Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L00891g34133615950.0
YIL041W32629910571e-145
Sklu_2174.33303179971e-135
Kwal_47.181483233179691e-131
Scas_704.453292999651e-131
ADL115W3333169101e-122
KLLA0E04433g3023067991e-106
Kwal_55.212273763581924e-16
CAGL0L08492g3852391916e-16
KLLA0E04543g3893761774e-14
Scas_676.184442581695e-13
AFR309C3643331685e-13
YPR148C435661511e-10
YMR247C156266682.1
CAGL0L00957g37373663.0
Scas_549.7137536663.0
Kwal_23.419867046654.2
ADL104W31525619.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L00891g
         (336 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L00891g 106804..107829 similar to sp|P40531 Saccharomyces c...   619   0.0  
YIL041W (YIL041W) [2626] chr9 (276524..277504) Cytoplasmic prote...   411   e-145
Sklu_2174.3 YIL041W, Contig c2174 2044-3036                           388   e-135
Kwal_47.18148                                                         377   e-131
Scas_704.45                                                           376   e-131
ADL115W [1626] [Homologous to ScYIL041W - SH] complement(483166....   355   e-122
KLLA0E04433g complement(406764..407672) similar to sp|P40531 Sac...   312   e-106
Kwal_55.21227                                                          79   4e-16
CAGL0L08492g 929051..930208 similar to tr|Q06523 Saccharomyces c...    78   6e-16
KLLA0E04543g 412009..413178 similar to sgd|S0006352 Saccharomyce...    73   4e-14
Scas_676.18                                                            70   5e-13
AFR309C [3501] [Homologous to ScYPR148C - SH] (1000084..1001178)...    69   5e-13
YPR148C (YPR148C) [5564] chr16 complement(826827..828134) Protei...    63   1e-10
YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protei...    31   2.1  
CAGL0L00957g 110615..111736 similar to sp|P39101 Saccharomyces c...    30   3.0  
Scas_549.7                                                             30   3.0  
Kwal_23.4198                                                           30   4.2  
ADL104W [1637] [Homologous to ScYIL036W (CST6) - SH; ScYER045C (...    28   9.4  

>CAGL0L00891g 106804..107829 similar to sp|P40531 Saccharomyces
           cerevisiae YIL041w, hypothetical start
          Length = 341

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/336 (92%), Positives = 311/336 (92%)

Query: 1   MSNFNSFANSLRENLQSFSNTVSQKTHELSTNIPTLAQSTQRMVQEKLGQVTDISQLPQE 60
           MSNFNSFANSLRENLQSFSNTVSQKTHELSTNIPTLAQSTQRMVQEKLGQVTDISQLPQE
Sbjct: 1   MSNFNSFANSLRENLQSFSNTVSQKTHELSTNIPTLAQSTQRMVQEKLGQVTDISQLPQE 60

Query: 61  YLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQELSKATSA 120
           YLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQELSKATSA
Sbjct: 61  YLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQELSKATSA 120

Query: 121 TEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPMDAKLSKVLLNYSDVQTKV 180
           TEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPMDAKLSKVLLNYSDVQTKV
Sbjct: 121 TEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPMDAKLSKVLLNYSDVQTKV 180

Query: 181 AQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVARTNLQNAKPEKEA 240
           AQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVARTNLQNAKPEKEA
Sbjct: 181 AQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVARTNLQNAKPEKEA 240

Query: 241 GLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAKLMKEFIX 300
           GLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAKLMKEFI 
Sbjct: 241 GLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAKLMKEFIS 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXDAGISLEDDDDE 336
                                   DAGISLEDDDDE
Sbjct: 301 SVDSSSSDAPASKTSKTSQTSTTTDAGISLEDDDDE 336

>YIL041W (YIL041W) [2626] chr9 (276524..277504) Cytoplasmic protein
           with possible role in cell-cycle regulation [981 bp, 326
           aa]
          Length = 326

 Score =  411 bits (1057), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 208/299 (69%), Positives = 248/299 (82%), Gaps = 8/299 (2%)

Query: 3   NFNSFANSLRENLQSFSNTVSQKTHELSTNIPTLAQSTQRMVQEKLGQVTDISQLPQEYL 62
           +FN+FA+SL + LQ  S +VS+KT EL    P+LAQSTQRMVQE+LGQVTDISQLP+EY 
Sbjct: 2   SFNAFASSLSKKLQEISTSVSEKTQEL----PSLAQSTQRMVQERLGQVTDISQLPREYT 57

Query: 63  ELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQELSKATSATE 122
           ELE+KVDTIK++Y HFL VTA+YEN SYDYPKY++ESVNEFS+++A+K+ EL+ ATSA+E
Sbjct: 58  ELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHATSASE 117

Query: 123 AQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPMDAK-LSKVLLNYSDVQTKVA 181
           AQNILVAPGP+KEPKTLNYA+SKVALN+SE LN  F  P + + L+  LL +SDVQ K+A
Sbjct: 118 AQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMF--PTEEQPLASALLQFSDVQAKIA 175

Query: 182 QARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVARTNL-QNAKPEKEA 240
           QAR+QQDT IQTKFNK +RE L+  I +A+K RKDV S RL+YDVARTNL  N KPEKEA
Sbjct: 176 QARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLANNKKPEKEA 235

Query: 241 GLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAKLMKEFI 299
            LRVQMETLEDQFAQ TEDATV +QEVI+ ANF   LKELA AQ EY+E SA LMKEF+
Sbjct: 236 SLRVQMETLEDQFAQVTEDATVCLQEVISHANFSEDLKELAKAQAEYFETSAGLMKEFL 294

>Sklu_2174.3 YIL041W, Contig c2174 2044-3036
          Length = 330

 Score =  388 bits (997), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 195/317 (61%), Positives = 247/317 (77%), Gaps = 22/317 (6%)

Query: 3   NFNSFANSLRENLQSFSNTVSQK--------------------THELSTNIPTLAQSTQR 42
           +FN+FA+SL +  Q  S +VSQK                    T +L+T++P+LAQSTQR
Sbjct: 2   SFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQR 61

Query: 43  MVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNE 102
           +VQE+LGQVTDISQLPQEYLELEN++D I++VYE+FL+VT VYE+ESYDYP  V +SVNE
Sbjct: 62  LVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNE 121

Query: 103 FSKNMAAKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPM 162
           FSK +++K+ ELS A+S  EAQNIL++PGP K+PKTLNYA+SKVAL +SEYL+ S  +  
Sbjct: 122 FSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKSGHE-- 179

Query: 163 DAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRL 222
           D  ++  LL YSDVQ K+AQARLQQDT IQTKFNK +RE LA  + +A KARK+V++KRL
Sbjct: 180 DETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRL 239

Query: 223 QYDVARTNLQNAKPEKEAGLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELAT 282
           QYD+AR NL NAKPEKEA LRVQME+LED+FAQATEDAT VMQ+VIAS+ FL  L EL +
Sbjct: 240 QYDIARANLANAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVS 299

Query: 283 AQLEYYEQSAKLMKEFI 299
           AQL YY+ S +L+ +F+
Sbjct: 300 AQLAYYKLSTELLSDFL 316

>Kwal_47.18148
          Length = 323

 Score =  377 bits (969), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 190/317 (59%), Positives = 240/317 (75%), Gaps = 21/317 (6%)

Query: 3   NFNSFANSLRENLQ--------------------SFSNTVSQKTHELSTNIPTLAQSTQR 42
           +FNSFA+S+    Q                      S  VSQKT + +T +P+LAQSTQR
Sbjct: 2   SFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQR 61

Query: 43  MVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNE 102
           ++QEKLGQVTDISQLPQ+Y+ELENK+D +K+VYE+FL+VT VYENESYDYP  V +SVNE
Sbjct: 62  LMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVNE 121

Query: 103 FSKNMAAKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPM 162
           FS  +  K+ ELS+ATS  EAQ++L++PGP K+PKTLNYA+SKVAL +SEYLN S     
Sbjct: 122 FSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKS-PGAE 180

Query: 163 DAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRL 222
           D+++S  LL YSDVQ K+AQARL QDT IQTKFNK +R  LA+ + RA KARK+V++KRL
Sbjct: 181 DSEVSSSLLKYSDVQAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRL 240

Query: 223 QYDVARTNLQNAKPEKEAGLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELAT 282
           QYD+AR NL NA+PEKEA LRVQME+LED+FAQAT+DA V+MQ+V  S+  L  L+EL  
Sbjct: 241 QYDIARANLANARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVA 300

Query: 283 AQLEYYEQSAKLMKEFI 299
           AQ EYY+QSA+L+ EF+
Sbjct: 301 AQAEYYKQSAELLSEFL 317

>Scas_704.45
          Length = 329

 Score =  376 bits (965), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 191/299 (63%), Positives = 236/299 (78%), Gaps = 1/299 (0%)

Query: 1   MSNFNSFANSLRENLQSFSNTVSQKTHELSTNIPTLAQSTQRMVQEKLGQVTDISQLPQE 60
           MS+FNSF NS  + L   S+TVSQKT ELSTN+P LAQSTQRMVQE+LGQVTDISQLP+E
Sbjct: 1   MSSFNSFTNSFSKTLSELSSTVSQKTQELSTNLPNLAQSTQRMVQERLGQVTDISQLPEE 60

Query: 61  YLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQELSKATSA 120
           YLELE K+D+IK +Y++FL V++VYE +SYDYP    ES+ EFSK  A+KV+ELS A+SA
Sbjct: 61  YLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSA 120

Query: 121 TEAQNILVAPGP-VKEPKTLNYAMSKVALNASEYLNHSFDDPMDAKLSKVLLNYSDVQTK 179
            EAQNIL      +KEPKTLN+A+SKVAL +SE+LN   D+      +  LLN+S++Q K
Sbjct: 121 HEAQNILTTSSTQIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASALLNFSNIQAK 180

Query: 180 VAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVARTNLQNAKPEKE 239
           +AQARLQQD  I+ KFN  +R +LA +IA+A K RK+VQSKRLQYD+ARTNL NAKPEKE
Sbjct: 181 IAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLMNAKPEKE 240

Query: 240 AGLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAKLMKEF 298
           A LRVQMETLED FAQATE AT+VMQ+VI +++ +  + ELA AQL Y+E S+ LMKEF
Sbjct: 241 ASLRVQMETLEDDFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYFELSSSLMKEF 299

>ADL115W [1626] [Homologous to ScYIL041W - SH]
           complement(483166..484167) [1002 bp, 333 aa]
          Length = 333

 Score =  355 bits (910), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 173/316 (54%), Positives = 233/316 (73%), Gaps = 22/316 (6%)

Query: 3   NFNSFANSLRENLQSFSNTV--------------------SQKTHELSTNIPTLAQSTQR 42
           +FN+FA+S  +  Q  S+TV                    SQ+T +L++N+P+LAQ+TQR
Sbjct: 2   SFNAFADSFSKRFQEISSTVQQKAQEAQLDKKLKDLSLSVSQRTQDLTSNLPSLAQTTQR 61

Query: 43  MVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNE 102
            VQE+LGQVTDISQ+P+EY+ELE +VD  K++Y++FL+V+ +YE+ESYDYP+++S+SVN+
Sbjct: 62  RVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVND 121

Query: 103 FSKNMAAKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPM 162
           FSK +  KVQEL+KAT+  EAQ+IL++PGP + PKTLNYA+SKVAL +SEYL+ S  D  
Sbjct: 122 FSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKSGSD-- 179

Query: 163 DAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRL 222
           D   + +LL YSDVQ K+AQARLQQDT IQT+FN+ +RE L    A A ++RK V  KRL
Sbjct: 180 DVVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRL 239

Query: 223 QYDVARTNLQNAKPEKEAGLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELAT 282
           QYD+AR N   A+PEK+A LRVQMETLEDQFAQ+TEDA  +MQ VI    FL   +EL T
Sbjct: 240 QYDIARANFTAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVT 299

Query: 283 AQLEYYEQSAKLMKEF 298
           AQL +++ +A+L+  F
Sbjct: 300 AQLGFHKAAAELLSGF 315

>KLLA0E04433g complement(406764..407672) similar to sp|P40531
           Saccharomyces cerevisiae YIL041w singleton, start by
           similarity
          Length = 302

 Score =  312 bits (799), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 164/306 (53%), Positives = 222/306 (72%), Gaps = 21/306 (6%)

Query: 4   FNSFANSLRENLQSFSNTVSQKTHE---------LSTNIPTLAQSTQRMVQEKLGQVTDI 54
           F+SF+  ++E     S +VSQK  E         L TN+P LA STQRM+QEKLGQVTDI
Sbjct: 5   FDSFSKKVQE----LSTSVSQKAQEAQLDQKFKDLKTNLPLLANSTQRMLQEKLGQVTDI 60

Query: 55  SQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQEL 114
           SQLP EY++LE++V+TIK++YE+FL+VT +YENESYDYP  V ESV+EFSK +  K+ +L
Sbjct: 61  SQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSKLVGGKLHDL 120

Query: 115 SKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPMDAKLSKVLLNYS 174
           SK T+  +AQN+L++   +KEPKTLNYA+SKVAL +SE++        D  L+  L  YS
Sbjct: 121 SKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTSSEHVE-------DESLANFLAKYS 173

Query: 175 DVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVARTN-LQN 233
           D QTK+AQ RLQQDT IQTKFNK I+E L + I  + KARK V+ KRLQYDV R+N L+N
Sbjct: 174 DSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQYDVVRSNRLKN 233

Query: 234 AKPEKEAGLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAK 293
            KPEK+A L+V+  T E++FA+AT+DA + M +V+  A+F  +L EL  AQL Y++ SA+
Sbjct: 234 TKPEKQAALQVEESTHEEEFAKATDDAIIAMSKVVELADFSANLHELVAAQLAYHKSSAE 293

Query: 294 LMKEFI 299
           +++E +
Sbjct: 294 ILEELV 299

>Kwal_55.21227
          Length = 376

 Score = 78.6 bits (192), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 85/358 (23%), Positives = 145/358 (40%), Gaps = 71/358 (19%)

Query: 2   SNFNSFA-NSLRENLQSFSNTVSQKTHELSTNIPTL----------AQSTQRMVQEKLGQ 50
           S F  F+ N L + L   +N   +    LST I  +           ++ +  +QE LG 
Sbjct: 3   SYFGGFSFNKLTDTL---TNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGT 59

Query: 51  VTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAK 110
           + DIS+LP +Y  LE K D+++      L VT  +E E YDYP  +SES++++  +    
Sbjct: 60  IEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEG 119

Query: 111 VQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPMDAK----- 165
           +  L  ++   +      A      P++   A++K A ++ + L    D    A      
Sbjct: 120 LFGLMSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQQASADEED 179

Query: 166 -------LSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQ 218
                  L K+   +S+ Q K+ Q + + D  +  +FN+ +   + E    A+  R+ V+
Sbjct: 180 EDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVE 239

Query: 219 SKRLQYDVARTN-----------LQNAKPE-KEAGLRVQ--------------------- 245
             RL++D  R             ++N K + KE+ L  +                     
Sbjct: 240 DSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTK 299

Query: 246 ------------METLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQS 291
                       +E LED+F   T +A   M E+  SA  L  +K     QL Y+ Q 
Sbjct: 300 EEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQC 357

>CAGL0L08492g 929051..930208 similar to tr|Q06523 Saccharomyces
           cerevisiae YPR148c, start by similarity
          Length = 385

 Score = 78.2 bits (191), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 114/239 (47%), Gaps = 27/239 (11%)

Query: 14  NLQSFSNTVSQKTHEL--STNIPTLAQSTQ---RMVQEKLGQVTDISQLPQEYLELENKV 68
           NL+S + ++S+ T  L    N P    S +   R +QE +G   DIS+LP +Y+ LE K 
Sbjct: 5   NLESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKC 64

Query: 69  DTIKIVYEHFLQVTAVYENESYDYPKYVSES------------VNEFSKNMAAKVQELSK 116
           D+I+ V +  L VT  YE E YDYP  +SES            ++E +KN+  K   + K
Sbjct: 65  DSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEK 124

Query: 117 ATSATEAQNILVAPGPVKE-PKTLNYAMSKVALNASEYLNHSFD------DPMDAKLSKV 169
           A   TEA   L       E P +   A+++   + S+ +  S +           +L K+
Sbjct: 125 A--GTEASKTLTDKEVSHEGPPSFASAIARAGKD-SQLIFESIETKDEDEKEDIDELVKI 181

Query: 170 LLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVAR 228
              +SD   +++ ++ + D  +  +FN  + + L ++  + +  R  V+  RL +D  R
Sbjct: 182 FKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMR 240

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%)

Query: 246 METLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAK 293
           +E LED+F   T +A  VM EV  ++  L  +K   T QL Y++   K
Sbjct: 324 LEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVK 371

>KLLA0E04543g 412009..413178 similar to sgd|S0006352 Saccharomyces
           cerevisiae YPR148c, start by similarity
          Length = 389

 Score = 72.8 bits (177), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 89/376 (23%), Positives = 152/376 (40%), Gaps = 94/376 (25%)

Query: 5   NSFANSLRENLQSFSNTVSQKTH--ELSTNIPTLAQSTQRMVQEKLGQVTDISQLPQEYL 62
           +S +N+ +   + FS+ + +K H  +  T +  L +  Q  +QE LG V DISQLP +Y 
Sbjct: 12  DSISNAAQRTQEQFSSAI-EKIHLDDPETRLSILKRRHQ--LQETLGTVHDISQLPIQYK 68

Query: 63  ELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKN-------MAAKVQELS 115
            LE K D ++ + +  L VT  +E E YDYP  ++ES N++           + K  E+S
Sbjct: 69  FLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFSKKKAEVS 128

Query: 116 KATSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNH-----------SFDDPMDA 164
                T A+N L+       P++   A+SK A +++  L                +  D 
Sbjct: 129 PEVKET-AENGLL-------PRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQ 180

Query: 165 K---------------------------LSKVLLNYSDVQTKVAQARLQQDTQIQTKFNK 197
           K                           L K   +++  Q  + Q++ + D+ +  +FN 
Sbjct: 181 KPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNA 240

Query: 198 VIRENLAESIARANKARKDVQSKRLQYDVARTNLQNAKPEK-------EAGLRVQMET-- 248
            + + +     + ++ R  VQ  RL +D  R  ++    EK       EA  +V  ET  
Sbjct: 241 KLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQEKEVVASSEEAEKKVATETPE 300

Query: 249 ---------------------------LEDQFAQATEDATVVMQEVIASANFLPSLKELA 281
                                      LEDQF  AT +    + E+  S+  +  +K   
Sbjct: 301 TPEKKTNEEPVDMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFH 360

Query: 282 TAQLEYYEQSAKLMKE 297
             QL +Y+Q  K ++E
Sbjct: 361 NFQLIHYKQCVKSLEE 376

>Scas_676.18
          Length = 444

 Score = 69.7 bits (169), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 110/258 (42%), Gaps = 39/258 (15%)

Query: 1   MSNF--NSFANSLRENLQSFSNTVSQKTHELSTNIPTLA-QSTQRMVQEKLGQVTDISQL 57
            SNF  +   NSL    Q  S+T+S      +     L+ +S +R+ QE +G V DIS L
Sbjct: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTL 61

Query: 58  PQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQELSKA 117
           P++Y  LE + D ++      L V+  +E E YDYP  +SES +++           S +
Sbjct: 62  PEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDW----------WSLS 111

Query: 118 TSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPMDAK------------ 165
           +   + Q      G +  P++   A+S  A +  E   H  +D  D              
Sbjct: 112 SKKKKEQEKEDKKGFL--PRSFAQAISNSAEDCVEIYQH-VNDGDDEDKEENANNEEENE 168

Query: 166 -----------LSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKAR 214
                      L K   +++     + Q + + D+ +  +FN  + + L E   + +  R
Sbjct: 169 EEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHTLR 228

Query: 215 KDVQSKRLQYDVARTNLQ 232
           K V+  RL++D  R  L+
Sbjct: 229 KRVKDSRLKFDTVRYELK 246

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%)

Query: 246 METLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQS 291
           +E LED F  +T  A  +M+E+  S+  +  +K     QL YY Q 
Sbjct: 383 LEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQC 428

>AFR309C [3501] [Homologous to ScYPR148C - SH] (1000084..1001178)
           [1095 bp, 364 aa]
          Length = 364

 Score = 69.3 bits (168), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 73/333 (21%), Positives = 134/333 (40%), Gaps = 47/333 (14%)

Query: 5   NSFANSLRENLQSFSNTVSQKTHELST-------NIPTLAQSTQRMVQEKLGQVTDISQL 57
           N+  N+ ++  Q  S T    TH +          I +L ++ +R +QE LG   DISQL
Sbjct: 15  NTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSL-KTRKRQLQETLGSAKDISQL 73

Query: 58  PQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQELSKA 117
           P +Y  LE K D I+ V +  L V+  +E E YDYP   +ES++++      + + L   
Sbjct: 74  PPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKETRFLKFG 133

Query: 118 TSATEAQ--NILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPMDAK---------- 165
              T+ Q  +         +P +  +A+ + A  +   +    +   + +          
Sbjct: 134 KGGTDKQKEDKQKQAAGSSDPPSFAHALHRAAKGSQGIIQELKEQAEEEQEQEVEIDEDV 193

Query: 166 --LSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQ 223
             L K+   ++D Q  +  A+ + D  +  +FN+ ++  L     + +  R+ V+  RL 
Sbjct: 194 ESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLT 253

Query: 224 YDVARTNLQN-----AKPEKEA--------------------GLRVQMETLEDQFAQATE 258
           +D  +          AK + EA                        Q+E  ED+F   T 
Sbjct: 254 FDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQLEDAEDEFVSNTA 313

Query: 259 DATVVMQEVIASANFLPSLKELATAQLEYYEQS 291
           +A   M  +  +   +  +K     QL Y+ + 
Sbjct: 314 EAVEFMTSIADATKLISLVKLFQNFQLVYHRKC 346

>YPR148C (YPR148C) [5564] chr16 complement(826827..828134) Protein
           of unknown function [1308 bp, 435 aa]
          Length = 435

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 45/66 (68%)

Query: 38  QSTQRMVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVS 97
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ V +  L V+  +E E YDYP  ++
Sbjct: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108

Query: 98  ESVNEF 103
           ES++++
Sbjct: 109 ESISDW 114

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 38/75 (50%)

Query: 166 LSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYD 225
           L KV  ++S     + + + + D+ +  +FNK +   + +   + +  RK V+  RL++D
Sbjct: 214 LIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFD 273

Query: 226 VARTNLQNAKPEKEA 240
             R  ++  + E EA
Sbjct: 274 TMRYEVKAKEAELEA 288

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 205 ESIARANKARKDVQSKRLQYDVARTNLQNAKPEKEAGLRVQMETLEDQFAQATEDATVVM 264
           ES   AN+   D  + R + D+    + +  P +E+     +E LED+F   T  A   M
Sbjct: 334 ESKKEANEPTVDDVADRKE-DLKSNKVNDEPPIEESEDNKLLEKLEDEFVSNTTAAVETM 392

Query: 265 QEVIASANFLPSLKELATAQLEYYEQS 291
           +E+  S+  L  +K     QL Y+ Q 
Sbjct: 393 EEITDSSEILGLIKLFQNFQLVYFRQC 419

>YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protein of
            unknown function, has weak similarity to uncharacterized
            C. albicans Orf6.3079p [4689 bp, 1562 aa]
          Length = 1562

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 37   AQSTQRMVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYV 96
              S  ++ Q+ L +VTD  ++P+EYLE ENK   IK ++   L +   +++ SY+  +  
Sbjct: 1234 VNSKFKLPQKLLQKVTD--EVPKEYLEYENKNSFIKYLWYWHL-ILMYFKDTSYNMRQIF 1290

Query: 97   SESVNE 102
             E + E
Sbjct: 1291 IEQLKE 1296

>CAGL0L00957g 110615..111736 similar to sp|P39101 Saccharomyces
           cerevisiae YER048c CAJ1, start by similarity
          Length = 373

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 3/73 (4%)

Query: 100 VNEFSKNMAAKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFD 159
           ++EF K +  +++EL   +   E  +IL     V   K  NY +SK  L  S +L    D
Sbjct: 187 LDEFQKKLTQEIEELKLESFGLELLHILAK---VYRNKANNYLLSKKTLGVSRFLTGFRD 243

Query: 160 DPMDAKLSKVLLN 172
              D K +  L++
Sbjct: 244 GAKDVKSTYSLIH 256

>Scas_549.7
          Length = 1375

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 99  SVNEFSKNMAAKVQELSKATSATEAQNILVAPGPVK 134
           +V+ FS+N     Q+L   TS+ E +NI+    P+K
Sbjct: 421 TVSRFSENCVWCPQQLDNGTSSLEIKNIIKTEAPIK 456

>Kwal_23.4198
          Length = 670

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 168 KVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKA 213
           KV +   D+Q  + +ARL   T    KF +++R+NL + + R N  
Sbjct: 6   KVYMKLVDLQ-HIREARLMSLTINTRKFKRIVRDNLLKVLGRINDG 50

>ADL104W [1637] [Homologous to ScYIL036W (CST6) - SH; ScYER045C
           (ACA1) - SH] complement(501149..502096) [948 bp, 315 aa]
          Length = 315

 Score = 28.1 bits (61), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%)

Query: 179 KVAQARLQQDTQIQTKFNKVIRENL 203
           K+AQ +LQ+D  I TK NK IR  L
Sbjct: 231 KIAQLQLQKDVDILTKENKEIRREL 255

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.123    0.316 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,083,049
Number of extensions: 340547
Number of successful extensions: 1762
Number of sequences better than 10.0: 122
Number of HSP's gapped: 1729
Number of HSP's successfully gapped: 143
Length of query: 336
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 234
Effective length of database: 13,065,073
Effective search space: 3057227082
Effective search space used: 3057227082
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)