRYGKSKGNFISTSKHEKHDENLSDIYGDYTGKNS---LR 331
           LSL N+L EL   +  D +      SK N  +T +H            D   + S     
Sbjct: 283 LSLNNQLQELQSMMDGDDNIKLDNVSKHNH-ATHRHSSQSSRDYSPSSDACLECSNDLYE 341

Query: 332 KHNIKPFNPIKMDNILETPTPPN 354
           K+ +KP N   M     TPTP N
Sbjct: 342 KNRVKPEN--NMSETFATPTPNN 362

>KLLA0F04862g 476880..477830 some similarities with sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42 spindle pole body
           component singleton, hypothetical start
          Length = 316

 Score = 99.4 bits (246), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 89/256 (34%), Positives = 147/256 (57%), Gaps = 34/256 (13%)

Query: 43  YSGINPPVYKNGLHSNLDDDKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNI 102
           ++G  P  +  G  +N  ++++VPEE K   ++IN+LI QNK+L   V  ++EEI+RLN+
Sbjct: 3   HNGSTPRRFVFG--NNDANERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNV 60

Query: 103 IIGQFRAKLTKYSVMNRKLE----DELRGSERSSNALNKDRNDDRNDSILENSFENAEDY 158
           +IG FRAKL KY+ +N+K++    ++     +S  +  + + +  ++S    S E   +Y
Sbjct: 61  LIGSFRAKLIKYTELNKKMQRDQQEQQHNRHQSFESKPRYKAEFTSESSSPVSNERDSEY 120

Query: 159 IQIPKLRYNSKGKQDKSPQTNDLNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSA 218
           +QI K   N++  ++K    +D+  +L  L  L+     N++    +N     P   +S 
Sbjct: 121 LQIKK---NNRHDENK---IDDIYQKLELLTNLV-----NDAIHKQNNGEQREPSNFNS- 168

Query: 219 TPPERNNKPIMSSPKIRDPSEEDILCQESAELKSLENQIELVKKKLLIKRENELRKLSLE 278
                           R  S++DI+  ES E K L++QI+L+K+KLLIK+ENELRKLSL 
Sbjct: 169 ----------------RIVSDDDIIISESQEFKQLQDQIDLLKRKLLIKKENELRKLSLN 212

Query: 279 NELIELMDQLSTDASP 294
            EL +LMD+LS ++SP
Sbjct: 213 KELADLMDELSMNSSP 228

>Scas_711.45
          Length = 335

 Score = 90.9 bits (224), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 88/297 (29%), Positives = 141/297 (47%), Gaps = 34/297 (11%)

Query: 1   MNISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYSGINPPVYKNGLHSNLD 60
           MN+SPTPKRY S       +    +VPE E         N  Y   N P Y +      D
Sbjct: 1   MNVSPTPKRYIS------GTFNPRRVPEPEYNNYHHNYNNHNYQRDNLPRYDDVKRPYQD 54

Query: 61  --DDKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVMN 118
             DD L+P++ K      ++L+  N+ L+  +  +++E+E+L I+    + KL KY+ + 
Sbjct: 55  HLDDALLPDDAKRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLT 114

Query: 119 RKLEDELRGSERSSNALNKDRNDDRNDSILENSFENAEDYIQIPKLRYNSKGKQDKSPQT 178
               DE+   +R    L K+    R    L N     ED         + K    ++ + 
Sbjct: 115 ANSNDEIEILKRRIEDLEKENKRLRRRDELFNEKIKEED---------SDKKVFTETTED 165

Query: 179 NDLNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSATPPERNNKPIMSSPKIRDPS 238
           ++L +++ +L  ++ K +Q          N  + P  +S    E+N+K          P+
Sbjct: 166 DELLEKIEKLTAMILKHKQ-------EQRNSGTTPAKTSWK--EQNSKAY--------PT 208

Query: 239 EEDILCQESAELKSLENQIELVKKKLLIKRENELRKLSLENELIELMDQLSTDASPY 295
           EE +L QES ELKSLE+Q+E ++ KL +KRENE RK+SL  EL++L   L    S +
Sbjct: 209 EETLLTQESLELKSLEDQVEKIRHKLALKRENEQRKISLNKELLKLKSSLEPSLSTF 265

>Scas_625.7d
          Length = 302

 Score = 85.5 bits (210), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 95/332 (28%), Positives = 153/332 (46%), Gaps = 83/332 (25%)

Query: 2   NISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYSGINPPVYKNGLHSNLDD 61
           NISPTP+RY +                 E Y + GL   D                    
Sbjct: 16  NISPTPQRYGT-----------------EKYARYGLRKTD-------------------- 38

Query: 62  DKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVMNRKL 121
            +L+PEE +L    IN+LI  N++L+ T+  + +E++R   +    ++KL KY+ +N KL
Sbjct: 39  -ELLPEESRLSNDAINELIDMNRQLKKTLRDREDELDRYGRLTESLQSKLIKYTNLNNKL 97

Query: 122 EDELRGSERSSNAL----NKDRNDDRNDSIL----------ENSFENAEDYIQIPKLRYN 167
           E E    E  +  L     +  ND R  S+           +   EN +D I IPK  + 
Sbjct: 98  EREKIELELENEKLIDINERLTNDLRTTSVAGDLKYSQKTRKGDDENTDD-IFIPKRGHT 156

Query: 168 SKGKQD------KSPQTNDLNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSATPP 221
            K   +      +      LN +L  L++ L              S D       ++   
Sbjct: 157 FKDTTESNNTDLRKGSAEVLNKKLDTLIEYL--------------SEDKFGAKTGNSRQK 202

Query: 222 ERNNKPIMSSPKIRDPSEEDILCQESAELKSLENQIELVKKKLLIKRENELRKLSLENEL 281
           ER++       ++ D  ++DI+ +ES E+K+LE+Q+E ++KK L+K+ENELRK+SL NEL
Sbjct: 203 ERHD-----HWRLTDDDDDDIITRESLEIKNLEDQVEELRKKTLLKQENELRKISLSNEL 257

Query: 282 IELMDQLSTDASPYRYGKSKGNFISTSKHEKH 313
           +EL  +LS+D +    G  + N +   KH++H
Sbjct: 258 LELATKLSSDTT---LGDDEVNGL--KKHKRH 284

>Kwal_56.24375
          Length = 806

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 74  TVINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVMNRKLEDELRGSERSSN 133
             + D +SQ K    T+     E E ++++  Q  A+L    + N++L +E+R  ER   
Sbjct: 621 AFVEDAMSQVKITPITLKRYIAEYEEIHLLESQKEAQLESLRIKNKQLHNEVRKLERDHT 680

Query: 134 ALNKDRNDDRNDSILEN--SFENAED 157
           ALN++     N+ ++EN  +FE  +D
Sbjct: 681 ALNREHIAIANE-LIENRLAFETLQD 705

>YKL179C (COY1) [3093] chr11 complement(110469..112508) Golgi
           membrane protein, member of CASP family of Golgi
           proteins, shows genetic interaction with GOS1 [2040 bp,
           679 aa]
          Length = 679

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 71/146 (48%), Gaps = 21/146 (14%)

Query: 64  LVPEEIKL-QRTVINDLISQN--KELQTTVHTQREEIERLNIIIGQ----------FRAK 110
           L  +E+KL Q    N L+S +  +E ++T H   E  E+LN ++ +           R K
Sbjct: 276 LHAKELKLNQLESENALLSASYEQERKSTSHAINELKEQLNSVVAESESYKSELETVRRK 335

Query: 111 LTKYSVMNRKLEDELRGSERSSNALNKD------RNDDRNDSILENSFENAEDYIQIPKL 164
           L  YS  N K+++EL   ++    +N+D      R++D+ND+  E+S  +A   +Q    
Sbjct: 336 LNNYSDYN-KIKEELSALKKIEFGVNEDDSDNDIRSEDKNDNTFESSLLSANKKLQATLA 394

Query: 165 RYNSKGKQDKSPQTNDLNDRLSQLVQ 190
            Y SK    +  + N+L   + QL Q
Sbjct: 395 EYRSKSTA-QEEERNELKKSVDQLKQ 419

>YPR190C (RPC82) [5604] chr16 complement(917071..919035) RNA
           polymerase III, third-largest subunit [1965 bp, 654 aa]
          Length = 654

 Score = 31.6 bits (70), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 231 SPKIRDPSEEDILCQESAELKSLENQIELVKKK 263
           SPKIRDP  +  L Q+  E KS +++ ELV++K
Sbjct: 323 SPKIRDPLTQTGLLQDLEEAKSFQDEAELVEEK 355

>KLLA0D10285g 869754..871301 similar to sp|Q04489 Saccharomyces
           cerevisiae YML096w singleton, start by similarity
          Length = 515

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 11/64 (17%)

Query: 17  YYASQARGKVP---EFEPYRKSGLNFNDGYSGINPPVYKNGLH--SNLDDDKLVPEEIKL 71
           Y+AS+ RGKV    E +PY +SG+     +SG+       G H  SN  +++LV   I+L
Sbjct: 366 YFASRGRGKVTENGESKPYNRSGIVM---FSGLGADELYGGYHKFSNKSNEELV---IEL 419

Query: 72  QRTV 75
           Q+ +
Sbjct: 420 QKQI 423

>AFR103W [3295] [Homologous to ScYJL083W - SH; ScYKR019C (IRS4) -
           SH] complement(620501..622735) [2235 bp, 744 aa]
          Length = 744

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 14/85 (16%)

Query: 49  PVYKNGLHSNLDDDKLVPEEIKLQRTVINDLISQNKELQTT-------VHTQRE-EIERL 100
           P + NG   N D+ + VPE+  +   V+ D+ S++   Q T       V T+R+  ++R 
Sbjct: 617 PWWNNG---NYDETREVPEDGLMLNLVVTDIWSRSNLPQDTLAQIYDMVDTRRDGTLDRN 673

Query: 101 NIIIGQFRAKLTKYSVMNRKLEDEL 125
           + ++G +   L   S+  RKL  EL
Sbjct: 674 SFVVGMW---LVDQSLYGRKLPREL 695

>YOR232W (MGE1) [5023] chr15 (774573..775259) Protein that
           participates with Ssc1p and Mdj1p in folding of proteins
           during mitochondrial (mt) import, involved in protection
           of mt DNA synthesis activity (Mip1p) during heat shock,
           member of mt Hsp70-Hsp78 bi-chaperone system, homolog of
           E. coli GrpE [687 bp, 228 aa]
          Length = 228

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 62/134 (46%), Gaps = 24/134 (17%)

Query: 243 LCQESAELKSLENQIELVKKKLLIKRENELRKLSLENELIELMD---QLSTDASPYRYGK 299
           L +E +E+K LE+Q+    K+    ++  LR ++    L ++     Q + D +  ++ K
Sbjct: 60  LTEEQSEIKKLESQLSAKTKEASELKDRLLRSVADFRNLQQVTKKDIQKAKDFALQKFAK 119

Query: 300 -------SKGNFISTSKHE--KHDENLSDIYGDY-----TGKNSLRKHNI-------KPF 338
                  + G+ ++  K E  +  + +SD+Y          +N+LRKH I       +PF
Sbjct: 120 DLLESVDNFGHALNAFKEEDLQKSKEISDLYTGVRMTRDVFENTLRKHGIEKLDPLGEPF 179

Query: 339 NPIKMDNILETPTP 352
           +P K +   E P P
Sbjct: 180 DPNKHEATFELPQP 193

>YPR106W (ISR1) [5527] chr16 (740057..741388) Serine-threonine
           protein kinase involved in staurosporine resistance
           [1332 bp, 443 aa]
          Length = 443

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 46/105 (43%), Gaps = 1/105 (0%)

Query: 161 IPKLRYNSKGKQDKSPQTNDLNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSATP 220
            P +  NSKG   + PQ +  N   S LV  +E+     S    ++ +  + PV +S   
Sbjct: 18  FPSISNNSKGFAYRQPQKHKSNFAYSHLVSPVEEPTAKFSEAFQTDYSSKA-PVATSEAH 76

Query: 221 PERNNKPIMSSPKIRDPSEEDILCQESAELKSLENQIELVKKKLL 265
            + +   + ++P+   P    ++ + S  + SLE   E +   LL
Sbjct: 77  LKNDLDVLFTTPRFYSPENLALMFRLSNTVSSLEFLDEFLMGILL 121

>CAGL0J02992g 286008..286700 similar to sp|P40040 Saccharomyces
           cerevisiae YER063w THO1, start by similarity
          Length = 230

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 14/93 (15%)

Query: 201 TKINSNSNDMSPPVCSSATPPERNNKPI---MSSPKIRDPSEE--DILCQESAELKSLEN 255
           TK    SN+ +P V S        +KP      +P++++P +E  DIL  E  E+K  + 
Sbjct: 83  TKAEPASNEAAPAVASEQPAEASEDKPAEVQEKAPEVKEPEKELFDILTAE--EIK--QR 138

Query: 256 QIELVKKKLLIKRENELRKLSLENELIELMDQL 288
             EL+ KKL     +  +K   E + I+ +++L
Sbjct: 139 ATELIDKKL-----HRAKKFGAEQDQIDSLEKL 166

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.129    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,737,302
Number of extensions: 693258
Number of successful extensions: 3944
Number of sequences better than 10.0: 437
Number of HSP's gapped: 3848
Number of HSP's successfully gapped: 513
Length of query: 354
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 251
Effective length of database: 13,030,455
Effective search space: 3270644205
Effective search space used: 3270644205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 62 (28.5 bits)