Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L01771g43542821200.0
Scas_625.85211355281e-61
YKL043W (PHD1)3661265153e-61
Scas_106.14231065194e-61
YMR016C (SOK2)7851065306e-60
ABR055C6781065231e-59
KLLA0F04840g6361095175e-59
Scas_709.527251065216e-59
Kwal_26.81765921445122e-58
CAGL0M07634g2571003764e-42
YER111C (SWI4)10931281156e-06
Scas_510.210431021131e-05
KLLA0E05357g754771131e-05
YDL056W (MBP1)833771103e-05
Sklu_1824.2179831034e-05
CAGL0A04565g10411281032e-04
CAGL0D01012g802771003e-04
Kwal_27.107569221011004e-04
Scas_683.3782078987e-04
AGL297C97082940.002
KLLA0E20867g93379930.003
AFR600C81577930.003
Sklu_2055.374377930.003
Kwal_26.935974277920.003
Kwal_0.7077248800.096
Scas_671.2067671730.66
KLLA0F08701g34669638.6
Scas_556.61022158639.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L01771g
         (428 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L01771g 196974..198281 some similarities with sp|P36093 Sac...   821   0.0  
Scas_625.8                                                            207   1e-61
YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription facto...   202   3e-61
Scas_106.1                                                            204   4e-61
YMR016C (SOK2) [3980] chr13 complement(303235..305592) Transcrip...   208   6e-60
ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W (P...   206   1e-59
KLLA0F04840g 474544..476454 some similarities with sp|P53438 Sac...   203   5e-59
Scas_709.52                                                           205   6e-59
Kwal_26.8176                                                          201   2e-58
CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces c...   149   4e-42
YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcript...    49   6e-06
Scas_510.2                                                             48   1e-05
KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA Kluyv...    48   1e-05
YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor ...    47   3e-05
Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement         44   4e-05
CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces c...    44   2e-04
CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces c...    43   3e-04
Kwal_27.10756                                                          43   4e-04
Scas_683.37                                                            42   7e-04
AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH] (147990..15...    41   0.002
KLLA0E20867g complement(1852522..1855323) weakly similar to sp|P...    40   0.003
AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH] (1517341..1...    40   0.003
Sklu_2055.3 YDL056W, Contig c2055 5141-7372                            40   0.003
Kwal_26.9359                                                           40   0.003
Kwal_0.70                                                              35   0.096
Scas_671.20                                                            33   0.66 
KLLA0F08701g 811112..812152 some similarities with sgd|S0005842 ...    29   8.6  
Scas_556.6                                                             29   9.7  

>CAGL0L01771g 196974..198281 some similarities with sp|P36093
           Saccharomyces cerevisiae YKL043w PHD1 or sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2, hypothetical
           start
          Length = 435

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/428 (95%), Positives = 408/428 (95%)

Query: 1   MTSSAQYINTATANTYYQMSYPPNAQQHXXXXXXXXXXXXXXXXXXXXTSIPQHQPIYYS 60
           MTSSAQYINTATANTYYQMSYPPNAQQH                    TSIPQHQPIYYS
Sbjct: 1   MTSSAQYINTATANTYYQMSYPPNAQQHVVYRYNPYQQPQPQHIQHVQTSIPQHQPIYYS 60

Query: 61  TSGSGYVSAVYQQGSSTPVTASRMSQSSASGNAAVGNGSTVITQGSGLVSTTPQYTTSTS 120
           TSGSGYVSAVYQQGSSTPVTASRMSQSSASGNAAVGNGSTVITQGSGLVSTTPQYTTSTS
Sbjct: 61  TSGSGYVSAVYQQGSSTPVTASRMSQSSASGNAAVGNGSTVITQGSGLVSTTPQYTTSTS 120

Query: 121 INALNQAHHVYPYRSSPTYPTIIPAGQIGSGSRHNSASEIRSSIVGHQQPTHLTIAAIPD 180
           INALNQAHHVYPYRSSPTYPTIIPAGQIGSGSRHNSASEIRSSIVGHQQPTHLTIAAIPD
Sbjct: 121 INALNQAHHVYPYRSSPTYPTIIPAGQIGSGSRHNSASEIRSSIVGHQQPTHLTIAAIPD 180

Query: 181 SQQHHSLRVLSSAVAGDGKGPRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLL 240
           SQQHHSLRVLSSAVAGDGKGPRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLL
Sbjct: 181 SQQHHSLRVLSSAVAGDGKGPRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLL 240

Query: 241 NVTKMTRGKRDGILRSEKYRKVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRD 300
           NVTKMTRGKRDGILRSEKYRKVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRD
Sbjct: 241 NVTKMTRGKRDGILRSEKYRKVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRD 300

Query: 301 ITSVLKTSLKPSSLVIPMQDNTTVTSKIYQLPASNHVISNATQSSSVHDGYHSPTSHVRM 360
           ITSVLKTSLKPSSLVIPMQDNTTVTSKIYQLPASNHVISNATQSSSVHDGYHSPTSHVRM
Sbjct: 301 ITSVLKTSLKPSSLVIPMQDNTTVTSKIYQLPASNHVISNATQSSSVHDGYHSPTSHVRM 360

Query: 361 IPKIEEQQHSPTSTSHQYVRLPTIIKREDEERPILKSSSSTPPLIKSEDNDSSWDSRRAS 420
           IPKIEEQQHSPTSTSHQYVRLPTIIKREDEERPILKSSSSTPPLIKSEDNDSSWDSRRAS
Sbjct: 361 IPKIEEQQHSPTSTSHQYVRLPTIIKREDEERPILKSSSSTPPLIKSEDNDSSWDSRRAS 420

Query: 421 KSDVTKIS 428
           KSDVTKIS
Sbjct: 421 KSDVTKIS 428

>Scas_625.8
          Length = 521

 Score =  207 bits (528), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%)

Query: 171 THLTIAAIPDSQQHHSLRVLSSAVAGDGKGPRIITTIWEDENTLCYQVEANGVSVVRRAD 230
           T+LT   IP  +   S    + ++      PR+ITT+WEDE TLCYQVE NGV+VVRRAD
Sbjct: 178 TNLTEPFIPVEKPDQSKDGTNDSLEVKKHIPRVITTMWEDERTLCYQVECNGVAVVRRAD 237

Query: 231 NDMINGTKLLNVTKMTRGKRDGILRSEKYRKVVKIGSMHLKGVWIPFERALFIAKREKIV 290
           NDMINGTKLLNVTKMTRG+RDGILR+EK R V+KIGSMHLKGVWIPF+RAL +AKREKIV
Sbjct: 238 NDMINGTKLLNVTKMTRGRRDGILRAEKVRSVIKIGSMHLKGVWIPFDRALMMAKREKIV 297

Query: 291 DLLYPLFVRDITSVL 305
           DLLYPLFV+DI S+L
Sbjct: 298 DLLYPLFVKDINSIL 312

>YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription factor
           involved in regulation of filamentous growth [1101 bp,
           366 aa]
          Length = 366

 Score =  202 bits (515), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (85%), Gaps = 7/126 (5%)

Query: 201 PRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYR 260
           PR+ITT+WEDENT+CYQVEANG+SVVRRADN+MINGTKLLNVTKMTRG+RDGILRSEK R
Sbjct: 185 PRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKVR 244

Query: 261 KVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDITSVL-------KTSLKPSS 313
           +VVKIGSMHLKGVWIPFERA  +A+RE+I+D LYPLFV+DI S++       K SL P S
Sbjct: 245 EVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKPSNKASLTPKS 304

Query: 314 LVIPMQ 319
              P++
Sbjct: 305 SPAPIK 310

>Scas_106.1
          Length = 423

 Score =  204 bits (519), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 99/106 (93%)

Query: 201 PRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYR 260
           PR+ TT+WEDE TLCYQVEA GVSVVRRADNDMINGTKLLNVTKMTRG+RDGIL++EK R
Sbjct: 154 PRVTTTMWEDEKTLCYQVEACGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKAEKIR 213

Query: 261 KVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDITSVLK 306
            VVKIGSMHLKGVWIPF+RAL +A+REKIVDLL+PLFVRDI SV++
Sbjct: 214 HVVKIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQ 259

>YMR016C (SOK2) [3980] chr13 complement(303235..305592)
           Transcription factor with dual roles as both activator
           and repressor, negatively regulates meiosis, involved in
           regulation of cAMP-dependent kinase-stimulated growth,
           pseudohyphal differentiation, and sporulation [2358 bp,
           785 aa]
          Length = 785

 Score =  208 bits (530), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 89/106 (83%), Positives = 98/106 (92%)

Query: 201 PRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYR 260
           PR+ TT+WEDE TLCYQVEANG+SVVRRADNDM+NGTKLLNVTKMTRG+RDGIL++EK R
Sbjct: 413 PRVTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIR 472

Query: 261 KVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDITSVLK 306
            VVKIGSMHLKGVWIPFERAL IA+REKI D LYPLF+RDI SVLK
Sbjct: 473 HVVKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLK 518

>ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W
           (PHD1) - SH] (495331..497367) [2037 bp, 678 aa]
          Length = 678

 Score =  206 bits (523), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 100/106 (94%)

Query: 201 PRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYR 260
           PR+ TT+WEDE+TLCYQVEANGVSVVRRADNDMINGTKLLNV KMTRG+RDGIL++EK R
Sbjct: 329 PRVTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVR 388

Query: 261 KVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDITSVLK 306
            VVKIGSMHLKGVWIPFERAL +A+REKIVD+L+PLFVRDI SV++
Sbjct: 389 HVVKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQ 434

>KLLA0F04840g 474544..476454 some similarities with sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2 regulatory protein
           in the PKA signal transduction pathway, hypothetical
           start
          Length = 636

 Score =  203 bits (517), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 88/109 (80%), Positives = 101/109 (92%)

Query: 198 GKGPRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSE 257
           G+  ++ TT+WEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVT+MTRG+RDGIL++E
Sbjct: 360 GQRSKVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAE 419

Query: 258 KYRKVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDITSVLK 306
           K R VVKIGSMHLKGVWIPFERAL +A+REKIVDLLY LFVRDI S+++
Sbjct: 420 KIRHVVKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQ 468

>Scas_709.52
          Length = 725

 Score =  205 bits (521), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 89/106 (83%), Positives = 97/106 (91%)

Query: 201 PRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYR 260
           PR+ TT+WEDE T+CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRG+RDGIL+SEK R
Sbjct: 384 PRVTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIR 443

Query: 261 KVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDITSVLK 306
            VVKIGSMHLKGVW+PFERA  +A RE I+DLLYPLFVRDI SVLK
Sbjct: 444 HVVKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLK 489

>Kwal_26.8176
          Length = 592

 Score =  201 bits (512), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 93/144 (64%), Positives = 111/144 (77%), Gaps = 5/144 (3%)

Query: 203 IITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYRKV 262
           + TT+WEDE+TLCYQVEANGVSVVRRADNDMINGTKLLNV KMTRG+RDGIL++EK R V
Sbjct: 217 VTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHV 276

Query: 263 VKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDITSVLKTSLKPSSLVIPMQDNT 322
           VKIGSMHLKGVWIPF+RAL +A+REKIVDLL+PLFVRDI SV++     + LV P     
Sbjct: 277 VKIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGAS-TVLVGPAASGA 335

Query: 323 TVTSKIYQLPASNHVISNATQSSS 346
           T       +P++    +N  Q  +
Sbjct: 336 TAGG----MPSAGAARANMNQGGA 355

>CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces
           cerevisiae YMR016c SOK2 or sp|P36093 Saccharomyces
           cerevisiae YKL043w PHD1, hypothetical start
          Length = 257

 Score =  149 bits (376), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%)

Query: 202 RIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYRK 261
           R+ITT WEDE+T+C+ V  NGV+VVRRADNDM+NGTKLLNVT MTRG+RDGIL++E  R 
Sbjct: 121 RVITTYWEDEHTICHGVNHNGVTVVRRADNDMVNGTKLLNVTGMTRGRRDGILKNEPVRD 180

Query: 262 VVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDI 301
           VVK G M LKGVWIP +RA  IA++E I   LYPLF+ D+
Sbjct: 181 VVKGGPMTLKGVWIPIDRARAIARQEGIEQWLYPLFIDDL 220

>YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcription
           factor that is a component of the SBF (Swi4p-Swi6p)
           complex that regulates expression at promoters
           containing the cell cycle box (CCB) element, contains
           two ankyrin repeats [3282 bp, 1093 aa]
          Length = 1093

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 60/128 (46%), Gaps = 6/128 (4%)

Query: 170 PTHLTIAAIPDSQQHHSLRVLSSAV--AGDGKGPRI-ITTIWEDENTLCYQVEANGVSVV 226
           P  + I+   D+  H ++  +S +V  A     P I I T  E +   CY        V+
Sbjct: 2   PFDVLISNQKDNTNHQNITPISKSVLLAPHSNHPVIEIATYSETDVYECYIRGFETKIVM 61

Query: 227 RRADNDMINGTKLLNVTKMTRGKRDGILRSEK---YRKVVKIGSMHLKGVWIPFERALFI 283
           RR  +D IN T++  + + ++ KR  IL  E      + V+ G    +G WIP + A F+
Sbjct: 62  RRTKDDWINITQVFKIAQFSKTKRTKILEKESNDMQHEKVQGGYGRFQGTWIPLDSAKFL 121

Query: 284 AKREKIVD 291
             + +I+D
Sbjct: 122 VNKYEIID 129

>Scas_510.2
          Length = 1043

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 10/102 (9%)

Query: 215 CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEK---YRKVVKIGSMHLK 271
           CY        V+RR  +D IN T++  +   ++  R  +L  E      + V+ G    +
Sbjct: 64  CYIKGFESRIVMRRTKDDWINVTQVFKIADFSKAHRTKVLEKESSDMMHEKVQGGYGRFQ 123

Query: 272 GVWIPFERALFIAKREKIVDLLYPLFVRDITSVLKTSLKPSS 313
           G WIP E AL + ++ KI D   P+    +T++L   L P++
Sbjct: 124 GTWIPLESALMLVQKYKIND---PV----VTTILHFKLDPAN 158

>KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA
           Kluyveromyces lactis Transcription factor MBP1 (MBF
           subunit P120), start by similarity
          Length = 754

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 224 SVVRRADNDMINGTKLLNVTKMTRGKRDGILRSE---KYRKVVKIGSMHLKGVWIPFERA 280
           S+++R  ++ +N T +L   K  + KR  IL  E      + V+ G    +G WIP E A
Sbjct: 25  SIMKRKADNWVNATHILKAAKFPKAKRTRILEKEVITDTHEKVQGGFGKYQGTWIPLELA 84

Query: 281 LFIAKREKIVDLLYPLF 297
             +A++ +++D L PLF
Sbjct: 85  SKLAEKFEVLDELKPLF 101

>YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor
           that collaborates with Swi6p to form the MBF
           (Mbp1p-Swi6p) factor for regulation at Mlu1 cell cycle
           box (MCB) elements, has two ankyrin repeats [2502 bp,
           833 aa]
          Length = 833

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 224 SVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYRKV---VKIGSMHLKGVWIPFERA 280
           S+++R  +D +N T +L      + KR  IL  E  ++    V+ G    +G W+P   A
Sbjct: 24  SIMKRKKDDWVNATHILKAANFAKAKRTRILEKEVLKETHEKVQGGFGKYQGTWVPLNIA 83

Query: 281 LFIAKREKIVDLLYPLF 297
             +A++  + D L PLF
Sbjct: 84  KQLAEKFSVYDQLKPLF 100

>Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement
          Length = 179

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 215 CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSE----KYRKVVKIGSMHL 270
           CY        V+RR  ++ +N T++  +   ++ +R  IL  E    K+ K+ + G    
Sbjct: 28  CYCRGKESKIVMRRCQDNWVNITQVFKIASFSKTQRTKILEKESNDMKHEKI-QGGYGRF 86

Query: 271 KGVWIPFERALFIAKREKIVDLL 293
           +G WIP E A ++  + K+ D++
Sbjct: 87  QGTWIPLENARYLVSKYKVDDII 109

>CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces
           cerevisiae YER111c SWI4, start by similarity
          Length = 1041

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 56/128 (43%), Gaps = 14/128 (10%)

Query: 170 PTHLTIAAIPDSQQHHSLRVLSSAVAGD---GKGPRIITTIWEDENTL-CYQVEANGVSV 225
           P +L I   P S    SL     A A D   G  P I    + D +   CY        V
Sbjct: 8   PNYLMIGTHPMSNVPSSL-----AAAVDTSSGMAPIIEIATYADTDVYECYIRGQESNIV 62

Query: 226 VRRADNDMINGTKLLNVTKMTRGKRDGILRSE----KYRKVVKIGSMHLKGVWIPFERAL 281
           +RR  +D +N T++  + + ++ +R  IL  E    K+ K V+ G    +G W+P E A 
Sbjct: 63  MRRTMDDWVNVTQVFKIAQFSKTQRTKILEKESTNMKHEK-VQGGYGRFQGTWVPLEAAK 121

Query: 282 FIAKREKI 289
           F+  +  I
Sbjct: 122 FMTTKYNI 129

>CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces
           cerevisiae YDL056w MBP1 transcription factor, start by
           similarity
          Length = 802

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 224 SVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYRKV---VKIGSMHLKGVWIPFERA 280
           S+++R ++  +N T +L      + KR  IL  E  +++   V+ G    +G W+P   A
Sbjct: 24  SIMKRKNDGWVNATHILKAANFAKAKRTRILEKEVLKEMHEKVQGGFGKYQGTWVPLNIA 83

Query: 281 LFIAKREKIVDLLYPLF 297
           + +A++  +   L PLF
Sbjct: 84  INLAEKFDVYQDLKPLF 100

>Kwal_27.10756
          Length = 922

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 49/101 (48%), Gaps = 12/101 (11%)

Query: 215 CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSE----KYRKVVKIGSMHL 270
           CY        V+RR  +D +N T++  +   ++ +R  IL  E    K+ K ++ G    
Sbjct: 46  CYCRGQESRIVMRRCMDDWVNITQVFKIASFSKTQRTKILEKESNMVKHEK-IQGGYGRF 104

Query: 271 KGVWIPFERALFIAKREKIVDLLYPLFVRDITSVLKTSLKP 311
           +G WIP E A ++ ++  + D++       ++++L   L P
Sbjct: 105 QGTWIPLENAHYLVQKYSVSDVV-------VSTILHFQLDP 138

>Scas_683.37
          Length = 820

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 224 SVVRRADNDMINGTKLLNVTKMTRGKRDGILRSE----KYRKVVKIGSMHLKGVWIPFER 279
           SV++R  +D +N T +L      + KR  IL  E    K+ KV + G    +G W+P E 
Sbjct: 24  SVMKRKKDDWVNATHILKAANFAKAKRTRILDKEVMGRKHEKV-QGGFGKYQGTWVPLEI 82

Query: 280 ALFIAKREKIVDLLYPLF 297
           A  +A +  + + L  LF
Sbjct: 83  ATELAMKFDVYEELRALF 100

>AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH]
           (147990..150902) [2913 bp, 970 aa]
          Length = 970

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 39/82 (47%), Gaps = 3/82 (3%)

Query: 215 CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKY---RKVVKIGSMHLK 271
           CY        V+RR  +D +N T++  V   ++ +R  IL  E      + ++ G    +
Sbjct: 33  CYCRGKESSIVMRRLHDDWVNITQVFKVATFSKTQRTKILEKESADISHEKIQGGYGRFQ 92

Query: 272 GVWIPFERALFIAKREKIVDLL 293
           G WIP + A  +  + +I D++
Sbjct: 93  GTWIPLDSAKGLVAKYEITDIV 114

>KLLA0E20867g complement(1852522..1855323) weakly similar to
           sp|P25302 Saccharomyces cerevisiae YER111c SWI4
           transcription factor, start by similarity
          Length = 933

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 215 CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSE----KYRKVVKIGSMHL 270
           CY  +     ++RR +++ +N T++      T+ +R  IL  E    K+ K ++ G    
Sbjct: 109 CYTKDKPPCLIMRRCNDNWLNITQVFKAGSFTKAQRTKILEKEANEIKHEK-IQGGYGRF 167

Query: 271 KGVWIPFERALFIAKREKI 289
           +G WIP+E   ++ ++  I
Sbjct: 168 QGTWIPWESTKYLVEKYNI 186

>AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH]
           (1517341..1519788) [2448 bp, 815 aa]
          Length = 815

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 224 SVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYRKV---VKIGSMHLKGVWIPFERA 280
           S+++R  +D +N T +L   K  + KR  IL  E  +     V+ G    +G W+P + A
Sbjct: 31  SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEVIKDTHEKVQGGFGKYQGTWVPLDIA 90

Query: 281 LFIAKREKIVDLLYPLF 297
             +A++ ++++ L PLF
Sbjct: 91  RRLAQKFEVLEELRPLF 107

>Sklu_2055.3 YDL056W, Contig c2055 5141-7372
          Length = 743

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 224 SVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYRKV---VKIGSMHLKGVWIPFERA 280
           S+++R  +D +N T +L   K  + KR  IL  E  + +   V+ G    +G W+P + A
Sbjct: 27  SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEVIKDIHEKVQGGFGKYQGTWVPLDIA 86

Query: 281 LFIAKREKIVDLLYPLF 297
             +A +  +++ L PLF
Sbjct: 87  RKLASKFDVMEELKPLF 103

>Kwal_26.9359
          Length = 742

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 224 SVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYRKV---VKIGSMHLKGVWIPFERA 280
           S+++R ++D +N T +L   K  + KR  IL  E  +     V+ G    +G W+P + A
Sbjct: 25  SIMKRKEDDWVNATHILKAAKFAKAKRTRILEKEVIKDTHEKVQGGFGKYQGTWVPLDIA 84

Query: 281 LFIAKREKIVDLLYPLF 297
             +A + +++  L PLF
Sbjct: 85  RNLAAKFEVLSELKPLF 101

>Kwal_0.70
          Length = 772

 Score = 35.4 bits (80), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 331 LPASNHVISNATQSSSVHDGYHSPTS-HVRMIPKIEEQQHSPTSTSHQ 377
           LP    + SN T++ +++D +HS T+ H+ ++P I E+++ P++   Q
Sbjct: 498 LPQLKGLRSNLTETKNINDRFHSETTEHIMLVPMIFERKNVPSAFQDQ 545

>Scas_671.20
          Length = 676

 Score = 32.7 bits (73), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 5/71 (7%)

Query: 241 NVTKMTRGKRDGILRSEK---YRKVVKIGSMHLKGVWIPFERALFIAKR--EKIVDLLYP 295
           N+ +M +G     L S K   + + ++ G + ++G W+P E A  I  +    I  LL P
Sbjct: 323 NILQMEKGITSDYLASMKDCDFCQRIRGGYIKIQGTWLPIEMAKLICTKFCFPIRYLLVP 382

Query: 296 LFVRDITSVLK 306
           +F  D   + +
Sbjct: 383 IFGNDFPKICQ 393

>KLLA0F08701g 811112..812152 some similarities with sgd|S0005842
           Saccharomyces cerevisiae YOR315w hypothetical protein,
           hypothetical start
          Length = 346

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 33/69 (47%)

Query: 58  YYSTSGSGYVSAVYQQGSSTPVTASRMSQSSASGNAAVGNGSTVITQGSGLVSTTPQYTT 117
           YY++S     + VY++   T    S+ +   AS +AAV        + S +++ + + TT
Sbjct: 256 YYNSSDEDQDNLVYERNDDTNEQNSKQANDKASSDAAVIRAYDFNFEDSTILNKSDRVTT 315

Query: 118 STSINALNQ 126
              I + NQ
Sbjct: 316 HLGIYSQNQ 324

>Scas_556.6
          Length = 1022

 Score = 28.9 bits (63), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 73/158 (46%), Gaps = 15/158 (9%)

Query: 226 VRRADNDMI----NGTKLLNVTKMTRGKRDGILRSEKYRKVVKIGSMHLKGV-------- 273
           + R +ND+        KLL   + T GK +G  RS  Y K  ++  +  + +        
Sbjct: 92  ITRLENDVEYWKNKAMKLLEEKEQTNGKSNGFKRSSSYVKEEELDRVDNQTIDKRLKTQS 151

Query: 274 WIPFERALFIAKREKIVDLLYPLFVRDITSVLKTSLKP-SSLVIPMQDN--TTVTSKIYQ 330
            +P ++A    K + +V+L        ++ V+K  +KP S   I +QD   +T+ S ++ 
Sbjct: 152 TVPLQKATHATKDDIMVNLYKNNPTMIMSKVMKREVKPLSENYILIQDKFISTLISSVFL 211

Query: 331 LPASNHVISNATQSSSVHDGYHSPTSHVRMIPKIEEQQ 368
            P+ N +I   T ++++     S T++   + +I  +Q
Sbjct: 212 DPSKNTMIPALTANANISRTQPSVTTNALKLKEILVKQ 249

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.124    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,174,391
Number of extensions: 544742
Number of successful extensions: 2533
Number of sequences better than 10.0: 124
Number of HSP's gapped: 2457
Number of HSP's successfully gapped: 167
Length of query: 428
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 324
Effective length of database: 12,995,837
Effective search space: 4210651188
Effective search space used: 4210651188
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)