Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L01749g50249426490.0
YKL045W (PRI2)52850919110.0
Scas_625.952451418440.0
Kwal_26.820650650017910.0
Sklu_2411.1050449817570.0
KLLA0F04818g49349315570.0
ABR056C48950013720.0
Scas_583.1338448720.80
KLLA0F27797g1101109692.7
YPL149W (ATG5)29455672.8
Scas_713.334934164649.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L01749g
         (494 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L01749g 184351..185859 highly similar to sp|P20457 Saccharo...  1025   0.0  
YKL045W (PRI2) [3214] chr11 (353138..354724) DNA primase large s...   740   0.0  
Scas_625.9                                                            714   0.0  
Kwal_26.8206                                                          694   0.0  
Sklu_2411.10 YKL045W, Contig c2411 18845-20359                        681   0.0  
KLLA0F04818g 469283..470764 similar to sp|P20457 Saccharomyces c...   604   0.0  
ABR056C [647] [Homologous to ScYKL045W (PRI2) - SH] (498192..499...   533   0.0  
Scas_583.13                                                            32   0.80 
KLLA0F27797g complement(2572415..2575720) similar to sp|P40541 S...    31   2.7  
YPL149W (ATG5) [5298] chr16 (271309..272193) Protein involved in...    30   2.8  
Scas_713.33                                                            29   9.5  

>CAGL0L01749g 184351..185859 highly similar to sp|P20457
           Saccharomyces cerevisiae YKL045w PRI2, start by
           similarity
          Length = 502

 Score = 1025 bits (2649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/494 (100%), Positives = 494/494 (100%)

Query: 1   MFRQSKKRVSMRRNFAEDRGDASAIIIGATTTEEEKKLYQRIYENKLSFYDIPPQGEITL 60
           MFRQSKKRVSMRRNFAEDRGDASAIIIGATTTEEEKKLYQRIYENKLSFYDIPPQGEITL
Sbjct: 1   MFRQSKKRVSMRRNFAEDRGDASAIIIGATTTEEEKKLYQRIYENKLSFYDIPPQGEITL 60

Query: 61  EEFEIWAIDRLKLLLEIESCLARNKTLKEIEGIIKPLFKKYNIFNNMDTFEDRKKEYYSH 120
           EEFEIWAIDRLKLLLEIESCLARNKTLKEIEGIIKPLFKKYNIFNNMDTFEDRKKEYYSH
Sbjct: 61  EEFEIWAIDRLKLLLEIESCLARNKTLKEIEGIIKPLFKKYNIFNNMDTFEDRKKEYYSH 120

Query: 121 FILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKFVKSLNLPSLQFIDEEEKAEL 180
           FILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKFVKSLNLPSLQFIDEEEKAEL
Sbjct: 121 FILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKFVKSLNLPSLQFIDEEEKAEL 180

Query: 181 STQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPFESVIELVGNRQVFLKNGYAYLP 240
           STQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPFESVIELVGNRQVFLKNGYAYLP
Sbjct: 181 STQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPFESVIELVGNRQVFLKNGYAYLP 240

Query: 241 QFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRLIPILNHLSSGYTIADSGSFDSQFG 300
           QFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRLIPILNHLSSGYTIADSGSFDSQFG
Sbjct: 241 QFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRLIPILNHLSSGYTIADSGSFDSQFG 300

Query: 301 NNEDNEINAKSVWSEEISKHYPLSVKNLFYGLKENNHLRYHGRQQLTLFLKGIGLSVDEA 360
           NNEDNEINAKSVWSEEISKHYPLSVKNLFYGLKENNHLRYHGRQQLTLFLKGIGLSVDEA
Sbjct: 301 NNEDNEINAKSVWSEEISKHYPLSVKNLFYGLKENNHLRYHGRQQLTLFLKGIGLSVDEA 360

Query: 361 LKFWHDAFTKNNKMTTEKFNKEYRYNIRHSYGLEGNRINYKPWDCRTILSKPRPNRGEYH 420
           LKFWHDAFTKNNKMTTEKFNKEYRYNIRHSYGLEGNRINYKPWDCRTILSKPRPNRGEYH
Sbjct: 361 LKFWHDAFTKNNKMTTEKFNKEYRYNIRHSYGLEGNRINYKPWDCRTILSKPRPNRGEYH 420

Query: 421 GCPFRDWNHDRLTSELSKMGLTTQQITDVLDSCDKHEYTIACTKVFEMTHNVPEGESMHI 480
           GCPFRDWNHDRLTSELSKMGLTTQQITDVLDSCDKHEYTIACTKVFEMTHNVPEGESMHI
Sbjct: 421 GCPFRDWNHDRLTSELSKMGLTTQQITDVLDSCDKHEYTIACTKVFEMTHNVPEGESMHI 480

Query: 481 SHPNLYFERSRQLE 494
           SHPNLYFERSRQLE
Sbjct: 481 SHPNLYFERSRQLE 494

>YKL045W (PRI2) [3214] chr11 (353138..354724) DNA primase large
           subunit (DNA polymerase alpha 58 kDa subunit), involved
           in synthesis of RNA primers for Okazaki fragments [1587
           bp, 528 aa]
          Length = 528

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/509 (71%), Positives = 427/509 (83%), Gaps = 19/509 (3%)

Query: 1   MFRQSKKRVSMRRNFAE---------DRGDASA---IIIGATTTEEEKKLYQRIYENKLS 48
           MFRQSK+R++ R+NF+          D G+ +A   II+ ++++EEEKKLY R+YE+KLS
Sbjct: 1   MFRQSKRRIASRKNFSSYDDIVKSELDVGNTNAANQIILSSSSSEEEKKLYARLYESKLS 60

Query: 49  FYDIPPQGEITLEEFEIWAIDRLKLLLEIESCLARNKTLKEIEGIIKPLFKKYNIFNNMD 108
           FYD+PPQGEITLE+FEIWAIDRLK+LLEIESCL+RNK++KEIE IIKP F+K   FN  +
Sbjct: 61  FYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFNT-E 119

Query: 109 TFEDRKKEYYSHFILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKFVKSLNLPS 168
           + EDRKK+YYSHFILRLCFC+SKELR+KFVR ET L ++RFNML+STDQ KFV+SL+LP 
Sbjct: 120 SLEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDLPL 179

Query: 169 LQFIDEEEKAELSTQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPFESVIELVGNR 228
           LQFI  EEKAELS QLYQT+S  LQF LNL +E QR+ YF+ EKFIKLPFE+VIELVGNR
Sbjct: 180 LQFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVGNR 239

Query: 229 QVFLKNGYAYLPQFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRLIPILNHLSSGYT 288
            VFLK+GYAYLPQFQQLNL++NEF++KL +ELIKTYQYLPRLNEDDRL+PILNHLSSGYT
Sbjct: 240 LVFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSGYT 299

Query: 289 IAD-SGSFDSQFGNNEDNEINAKSVWSEEISKHYPLSVKNLFYGLKENNHLRYHGRQQLT 347
           IAD +    +QF  N D+EINA+SVWSEEIS +YPL +KNL  GLK+N+HLRY+GRQQL+
Sbjct: 300 IADFNQQKANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQLS 359

Query: 348 LFLKGIGLSVDEALKFWHDAFTKNNKMTTEKFNKEYRYNIRHSYGLEGNRINYKPWDCRT 407
           LFLKGIGLS DEALKFW +AFT+N  MT EKFNKEYRY+ RH+YGLEGNRINYKPWDC T
Sbjct: 360 LFLKGIGLSADEALKFWSEAFTRNGNMTMEKFNKEYRYSFRHNYGLEGNRINYKPWDCHT 419

Query: 408 ILSKPRPNRGEYHGCPFRDWNHDRLTSELSKMGLTTQQITDVLDSCDKHEYTIACTKVFE 467
           ILSKPRP RG+YHGCPFRDW+H+RL++EL  M LT  QI  VLDSC K EYTIACTKVFE
Sbjct: 420 ILSKPRPGRGDYHGCPFRDWSHERLSAELRSMKLTQAQIISVLDSCQKGEYTIACTKVFE 479

Query: 468 MTHNVPE-----GESMHISHPNLYFERSR 491
           MTHN        GE  HI+HPNLYFERSR
Sbjct: 480 MTHNSASADLEIGEQTHIAHPNLYFERSR 508

>Scas_625.9
          Length = 524

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/514 (67%), Positives = 414/514 (80%), Gaps = 22/514 (4%)

Query: 1   MFRQSKKRVSMRRNFAEDRGDASA------------IIIGATTTEEEKKLYQRIYENKLS 48
           MFRQ+K+R+S RRNF      +               I+  +TTEEEK LY  IY++K+S
Sbjct: 1   MFRQNKRRISSRRNFDSSPFGSDNKNGNENNGGANQFILPGSTTEEEKTLYNNIYDSKIS 60

Query: 49  FYDIPPQGEITLEEFEIWAIDRLKLLLEIESCLARNKTLKEIEGIIKPLFKKYNIFNNMD 108
           FY+  PQGEITLE+FE+WAIDRLK+LLEIESCL+RNKTLKEIE +IKP F+K   FN  D
Sbjct: 61  FYEARPQGEITLEQFEVWAIDRLKILLEIESCLSRNKTLKEIETLIKPQFQKLLPFNT-D 119

Query: 109 TFEDRKKEYYSHFILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKFVKSLNLPS 168
           +F D+KK+YYSHFILRLCFC++KELR+KF+R ET+L ++RFNML+S DQ KFVKSLNL  
Sbjct: 120 SFLDKKKDYYSHFILRLCFCRTKELREKFIRAETLLFKIRFNMLTSFDQIKFVKSLNLSK 179

Query: 169 LQFIDEEEKAELSTQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPFESVIELVGNR 228
           LQFI +EEK ELS +LYQTI+  L + LNL DE QR+L+F+NEKFIKLPFE+VIELVGNR
Sbjct: 180 LQFITDEEKTELSDKLYQTITPALIYQLNLTDENQRKLFFQNEKFIKLPFENVIELVGNR 239

Query: 229 QVFLKNGYAYLPQFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRLIPILNHLSSGYT 288
           Q F++ G+ Y+PQFQQLNLI+ EFS KL E L+KTYQ+LPRLNEDDRL+PILNHLSSGYT
Sbjct: 240 QAFIRKGFIYIPQFQQLNLISTEFSNKLNEALMKTYQFLPRLNEDDRLLPILNHLSSGYT 299

Query: 289 IADSGSFDSQFG---NNEDNEINAKSVWSEEISKHYPLSVKNLFYGLKENNHLRYHGRQQ 345
           IAD    +S+FG   N  D+EINA++V+SEEIS +YPL +KNLF GLKE+ HL+YHGRQQ
Sbjct: 300 IADFNE-NSKFGMYQNGNDDEINAQTVYSEEISANYPLCIKNLFRGLKEHGHLKYHGRQQ 358

Query: 346 LTLFLKGIGLSVDEALKFWHDAFTKNNKMTTEKFNKEYRYNIRHSYGLEGNRINYKPWDC 405
           L+LFLKGIGLS DE+LKFW +AFTKN +MT +KFNKEYRYN RH+YGLEGNRINYKPWDC
Sbjct: 359 LSLFLKGIGLSADESLKFWSEAFTKNGRMTVDKFNKEYRYNFRHNYGLEGNRINYKPWDC 418

Query: 406 RTILSKPRPNRGEYHGCPFRDWNHDRLTSELSKMGLTTQQITDVLDSCDKHEYTIACTKV 465
           RTILSKPRP RGEYHGCP+RDWN D+LT+EL  M LT  QI  +LDSC+K EYTIACTK 
Sbjct: 419 RTILSKPRPGRGEYHGCPYRDWNPDKLTAELRSMNLTPSQIASILDSCEKTEYTIACTKT 478

Query: 466 FEMTHNVPE-----GESMHISHPNLYFERSRQLE 494
           FE THN         +  HISHPNLYFERSRQL+
Sbjct: 479 FEFTHNTTGTDLEIDDQTHISHPNLYFERSRQLQ 512

>Kwal_26.8206
          Length = 506

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/500 (67%), Positives = 403/500 (80%), Gaps = 8/500 (1%)

Query: 1   MFRQSKKRVSMRRNFAEDRGDASA-IIIGATTTEEEKKLYQRIYENKLSFYDIPPQGEIT 59
           MFRQ+K+R++ RRNFA   GD+S   I+  TTTEEE KLY+ +YE+KLSFY +PP+GEIT
Sbjct: 1   MFRQAKRRITSRRNFAGQVGDSSGKFILDGTTTEEESKLYESLYESKLSFYQMPPKGEIT 60

Query: 60  LEEFEIWAIDRLKLLLEIESCLARNKTLKEIEGIIKPLFKKYNIFNNMDTFEDRKKEYYS 119
           LE+FE+WAI+RLK+LLEIESC+ RNK+ KE+E I+KPL  K  + +  D  +DRKK+YYS
Sbjct: 61  LEQFEVWAINRLKVLLEIESCIQRNKSPKEMEIIVKPLLNKL-LPSTSDDLQDRKKDYYS 119

Query: 120 HFILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKFVKSLNLPSLQFIDEEEKAE 179
           HFILRLCFC+SKELRDK +R ET LL+LRFNML+S DQAKFV++LNLP LQFI +EEK +
Sbjct: 120 HFILRLCFCRSKELRDKVIRSETALLKLRFNMLTSRDQAKFVQTLNLPFLQFITDEEKEQ 179

Query: 180 LSTQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPFESVIELVGNRQVFLKNGYAYL 239
           LSTQLYQTIS  LQF LNL DE QR+ YF  EKFIKLPFESVI+LVG+RQVF+K GYAYL
Sbjct: 180 LSTQLYQTISSALQFQLNLTDETQRRQYFNQEKFIKLPFESVIDLVGSRQVFIKKGYAYL 239

Query: 240 PQFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRLIPILNHLSSGYTIADSGSFDSQF 299
           PQFQQLN IANEFS  L   L KTYQ +PRLNEDDRL+PIL+HLSSGYTI++    D   
Sbjct: 240 PQFQQLNHIANEFSNMLSLALSKTYQSIPRLNEDDRLLPILHHLSSGYTISNFQQQDQFN 299

Query: 300 GNNEDNEINAKSVWSEEISKHYPLSVKNLFYGLKENNHLRYHGRQQLTLFLKGIGLSVDE 359
             ++  E+ A SV+S++I +++PL  KNL  GLKEN+HLRY GRQQL+ FLKGIG+ VDE
Sbjct: 300 QASQ-GEVTATSVYSDKIRENFPLCAKNLMNGLKENHHLRYQGRQQLSFFLKGIGMDVDE 358

Query: 360 ALKFWHDAFTKNNKMTTEKFNKEYRYNIRHSYGLEGNRINYKPWDCRTILSKPRPNRGEY 419
           AL+FW DAFT    MT +KF KEYRYN RH+YGLEGNRINYKPWDCRTILS+PRP+RGEY
Sbjct: 359 ALQFWSDAFTSGGHMTADKFTKEYRYNFRHNYGLEGNRINYKPWDCRTILSRPRPSRGEY 418

Query: 420 HGCPFRDWNHDRLTSELSK-MGLTTQQITDVLDSCDKHEYTIACTKVFEMTH----NVPE 474
           HGCP+RDWN DRL+ ELS+ M LT  Q+T VLDS  + EYTIACTKVFEMTH    NV  
Sbjct: 419 HGCPYRDWNADRLSMELSQGMSLTPAQVTSVLDSVQRTEYTIACTKVFEMTHGGAANVEV 478

Query: 475 GESMHISHPNLYFERSRQLE 494
            +  HI+HPNLY+ERSRQ +
Sbjct: 479 NDQTHIAHPNLYYERSRQFQ 498

>Sklu_2411.10 YKL045W, Contig c2411 18845-20359
          Length = 504

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/498 (66%), Positives = 414/498 (83%), Gaps = 6/498 (1%)

Query: 1   MFRQSKKRVSMRRNFAEDRGDASAIIIGATTTEEEKKLYQRIYENKLSFYDIPPQGEITL 60
           MFRQ+K+++S RRNF      +   I+ ATT+E E+KLY+++Y +K+SFYD+PPQGEITL
Sbjct: 1   MFRQTKRKISSRRNFDNSTDASGQFILQATTSEGEQKLYEKLYSSKISFYDLPPQGEITL 60

Query: 61  EEFEIWAIDRLKLLLEIESCLARNKTLKEIEGIIKPLFKKYNIFNNMDTFEDRKKEYYSH 120
           ++FE WAIDRLK+LLEIESC+ RNKT+KEIE I+KPL +K ++  N D+F+DRKK+YYSH
Sbjct: 61  DQFETWAIDRLKILLEIESCVQRNKTIKEIETIVKPLLQK-SLPYNTDSFQDRKKDYYSH 119

Query: 121 FILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKFVKSLNLPSLQFIDEEEKAEL 180
           FILRLCFC+SKELR+KF R ET+L ++RFNML+S DQ KFV+SLNLP LQFI +EEKA L
Sbjct: 120 FILRLCFCRSKELREKFTRSETLLFKIRFNMLTSQDQTKFVQSLNLPLLQFISDEEKANL 179

Query: 181 STQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPFESVIELVGNRQVFLKNGYAYLP 240
           S QLYQTI+  LQF L+L++EQQR+ +F+ EKFIKLPFESVIELVG+RQVF+  G+AYLP
Sbjct: 180 SQQLYQTIAPALQFQLSLSEEQQRRQFFQQEKFIKLPFESVIELVGSRQVFVSRGFAYLP 239

Query: 241 QFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRLIPILNHLSSGYTIADSGSFDSQFG 300
           QFQQLN IANEFSTKL  E++KTYQ+LPRLNEDDRL+PIL+HLSSGY I D     +++G
Sbjct: 240 QFQQLNHIANEFSTKLSTEMLKTYQHLPRLNEDDRLLPILHHLSSGYAIVDFQQQGNEYG 299

Query: 301 NNEDNEINAKSVWSEEISKHYPLSVKNLFYGLKENNHLRYHGRQQLTLFLKGIGLSVDEA 360
             ++ +I AK V+S+EI  ++PL  KNL  GL+ N+HLRY GRQQL+LFLKGIGL+VDEA
Sbjct: 300 -ADNGDITAKMVYSDEIVSNFPLCAKNLMRGLQTNHHLRYQGRQQLSLFLKGIGLNVDEA 358

Query: 361 LKFWHDAFTKNNKMTTEKFNKEYRYNIRHSYGLEGNRINYKPWDCRTILSKPRPNRGEYH 420
           LKFW DAF +N  M+ +KFNKEY+YN RH+YGLEGNRINYKPWDCRTILSKPRP RGE+H
Sbjct: 359 LKFWSDAFGRNGGMSIDKFNKEYKYNFRHNYGLEGNRINYKPWDCRTILSKPRPARGEFH 418

Query: 421 GCPFRDWNHDRLTSELSK-MGLTTQQITDVLDSCDKHEYTIACTKVFEMTHNVPE---GE 476
           GCP+RDWN ++L+SELS+ + LT  Q+T VLDSC ++E+T+ACTKVFE+TH        E
Sbjct: 419 GCPYRDWNVEKLSSELSQNLKLTPTQVTGVLDSCQRNEFTVACTKVFELTHGSSTTEINE 478

Query: 477 SMHISHPNLYFERSRQLE 494
             HI+HPNLY++RSRQL+
Sbjct: 479 QSHIAHPNLYYDRSRQLQ 496

>KLLA0F04818g 469283..470764 similar to sp|P20457 Saccharomyces
           cerevisiae YKL045w PRI2 DNA-directed DNA polymerase
           alpha, 58 KD subunit (DNA primase) singleton, start by
           similarity
          Length = 493

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/493 (58%), Positives = 375/493 (76%), Gaps = 10/493 (2%)

Query: 1   MFRQSKKRVSMRRNFAEDRGDASAIIIGATTTEEEKKLYQRIYENKLSFYDIPPQGEITL 60
           MFRQ+KKRV+ RRNF  D  D + I +     +++   Y  +Y  KL++Y +PP+GEITL
Sbjct: 1   MFRQTKKRVANRRNFVGD--DQNRIDVTGYGNQDDGMQYDILYPTKLTWYRLPPKGEITL 58

Query: 61  EEFEIWAIDRLKLLLEIESCLARNKTLKEIEGIIKPLFK-KYNIFNNMDTFEDRKKEYYS 119
           E+FE WAIDRLK+LLE+ES   RNK++KEIE  IKP+   K N+ N+    E RKK+YYS
Sbjct: 59  EQFETWAIDRLKVLLELESLWQRNKSMKEIETTIKPVLSSKLNLGNDN---ESRKKDYYS 115

Query: 120 HFILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKFVKSLNLPSLQFIDEEEKAE 179
           HFILRLCFC+SKELRDKFVR ET+L ++RF ML++ DQ  F+ SL+LP +  IDEEEK  
Sbjct: 116 HFILRLCFCRSKELRDKFVRAETLLFKIRFQMLTTQDQLNFISSLDLPYVNSIDEEEKQS 175

Query: 180 LSTQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPFESVIELVGNRQVFLKNGYAYL 239
           LST+LYQT+S  L F LNL +E QR+ +F  EK+ KLP E+V++LVG+RQ+F+K G+AY+
Sbjct: 176 LSTELYQTVSHLLTFQLNLTEETQRRQFFNREKYYKLPMENVMDLVGSRQIFIKKGWAYV 235

Query: 240 PQFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRLIPILNHLSSGYTIADSGSFDSQF 299
           PQFQQLNLI+NEFS  LQ EL+ TYQ +P+LNEDDR++PIL+HLSSGY + +S   +   
Sbjct: 236 PQFQQLNLISNEFSDCLQTELMGTYQMIPKLNEDDRILPILHHLSSGYVVTESQELN--- 292

Query: 300 GNNEDNEINAKSVWSEEISKHYPLSVKNLFYGLKENNHLRYHGRQQLTLFLKGIGLSVDE 359
           G   ++E   +SV ++++ +H+PL  K L   L+ N+HLRY GRQQL+ FLKGIGLSVDE
Sbjct: 293 GAGVNDEFTHRSVKTKKVMEHFPLCAKQLMEQLQTNHHLRYQGRQQLSFFLKGIGLSVDE 352

Query: 360 ALKFWHDAFTKNNKMTTEKFNKEYRYNIRHSYGLEGNRINYKPWDCRTILSKPRPNRGEY 419
           AL+FW ++FT   KMT ++FNKEY+YN RH+YGLEGNRINYKPWDCRTILSKPRP+RGEY
Sbjct: 353 ALQFWTESFTSGGKMTVDQFNKEYKYNFRHNYGLEGNRINYKPWDCRTILSKPRPSRGEY 412

Query: 420 HGCPFRDWNHDRLTSELSKMGLTTQQITDVLDSCDKHEYTIACTKVFEMTHNVPEGESMH 479
           HGCP+RD++ D+L + L +M LT QQ+  V++SC + +YTIACTKVFE  H     + + 
Sbjct: 413 HGCPYRDYHPDKLVATLKEMSLTQQQVNSVVESCQQQDYTIACTKVFEAVHKTTTAD-LQ 471

Query: 480 ISHPNLYFERSRQ 492
           I HPN YFERSRQ
Sbjct: 472 IVHPNQYFERSRQ 484

>ABR056C [647] [Homologous to ScYKL045W (PRI2) - SH]
           (498192..499661) [1470 bp, 489 aa]
          Length = 489

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/500 (52%), Positives = 340/500 (68%), Gaps = 22/500 (4%)

Query: 1   MFRQSKKRVSMRRNFAEDRGDASAIIIGATTTEEEKKLYQRIYENKLSFYDIPPQGEITL 60
           MFRQSK+RV+ RR+   D  D + I+ G  T EEE+  Y ++Y  KLSFY +PP GEITL
Sbjct: 1   MFRQSKRRVAQRRH--GDGADGATILAG-LTAEEEQARYDQLYPAKLSFYALPPVGEITL 57

Query: 61  EEFEIWAIDRLKLLLEIESCLARNKTLKEIEGIIKPLFKKYNIFNNMDTFEDRKKEYYSH 120
           ++FE WAIDRLK+LLE+ES + RN+  +E+E  +K       +    +  E R+K+YYSH
Sbjct: 58  DQFETWAIDRLKVLLELESLIQRNRAGRELEQAMK--PLLGKLLPLGEEQEARRKDYYSH 115

Query: 121 FILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKFVKSLNLPSLQFIDEEEKAEL 180
           FILRLCFC++ ELR++FVR ET L RLRF ML+S DQA+FV+SL+LP +QFIDE EK  L
Sbjct: 116 FILRLCFCRTAELRERFVRAETALFRLRFQMLTSADQARFVQSLDLPLVQFIDEAEKQAL 175

Query: 181 STQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPFESVIELVGNRQVFLKNGYAYLP 240
             QLY  ++  L   L L DE QR+ +F++E+F+KLPFESVI+LVG R V L+ G+AYLP
Sbjct: 176 GAQLYDAVAPQLLHQLQLTDEAQRRQFFQHERFLKLPFESVIDLVGPRHVLLRGGWAYLP 235

Query: 241 QFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRLIPILNHLSSGYTIADSGSFDSQFG 300
           QF QLN IA E++ +L  +L  TYQ+LP L  DDRL PIL HLS+G+ +A          
Sbjct: 236 QFMQLNHIAAEYAARLATDLRATYQHLPALAGDDRLPPILAHLSAGHVVAPPPPPTG--- 292

Query: 301 NNEDNEINAKSVWSEEISKHYPLSVKNLFYGLKENNHLRYHGRQQLTLFLKGIGLSVDEA 360
                 + A  + +E +    PL  + L  GL  N+HLRY GRQQL LFLKG G+S D+A
Sbjct: 293 ----GGLTAADLAAEPVRAALPLCARGLLDGLAANHHLRYLGRQQLALFLKGAGMSADDA 348

Query: 361 LKFWHDAFTKNNKMTTEKFNKEYRYNIRHSYGLEGNRINYKPWDCRTILSKPRPNRGEYH 420
           L+FW DAFT     + ++FN+EYRY +RH+YGLEGNRINY+PWDCRTIL+KPRP R E+H
Sbjct: 349 LRFWADAFTA-GPTSLDRFNREYRYALRHTYGLEGNRINYRPWDCRTILAKPRPARNEFH 407

Query: 421 GCPFRDWNHDRLTSELSKMGLTTQQITDVLDSCDKHEYTIACTKVFEMTH---------N 471
           GCP+RDW  DRL + L+ M L    +  V D+C + EYT+ACT VF+  H         +
Sbjct: 408 GCPYRDWAPDRLAAALAAMQLAPPAVAAVRDACARREYTLACTHVFDACHGHVAPSAPGH 467

Query: 472 VPEGESMHISHPNLYFERSR 491
           VP  +  HI HPN +FER+R
Sbjct: 468 VPAPDMSHIVHPNQFFERAR 487

>Scas_583.13
          Length = 384

 Score = 32.3 bits (72), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 440 GLTTQQITDVLDSCDKHEYTIACTKVFE-MTHNVPEGESMHISHPNLY 486
            ++T+ + D+   C+++   + C +V++ + H++PEG+S+ +S   LY
Sbjct: 167 AISTETLNDICQLCEENNIYLHCDEVYKPIFHSMPEGKSVPLSGCQLY 214

>KLLA0F27797g complement(2572415..2575720) similar to sp|P40541
           Saccharomyces cerevisiae YIL026c IRR1 essential protein
           singleton, start by similarity
          Length = 1101

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 53/109 (48%), Gaps = 5/109 (4%)

Query: 115 KEYYSHFILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKFVKSLNLPSLQFIDE 174
           ++++  F  R+     +++ D  VR+ ++ +    N L   D  + +   ++ SL F D 
Sbjct: 440 RQFFERFKDRMLEIAGRDI-DIQVRLTSVQVLSSINGLGYLDDHEII---DIISLIFFDH 495

Query: 175 EEKAELSTQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPFESVIE 223
           E K   S++  + ++   +F  N+  E+  +    NE+F K+P  SV E
Sbjct: 496 EVKVSSSSRDVKFLNEVTKFLANIVSEKTEEFLINNERF-KVPVISVTE 543

>YPL149W (ATG5) [5298] chr16 (271309..272193) Protein involved in
           autophagy and nutrient starvation [885 bp, 294 aa]
          Length = 294

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 5/55 (9%)

Query: 340 YHGRQQLTLFLKG-----IGLSVDEALKFWHDAFTKNNKMTTEKFNKEYRYNIRH 389
           +H  +Q+   L G     + LSV+EA KFW    T+N +   E  NK      RH
Sbjct: 145 FHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVITRNFQDFIEISNKISSSRPRH 199

>Scas_713.33
          Length = 4934

 Score = 29.3 bits (64), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 75/164 (45%), Gaps = 28/164 (17%)

Query: 237  AYLPQFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRLIPILNHLSSGYTIADSGSFD 296
              +  FQ+ N ++N+     Q+    T  +L RL    R+   LN + +GY ++    FD
Sbjct: 3015 GLMSSFQKWNNVSNDRHMMFQQ---NTSHFLNRLETGYRVYSDLNDIFAGYVLSMKFGFD 3071

Query: 297  -SQFGNNEDNE-INAKSVWSEEISKHYPLSVKNLFYGLKENNHLRYHGRQQLTLFLKG-- 352
              + G  E ++  +  S+W+ +     PL V N+      NN  +  G+  L+L LK   
Sbjct: 3072 LLRRGKIEHSKTFDISSLWAID-----PLEVTNM------NNLNKTFGK--LSLLLKKTT 3118

Query: 353  -IGLSVDEALKFWHDAFT--KNNKMTTEKFNKE-----YRYNIR 388
               LS +E L ++ + F     +K   + FNK      YR+++R
Sbjct: 3119 MTTLSTEEILIYFIELFKIHGKSKCMLDTFNKTLHILYYRWSLR 3162

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,460,390
Number of extensions: 825565
Number of successful extensions: 2761
Number of sequences better than 10.0: 37
Number of HSP's gapped: 2817
Number of HSP's successfully gapped: 37
Length of query: 494
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 388
Effective length of database: 12,926,601
Effective search space: 5015521188
Effective search space used: 5015521188
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)