Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L00869g41941321980.0
Sklu_2174.241339313021e-179
Kwal_47.1815141440912831e-176
ADL116C43537212171e-166
YIL042C39437410681e-144
KLLA0E04455g42137210411e-139
Scas_704.444434549741e-129
AER270W4892782196e-19
KLLA0C05654g4734232053e-17
KLLA0F27423g5122982001e-16
Sklu_2299.65304471931e-15
Kwal_14.18254924251868e-15
CAGL0F07007g4852861851e-14
AAR157C5033631841e-14
Scas_563.94922911707e-13
YGL059W4912701484e-10
Scas_698.14118381840.031
KLLA0A00638g115581770.21
YIL147C (SLN1)122087730.58
AAR071W223191720.89
YMR246W (FAA4)69481720.90
CAGL0H06567g116979720.91
AFR284W110379720.96
Kwal_55.1985039067711.0
Kwal_23.61572230124682.4
CAGL0H09218g27962662.9
KLLA0C16203g145473664.2
Scas_581.1421447645.1
Kwal_56.236871576101656.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L00869g
         (413 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L00869g complement(105236..106495) similar to sp|P40530 Sac...   851   0.0  
Sklu_2174.2 YIL042C, Contig c2174 576-1817 reverse complement         506   e-179
Kwal_47.18151                                                         498   e-176
ADL116C [1625] [Homologous to ScYIL042C - SH] (481045..482352) [...   473   e-166
YIL042C (YIL042C) [2625] chr9 complement(275107..276291) Protein...   416   e-144
KLLA0E04455g 408415..409680 similar to sp|P40530 Saccharomyces c...   405   e-139
Scas_704.44                                                           379   e-129
AER270W [2772] [Homologous to NOHBY] complement(1131292..1132761...    89   6e-19
KLLA0C05654g complement(504568..505989) similar to sp|P53170 Sac...    84   3e-17
KLLA0F27423g complement(2537353..2538891) similar to ca|CA5524|I...    82   1e-16
Sklu_2299.6 YGL059W, Contig c2299 10909-12501 reverse complement       79   1e-15
Kwal_14.1825                                                           76   8e-15
CAGL0F07007g 687174..688631 highly similar to sp|P53170 Saccharo...    76   1e-14
AAR157C [345] [Homologous to ScYGL059W - SH] (627130..628641) [1...    75   1e-14
Scas_563.9                                                             70   7e-13
YGL059W (YGL059W) [1920] chr7 (392226..393701) Protein with simi...    62   4e-10
Scas_698.14                                                            37   0.031
KLLA0A00638g complement(60378..63845) gi|5531277|emb|CAB50891.1 ...    34   0.21 
YIL147C (SLN1) [2530] chr9 complement(69791..73453) Two-componen...    33   0.58 
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...    32   0.89 
YMR246W (FAA4) [4202] chr13 (759806..761890) Acyl-CoA synthase (...    32   0.90 
CAGL0H06567g 645707..649216 similar to sp|P39928 Saccharomyces c...    32   0.91 
AFR284W [3476] [Homologous to ScYIL147C (SLN1) - SH] complement(...    32   0.96 
Kwal_55.19850                                                          32   1.0  
Kwal_23.6157                                                           31   2.4  
CAGL0H09218g complement(904209..905048) similar to sp|P53078 Sac...    30   2.9  
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    30   4.2  
Scas_581.14                                                            29   5.1  
Kwal_56.23687                                                          30   6.4  

>CAGL0L00869g complement(105236..106495) similar to sp|P40530
           Saccharomyces cerevisiae YIL042c, hypothetical start
          Length = 419

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/413 (100%), Positives = 413/413 (100%)

Query: 1   MFLRSALRLGGHRRVIGRQFHAASVLLKNSKYGSVANYQDRLKHLEFDKHYKIRSNIELL 60
           MFLRSALRLGGHRRVIGRQFHAASVLLKNSKYGSVANYQDRLKHLEFDKHYKIRSNIELL
Sbjct: 1   MFLRSALRLGGHRRVIGRQFHAASVLLKNSKYGSVANYQDRLKHLEFDKHYKIRSNIELL 60

Query: 61  IQEYASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLLSYTCRRLNAIQKLPYVAAV 120
           IQEYASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLLSYTCRRLNAIQKLPYVAAV
Sbjct: 61  IQEYASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLLSYTCRRLNAIQKLPYVAAV 120

Query: 121 NPSIEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFLDDHQDTVETLSRGLEEIMD 180
           NPSIEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFLDDHQDTVETLSRGLEEIMD
Sbjct: 121 NPSIEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFLDDHQDTVETLSRGLEEIMD 180

Query: 181 FLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNRDSDPNMIGTIHKALPVADMVKKVS 240
           FLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNRDSDPNMIGTIHKALPVADMVKKVS
Sbjct: 181 FLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNRDSDPNMIGTIHKALPVADMVKKVS 240

Query: 241 EFVSDLCFVKYDQLVAPVKIYGGHDVTFPCIPTILEYVLTEILKNSYRAHIENTTSHNCL 300
           EFVSDLCFVKYDQLVAPVKIYGGHDVTFPCIPTILEYVLTEILKNSYRAHIENTTSHNCL
Sbjct: 241 EFVSDLCFVKYDQLVAPVKIYGGHDVTFPCIPTILEYVLTEILKNSYRAHIENTTSHNCL 300

Query: 301 VEKPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVI 360
           VEKPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVI
Sbjct: 301 VEKPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVI 360

Query: 361 PGEDINIVSGMGFGLPMCKAYIEMFDGKLDIQSLWGWGTDVYIKLKGPTKKML 413
           PGEDINIVSGMGFGLPMCKAYIEMFDGKLDIQSLWGWGTDVYIKLKGPTKKML
Sbjct: 361 PGEDINIVSGMGFGLPMCKAYIEMFDGKLDIQSLWGWGTDVYIKLKGPTKKML 413

>Sklu_2174.2 YIL042C, Contig c2174 576-1817 reverse complement
          Length = 413

 Score =  506 bits (1302), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 247/393 (62%), Positives = 317/393 (80%), Gaps = 7/393 (1%)

Query: 22  AASVLLKNSKYGSVANYQDRLKHLEFDKHYKIRSNIELLIQEYASKPIPPLTYDYLTHYK 81
            AS+ +K+S + +  N +  L  L F++ Y+IRS+IELLIQ+YA+KPIP ++Y+YL+ YK
Sbjct: 26  TASLTIKHSSHHNRRN-ERLLSGLGFEQLYQIRSSIELLIQDYANKPIPAISYEYLSMYK 84

Query: 82  PPLSANEEYMLTIKTINLLLSYTCRRLNAIQKLP-YVAAVNPSIEKSYSLYLKTLESLLS 140
           PPL+ NE+Y+L IKT+NLLL+YTCRRL AIQKL  Y+A VNP++E+S  LYLKTLESLLS
Sbjct: 85  PPLTDNEKYVLVIKTVNLLLAYTCRRLAAIQKLSXYIAVVNPNVEESNRLYLKTLESLLS 144

Query: 141 IEFPYALHDKDIIHGLLIEFLDDHQDTVETLSRGLEEIMDFLEKDTIFKFLDEHLRDRIA 200
           I+FPY LHD++ +   L +FLDDHQDT+ TLSRG EE+M+F +++ +F+FL++HLRDRI+
Sbjct: 145 IDFPYGLHDQEAMVTKLTKFLDDHQDTLITLSRGFEEVMEFYQQEAVFEFLNQHLRDRIS 204

Query: 201 MKILATNHLAVSNHNRDSDPNMIGTIHKALPVADMVKKVSEFVSDLCFVKYDQLVAPVKI 260
           MK+L T++LA+      + P  IG +HK L +++++ +V EFV DLCFVKYD+ V PVKI
Sbjct: 205 MKLLVTHYLALVQQQDKNSP-AIGVLHKNLKISELIHRVEEFVGDLCFVKYDRQV-PVKI 262

Query: 261 YGGHDVTFPCIPTILEYVLTEILKNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELE 320
             G DVTFPCIPT LEYVLTEILKNS RAHIEN+T    L EKP+EV IV+    D +LE
Sbjct: 263 LYGADVTFPCIPTDLEYVLTEILKNSSRAHIENSTKERDLTEKPIEVTIVRS---DCDLE 319

Query: 321 IRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMCKA 380
           IRIRDFGGGIPP VE  +FEYSY+TV+++ K++G SAYVIPGE++N VSGMGFGLPMCKA
Sbjct: 320 IRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMCKA 379

Query: 381 YIEMFDGKLDIQSLWGWGTDVYIKLKGPTKKML 413
           Y+EMFDG LDIQSL+GWGTDVYIKLKGP  K+L
Sbjct: 380 YLEMFDGSLDIQSLYGWGTDVYIKLKGPENKLL 412

>Kwal_47.18151
          Length = 414

 Score =  498 bits (1283), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 244/409 (59%), Positives = 317/409 (77%), Gaps = 8/409 (1%)

Query: 5   SALRLGGHRRVIGRQFHAASVLLKN-SKYGSVANYQDRLKHLEFDKHYKIRSNIELLIQE 63
           +A+R     R   + FH     L+   K    ++ ++ L+ + F++ Y+IRSN ELLIQ+
Sbjct: 9   TAVRGFSRLRYTRKAFHNGLHTLRPLQKVHGKSSLREMLREVGFEELYRIRSNTELLIQD 68

Query: 64  YASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLLSYTCRRLNAIQKLPYVAAVNPS 123
           +A KPIP ++Y++LT YK PL+ NE+YMLTI+T+NLLL+YTCRRL AIQKLPY+A +NP+
Sbjct: 69  FAKKPIPAISYEFLTQYKVPLTDNEKYMLTIQTVNLLLTYTCRRLVAIQKLPYIAVLNPN 128

Query: 124 IEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFLDDHQDTVETLSRGLEEIMDFLE 183
           IE++  LYL+TLESLLS+ +PY LHD++++   L EFLDDHQDT+ TLSRG +EIM+F  
Sbjct: 129 IEETNRLYLRTLESLLSLNYPYGLHDQEVMAKKLTEFLDDHQDTLLTLSRGFQEIMEFFP 188

Query: 184 KDTIFKFLDEHLRDRIAMKILATNHLA-VSNHNRDSDPNMIGTIHKALPVADMVKKVSEF 242
           K+++F+FL+ HLRDRI+MK+LAT++LA VS  +RD    +IG +H+ + ++++V +V EF
Sbjct: 189 KESVFEFLNSHLRDRISMKLLATHYLAIVSQTSRDD--RVIGVLHREMKISELVCRVEEF 246

Query: 243 VSDLCFVKYDQLVAPVKIYGGHDVTFPCIPTILEYVLTEILKNSYRAHIENTTSHNCLVE 302
           V DLC+VKYDQ V P+KI  G DVTFPCIPT LEYVLTE+LKNS RAHIE +TS N   E
Sbjct: 247 VGDLCYVKYDQQV-PIKILEGEDVTFPCIPTDLEYVLTELLKNSSRAHIEGSTSDNNTAE 305

Query: 303 KPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVIPG 362
           KPVEV IV+    D +L+IRIRDFGGGIPP VE  +F+YSY+TV +D K+SG SAYVIPG
Sbjct: 306 KPVEVTIVRK---DNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPG 362

Query: 363 EDINIVSGMGFGLPMCKAYIEMFDGKLDIQSLWGWGTDVYIKLKGPTKK 411
            D+  VSGMGFGLPMCKAY+EMF+G LDIQSLWGWGTD YI LKGP  K
Sbjct: 363 ADVCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYLKGPDPK 411

>ADL116C [1625] [Homologous to ScYIL042C - SH] (481045..482352)
           [1308 bp, 435 aa]
          Length = 435

 Score =  473 bits (1217), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 226/372 (60%), Positives = 289/372 (77%), Gaps = 6/372 (1%)

Query: 42  LKHLEFDKHYKIRSNIELLIQEYASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLL 101
           L  L F++ Y++RSN+E+LIQ+YA + IP +TY++LT Y PPLS NE +ML+IK +N+LL
Sbjct: 66  LSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKVLNMLL 125

Query: 102 SYTCRRLNAIQKLPYVAAVNPSIEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFL 161
           +YTCRRL A+Q+LPY+A +NP+IE+S  LYLKTLESLL+IE PY LHD   +   LI FL
Sbjct: 126 TYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREKLITFL 185

Query: 162 DDHQDTVETLSRGLEEIMDFLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNRDSDPN 221
           DDH DT+ TLS+G EEIMDF  +  +F FL+ HLRDR++MK+L T++L +   +  +D  
Sbjct: 186 DDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQSSGAD-- 243

Query: 222 MIGTIHKALPVADMVKKVSEFVSDLCFVKYDQLVAPVKIYGGHDVTFPCIPTILEYVLTE 281
            IG + K L +A++VK+  EFV DL FVKYD++V PV I  GHDVTF CIP  LEYVL E
Sbjct: 244 CIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIV-PVNILEGHDVTFACIPQDLEYVLQE 302

Query: 282 ILKNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEY 341
           ILKNS RAHIEN T  N   EKP+EV IV+     E+LEIRIRDFGGGIPP+VE  +F+Y
Sbjct: 303 ILKNSARAHIENHTPSNYSAEKPIEVTIVRSY---EDLEIRIRDFGGGIPPDVEDRMFDY 359

Query: 342 SYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMCKAYIEMFDGKLDIQSLWGWGTDV 401
           SYTT E D K++G SAY+IPG+D++ VSGMGFGLP+CKAY+EMF+G+LDI SLWGWGTDV
Sbjct: 360 SYTTSEKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGTDV 419

Query: 402 YIKLKGPTKKML 413
           YI+LKGP + +L
Sbjct: 420 YIRLKGPKESLL 431

>YIL042C (YIL042C) [2625] chr9 complement(275107..276291) Protein
           with similarity to mitochondrial branched chain
           alpha-ketoacid and pyruvate dehydrogenase protein
           kinases [1185 bp, 394 aa]
          Length = 394

 Score =  416 bits (1068), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 203/374 (54%), Positives = 272/374 (72%), Gaps = 11/374 (2%)

Query: 42  LKHLEFDKHYKIRSNIELLIQEYASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLL 101
           L  L FD+HYKIRSNIELLIQ+YASKPI PL Y+Y   Y+PPL+  EEYMLTIKTINLLL
Sbjct: 26  LSQLSFDQHYKIRSNIELLIQDYASKPIAPLNYEYFLQYRPPLTKKEEYMLTIKTINLLL 85

Query: 102 SYTCRRLNAIQKLPYVAAVNPSIEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFL 161
           S TC+RLNAIQ+LPY A +NP IE++ SLYLK+L++LLSI +PY LH+   I     E L
Sbjct: 86  SLTCKRLNAIQRLPYNAVINPHIERTNSLYLKSLQTLLSIAYPYELHNPPKIQAKFTELL 145

Query: 162 DDHQDTVETLSRGLEEIMDFLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNR-DSDP 220
           DDH+D +  L++GL+EI     K  I +FL+ HL++RI MK+L T++L++   N+ D++ 
Sbjct: 146 DDHEDAIVVLAKGLQEIQSCYPKFQISQFLNFHLKERITMKLLVTHYLSLMAQNKGDTNK 205

Query: 221 NMIGTIHKALPVADMVKKVSEFVSDLCFVKYDQLVAPVKIY-GGHDVTFPCIPTILEYVL 279
            MIG +H+ LP+A ++K VS++V+D+CFVK++    PV I+    D+TF CIP ILEY++
Sbjct: 206 RMIGILHRDLPIAQLIKHVSDYVNDICFVKFNTQRTPVLIHPPSQDITFTCIPPILEYIM 265

Query: 280 TEILKNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIF 339
           TE+ KN++ A I     H      P+E+ ++K +  D+EL +RIRD GGGI P VE+ +F
Sbjct: 266 TEVFKNAFEAQIALGKEH-----MPIEINLLKPD--DDELYLRIRDHGGGITPEVEALMF 318

Query: 340 EYSYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMCKAYIEMFDGKLDIQSLWGWGT 399
            YSY+T      +S ++   +PGE IN VSGMGFGLPMCK Y+E+F GK+D+QSL GWGT
Sbjct: 319 NYSYSTHTQQSADSESTD--LPGEQINNVSGMGFGLPMCKTYLELFGGKIDVQSLLGWGT 376

Query: 400 DVYIKLKGPTKKML 413
           DVYIKLKGP+K  L
Sbjct: 377 DVYIKLKGPSKTAL 390

>KLLA0E04455g 408415..409680 similar to sp|P40530 Saccharomyces
           cerevisiae YIL042c, hypothetical start
          Length = 421

 Score =  405 bits (1041), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 213/372 (57%), Positives = 277/372 (74%), Gaps = 12/372 (3%)

Query: 42  LKHLEFDKHYKIRSNIELLIQEYASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLL 101
           +  L F + Y IRSNI+ LIQ+Y+S  IP + + +L  Y+ PL  NE+Y LTIKT+NLLL
Sbjct: 60  MTELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQYRGPLQDNEKYFLTIKTLNLLL 119

Query: 102 SYTCRRLNAIQKLPYVAAVNPSIEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFL 161
           + TC RL ++Q+LPY+A VNP+IE+S  LYLKTLESLLSIE+PY L+D D I  L  EFL
Sbjct: 120 TLTCHRLASLQELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFL 179

Query: 162 DDHQDTVETLSRGLEEIMDFLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNRDSDPN 221
           +DHQDT+ TLS GL+E+  F + + IFKFL++HL DRI MK+L TN+L +      S   
Sbjct: 180 NDHQDTLLTLSNGLQEVSRFYDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQT--SSDE 237

Query: 222 MIGTIHKALPVADMVKKVSEFVSDLCFVKYDQLVAPVKIYGGHDVTFPCIPTILEYVLTE 281
           +IG IHK L ++D+V + +EFV+DL F+KYD+ V PVKI  G DV F  IPT LEYVL E
Sbjct: 238 VIGVIHKDLHISDLVTRTNEFVNDLTFIKYDKTV-PVKIMEGSDVKFSYIPTDLEYVLQE 296

Query: 282 ILKNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEY 341
           +LKNS RAHIEN       V+K VEV IVK+   D++LEIRIRDFGGGI P VE  +F+Y
Sbjct: 297 LLKNSSRAHIENN------VDKDVEVTIVKN---DDQLEIRIRDFGGGIDPQVEDRVFDY 347

Query: 342 SYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMCKAYIEMFDGKLDIQSLWGWGTDV 401
           S++T   ++K+SG S YV+PG+++  V+GMGFGLPMCKAY+E+F+G LDIQSLWGWGTDV
Sbjct: 348 SFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDV 407

Query: 402 YIKLKGPTKKML 413
           YI+L GP+ ++ 
Sbjct: 408 YIRLHGPSDRLF 419

>Scas_704.44
          Length = 443

 Score =  379 bits (974), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 207/454 (45%), Positives = 288/454 (63%), Gaps = 57/454 (12%)

Query: 2   FLRSALRLG--GHRRVIGRQFHAASVLLKNSKYGSVANYQD------RLKHLEFDKHYKI 53
            L+S +R    G++ ++ R F  +S+    +++ + A++         L HL+F  +YKI
Sbjct: 1   MLQSTIRFARLGNKSLLTRPFFCSSI--TGNRHTTHAHHLKHNKAAINLSHLDFQAYYKI 58

Query: 54  RSNIELLIQEYASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLLSYTCRRLNAIQK 113
           RSNIELLIQ+Y+ KPIPPL+Y +LT Y+ PLS  E+Y L IKTIN L+S TCR+L+ IQ 
Sbjct: 59  RSNIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTINQLISLTCRQLSLIQN 118

Query: 114 LPYVAAVNPSIEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFLDDHQDTVETLSR 173
           LPY+  +NP I +  SLYLKTLESLLSI FPY L+  D+I  LL    ++H DT+  LS 
Sbjct: 119 LPYIVLLNPKINQINSLYLKTLESLLSITFPYDLYKNDLILSLLNHLNEEHNDTLLVLSD 178

Query: 174 GLEEIMD-FLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNRDSDPNMIGTIHKALPV 232
           GL+EI +  L  + I KFLD H+RDRI MK++  NHLA+   +  ++P+MIG IHK + +
Sbjct: 179 GLKEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALL--SPKTEPDMIGIIHKRVKI 236

Query: 233 ADMVKKVSEFVSDLCFVKYDQLVAPVKIYG---------GHDVTFPCIPTILEYVLTEIL 283
           +  + +  EFV+DLC +K++    P+   G         G ++ FPCIP ILEYVLTEIL
Sbjct: 237 SQFINQTFEFVNDLCQLKFN---LPMSTTGNSSMITYITGEEIEFPCIPVILEYVLTEIL 293

Query: 284 KNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEYSY 343
           KNS +AHIEN       V KP+E+ I   E   +EL +RIRD+GGGI P +E  IF+YS+
Sbjct: 294 KNSMKAHIEND------VTKPIEISIF--ETDSDELTVRIRDYGGGIDPKIEPKIFQYSF 345

Query: 344 TT-----------------------VESDKKESGASAYVIPGE-DINIVSGMGFGLPMCK 379
           +T                       + S + +S     ++PGE + N +SGMG+GLP+CK
Sbjct: 346 STTLDSTFSKIHEENNGNQRETDSVIGSCQNDSSVPQLMMPGEVENNTISGMGYGLPLCK 405

Query: 380 AYIEMFDGKLDIQSLWGWGTDVYIKLKGPTKKML 413
            Y+E+FDG + IQ+LWG GTDVYIK+KGP K +L
Sbjct: 406 NYLELFDGDITIQNLWGLGTDVYIKVKGPNKSLL 439

>AER270W [2772] [Homologous to NOHBY] complement(1131292..1132761)
           [1470 bp, 489 aa]
          Length = 489

 Score = 89.0 bits (219), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 133/278 (47%), Gaps = 40/278 (14%)

Query: 164 HQDTVETLSRGLEEIMDFLEKD----TIFKFLDEHLRDRIAMKILATNHLAVSNHNRDSD 219
           H  TV TL+RGL       + +    +I  +LD     RI +++L   HL++      SD
Sbjct: 205 HDATVVTLARGLLRWKRTQKNNVVDASIKGYLDRFYMGRIGIRMLIGQHLSLLEQAMHSD 264

Query: 220 ------PNMIGTIHKALPVADMVKKVSEFVSDL--------CFVKYDQLVAP-VKIY--- 261
                 P  +G+    + +     KV++ V+D+        C   Y+   AP V+++   
Sbjct: 265 LACEHVPGAVGSDADYVGIVCTRTKVAQ-VADIAIDRARHICAEYYNLYEAPKVELHTIP 323

Query: 262 -------GGHDVTFPCIPTILEYVLTEILKNSYRAHIENT-------TSHNCLVEKPVEV 307
                  G  ++ F  +P+ L ++L E+LKN+ RA +E+T       T ++ L   PV+V
Sbjct: 324 IKRDDSSGLREIEFTYVPSHLVHMLFEVLKNALRATVESTIQKNPGVTDYDSLRFPPVKV 383

Query: 308 QIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVIPGEDINI 367
            I +     EEL ++I D GGGI  +    ++ Y YTT+  D+++S              
Sbjct: 384 IISEGT---EELAVKISDEGGGIARSNLPLVWTYLYTTMTDDEQDSLIDGDSTLSGSCPP 440

Query: 368 VSGMGFGLPMCKAYIEMFDGKLDIQSLWGWGTDVYIKL 405
           ++G G+GL + + Y   F G L + S+ G+GTDVY+ L
Sbjct: 441 MAGYGYGLALSRLYARHFGGDLRLLSMDGYGTDVYLHL 478

>KLLA0C05654g complement(504568..505989) similar to sp|P53170
           Saccharomyces cerevisiae YGL059w, start by similarity
          Length = 473

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 94/423 (22%), Positives = 177/423 (41%), Gaps = 82/423 (19%)

Query: 50  HYKIRSNIELLIQEYASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLLSYTCRR-- 107
            Y    N  +L+++Y  K   P++   L  Y    S+    M  I +   +    C R  
Sbjct: 51  QYHYYHNDNVLVKKYLQKKPHPMSLKQLAQYYDD-SSKLTKMKIISSGKFVKEELCVRIA 109

Query: 108 --LNAIQKLPYVAAVNPSIEKSYSLYLKTLESLLSIEFPYALHDKD------IIHGLLIE 159
             L+ +Q LP+    N    + Y  Y    E     +FP    +KD       +H +L +
Sbjct: 110 HKLDLLQNLPFDVVNNFHFNQVYESYYNIFERFR--KFPEIKDEKDNLKFCQFLHAILSD 167

Query: 160 FLDDHQDTVETLSRGLE-EIMDFLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNH---N 215
           F  +  +    +   LE  I+D   +D +   + + LR RI+ +++   HL+++++    
Sbjct: 168 F--NSLNLPHLIMGALECRILDLYPQDKMDALISDLLRARISRRLIVEEHLSITSNYLSG 225

Query: 216 RDSDPNMIGTIHKALPVADMVKKVSE----FVSDLCF--VKYDQLVAPVKIYGGHDVTFP 269
           +  +  ++G I +     + +    E    +++++ F  +K  +L+    I G  ++ F 
Sbjct: 226 KKENTLVLGDIFQKCNAKEYLNGAREVCEAYINNMYFAGIKMPELI----INGDTELEFY 281

Query: 270 CIPTILEYVLTEILKNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFGGG 329
            +P+ L+++L EIL+NSY   ++ T         PV V I+ +   D+    RI D GGG
Sbjct: 282 FLPSHLKFLLGEILRNSYEVTVKETIRLGLEKAPPVTVTIISN---DQSYLFRISDRGGG 338

Query: 330 IPPNVESHIFEYSYTTVESDKKESGASAYVIPG--------------------------- 362
           + P+ +  I  +S+   +   K+S  + + +PG                           
Sbjct: 339 V-PHSDKQI--WSFGKSKELAKQSLDNFHHLPGLQTLSLYDSSNGAHLKSDRYRQTSLDR 395

Query: 363 -EDINIVSG-------------------MGFGLPMCKAYIEMFDGKLDIQSLWGWGTDVY 402
             + N+  G                   +G GL +CK Y E ++G L + S+ G+GTD  
Sbjct: 396 MSENNLTKGKFKVGQPLMELLKRSPRYKLGIGLALCKVYAEYWNGDLTVHSIQGYGTDTV 455

Query: 403 IKL 405
           +KL
Sbjct: 456 LKL 458

>KLLA0F27423g complement(2537353..2538891) similar to
           ca|CA5524|IPF2861 Candida albicans putative pyruvate
           dehydrogenase kinase, hypothetical start
          Length = 512

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 133/298 (44%), Gaps = 57/298 (19%)

Query: 153 IHGLLIEFLDDHQDTVETLSRGL--------EEIMDFLEKDTIFKFLDEHLRDRIAMKIL 204
            + +L    + H  TV TL++G+        + ++D    D+I  FLD     RI +++L
Sbjct: 216 FYNVLQNIKERHDATVITLAKGVLKWKKTHQQNVVD----DSIQSFLDRFYLSRIGIRML 271

Query: 205 ATNHLAVSNHNR--------DSDPNMIGTIHKALPVADMVKKVSEFVSDLCFVKYDQLVA 256
               LA+    R        + D + +G I     +  + K   +    +C   Y    A
Sbjct: 272 IGQQLALLESARQPAEGPFDEDDEDWVGIICTKTNITQLSKTAIDNARHICAEHYGLYEA 331

Query: 257 P-VKIYG------------------GHDVTFPCIPTILEYVLTEILKNSYRAHIENTTSH 297
           P V++                      D+ F  +P  L ++L E LKN+ RA +E T   
Sbjct: 332 PKVQLLTFPLDYRPSTEEKSGCPNESPDIEFMYVPGHLIHMLFETLKNALRATVEKTIEK 391

Query: 298 NCLVEK-----PVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEYSYTTVESDKK- 351
           N  V+K     P +V+++  E   E+L ++I D GGGI  +    ++ Y YTT+  +++ 
Sbjct: 392 NPSVDKYDLKFP-DVKVIITEG-TEDLTVKISDEGGGIARSNLPLVWTYLYTTMPENEQI 449

Query: 352 ----ESGASAYVIPGEDINIVSGMGFGLPMCKAYIEMFDGKLDIQSLWGWGTDVYIKL 405
               E  +  + IP      ++G G+GL + + Y   F G L + S+ G+GTDVY+ L
Sbjct: 450 GLMDEEMSQNFRIP------MAGYGYGLALSRLYARYFGGDLKLMSMEGFGTDVYLHL 501

>Sklu_2299.6 YGL059W, Contig c2299 10909-12501 reverse complement
          Length = 530

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 96/447 (21%), Positives = 179/447 (40%), Gaps = 88/447 (19%)

Query: 34  SVANYQDRLKHLEFDKHYKIRSNIELLIQEYASKPIPPLTYDYLTHYKPPLSANEEYMLT 93
           +++ Y  + +++    +Y+   N  +L Q+Y +K   P++   L  Y      +   +  
Sbjct: 82  TLSAYPSKSRYVNMQHYYQ---NKNILWQKYLTKSPNPVSLKQLAMY----YDDSNKLTK 134

Query: 94  IKTINL-------LLSYTCRRLNAIQKLPYVAAVNPSIEKSYSLYLKTLESLLSIEFPYA 146
           +K IN        L     ++L+ +Q LP+    N    + Y  Y    E          
Sbjct: 135 LKIINSGRFVKEELAIRIAQKLHLLQNLPFNVVNNFHFVQVYESYYNIFERFRKFPHIKN 194

Query: 147 LHDKDIIHGLLIEFLDDHQD-TVETLSRGLEE--IMDFLEKDTIFKFLDEHLRDRIAMKI 203
           + D       L + L D     +  L  G  E  I+D  +++ + + +   LR RI+ ++
Sbjct: 195 IEDNYKFAEFLYQILSDFNSLNLPHLIMGALECRILDLYKQEQMDELISTLLRARISRRL 254

Query: 204 LATNHLAVSNH---NRDSDPNMIGTIHKALPVADMVKKVSE----FVSDLCFVKYDQLVA 256
           +   HL+++++    +  +  ++G I +     D + + S+    F+ D+ F   D +  
Sbjct: 255 IVEEHLSITSNFASGKKENTLVLGDIFQECCARDYLLEASQMCEAFIKDMFF---DGIPL 311

Query: 257 P-VKIYGGHDVTFPCIPTILEYVLTEILKNSYRAHIENTTSHNCLVEKPVEVQIVKDEKY 315
           P   I G  D+ F  +P+ L+Y+L E L+NSY A ++           P+ V I+ +   
Sbjct: 312 PKFVIDGDTDLKFYFLPSHLKYLLGETLRNSYEATVKEYIRLGLDNPHPITVTIISN--- 368

Query: 316 DEELEIRIRDFGGGIP--------------------------PNVES-HIFEYSYT---- 344
           +     RI D GGGIP                          P +++  +++Y Y     
Sbjct: 369 NHSFLFRISDRGGGIPHDDKTIWSFGKSKKLAKESLDNFHKLPGLQTVSLYDYMYQGIHD 428

Query: 345 -------TVESDKKESGASAYVIPGEDINIVSG-------------------MGFGLPMC 378
                  T + D  +      + P  D N+  G                   +G GL +C
Sbjct: 429 GKISQRITSKDDLNQPYRYTSLEPMSDTNLHKGLYKLEKPLLGLLERSSRYKLGIGLAVC 488

Query: 379 KAYIEMFDGKLDIQSLWGWGTDVYIKL 405
           K Y E ++G L + S+ G+GTD  +KL
Sbjct: 489 KVYAEYWNGDLTVHSIHGYGTDTVLKL 515

>Kwal_14.1825
          Length = 492

 Score = 76.3 bits (186), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 100/425 (23%), Positives = 170/425 (40%), Gaps = 81/425 (19%)

Query: 48  DKHYKIRSNIELLIQEYASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTI--------NL 99
            +HY    NI  L + Y +K   P++   L  Y      ++   LT + I        + 
Sbjct: 67  QQHYYQNQNI--LEKHYLTKKPHPVSLSQLAQY-----FDDSTALTKQKIVNSGNFVKDE 119

Query: 100 LLSYTCRRLNAIQKLPYVAAVNPSIEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIE 159
           L++    +++ +Q LP+    N    + Y  Y    E          L D +     L  
Sbjct: 120 LVTRIAHKIHLLQTLPFNVVNNFHFSQVYESYYNIFERFRRYPSIKTLEDNERFAKFLHT 179

Query: 160 FLDDHQD-TVETLSRGLEE--IMDFLEKDTIFKFLDEHLRDRIAMKILATNHLAV-SNHN 215
            L D     +  L  G  E  I+D    + + + +   LR RI+ +++   HL++ SN++
Sbjct: 180 ILSDFNSLNLPHLIMGALECRILDLCPPEKMDEVISSLLRARISRRLIVEEHLSITSNYH 239

Query: 216 RDSDPN--MIGTIHKALPVADMV---KKVSE-FVSDLCFV--KYDQLVAPVKIYGGHDVT 267
                N  ++G I +     + +   K + E F+ D+ +V  K  + +    I G  D+ 
Sbjct: 240 SGKKENTLVLGDIFQECSAREFLLGAKSMCEKFIQDMYYVGIKLPEFI----IDGKTDLK 295

Query: 268 FPCIPTILEYVLTEILKNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFG 327
           F  +P  L+Y+L E+L+NSY A ++          +P+ V +V +E        RI D  
Sbjct: 296 FYFLPLHLKYLLGEVLRNSYEATMQEYIRLGLKDPEPITVTVVSNE---SSFIFRISDRA 352

Query: 328 GGIP--------------------------PNVE---------------SHIFEYSYTTV 346
           GGIP                          P ++               S  F Y +T++
Sbjct: 353 GGIPHDEKTIWSFGKSKELARKSLSNFHKLPGLQTVSLYDHVTDHHPGHSSTFPYKFTSL 412

Query: 347 E---SDKKESGASAYVIPGEDINIVSG---MGFGLPMCKAYIEMFDGKLDIQSLWGWGTD 400
           E   +    +G   +  P   +   S    +G GL MCK Y E ++G L + SL G+GTD
Sbjct: 413 EPINASNLPTGLHKFEKPLLGLLERSSRYKLGIGLAMCKVYAEYWNGDLTVHSLQGYGTD 472

Query: 401 VYIKL 405
             +KL
Sbjct: 473 TVLKL 477

>CAGL0F07007g 687174..688631 highly similar to sp|P53170
           Saccharomyces cerevisiae YGL059w, hypothetical start
          Length = 485

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 127/286 (44%), Gaps = 66/286 (23%)

Query: 179 MDFLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNH---NRDSDPNMIGTIHKALPVADM 235
           +D    D + K L + LR RI+ +++   H++++++    +  +  ++G I +     + 
Sbjct: 192 LDLYPTDKMDKLLSDLLRARISRRLIVEEHISIADNYFSGKKKNTLVLGDIFQECSAKEH 251

Query: 236 V----KKVSEFVSDLCFVKYDQLVAP-VKIYGGHDVTFPCIPTILEYVLTEILKNSYRAH 290
           +    K   +F+ D+ F   + +  P +KI G  D+ F  +P+ L+Y+L EIL+N+Y A 
Sbjct: 252 ILGASKICEKFIQDMYF---ESIPMPELKINGETDLKFYFLPSHLKYLLGEILRNTYEAT 308

Query: 291 IENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEYSYTTVESDK 350
           I++         +P+ + I+K+E   E    RI D  GG+  + + +   +S+   +   
Sbjct: 309 IKDYIRKGLPKPEPIVITIIKNE---ESYLFRICDRAGGLAHHHDDNNI-WSFGKTKEQA 364

Query: 351 KESGASAYVIPG--------------ED-----------------INIVSG--------- 370
            +S ++ + +PG              ED                  NI S          
Sbjct: 365 AQSISNFHKLPGLQTVSLYDHLYNNTEDRQVNRAYINTSLEPMAHSNIASAVATGYEVPL 424

Query: 371 -----------MGFGLPMCKAYIEMFDGKLDIQSLWGWGTDVYIKL 405
                      +G GL MCK Y E ++G L + S+ G+GTD  +KL
Sbjct: 425 LKLLKRSFRYKLGIGLAMCKVYAEYWNGDLTLHSIHGFGTDTVLKL 470

>AAR157C [345] [Homologous to ScYGL059W - SH] (627130..628641) [1512
           bp, 503 aa]
          Length = 503

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 82/363 (22%), Positives = 141/363 (38%), Gaps = 73/363 (20%)

Query: 107 RLNAIQKLPYVAAVNPSIEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFLDDHQD 166
           +L  +Q LP+    N    + Y  Y    E          L D +    LL + + D   
Sbjct: 135 KLRELQDLPFNVVNNFHFVQVYESYYNIFERFRRFPAIRTLEDNERFAELLHQIMSDFNS 194

Query: 167 -TVETLSRGLEE--IMDFLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNRDSDPNMI 223
             +  L  G  E  I+D   +D + + +   LR RI+ +++   HL+V+++       M 
Sbjct: 195 LNLPHLIMGALESCILDLYPQDAMDRLMSSFLRARISRRLIVEEHLSVTSNY------MS 248

Query: 224 GTIHKALPVADMVKKVSE-----FVSDLCFVKYDQLVAP------VKIYGGHDVTFPCIP 272
           G     L + D+ ++ S        + +C      +  P        I G  D+ F  +P
Sbjct: 249 GKSENTLVLGDIFQECSAREYLLHAARICENAIRDMFYPDIPLPDFIIDGCADLRFYFLP 308

Query: 273 TILEYVLTEILKNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFGGGIP- 331
           + L Y+  E L+NSY A ++           P+ V +V++    E    RI D GGGIP 
Sbjct: 309 SQLHYLFGETLRNSYEATVKEAIRRGLPKPDPITVTVVQNP---ESYLFRISDRGGGIPH 365

Query: 332 -------------------------PNVES-----HIF-----------EYSYTTVESDK 350
                                    P  ++     H++           + S T+++S  
Sbjct: 366 PDRTIWSFGKSKLLAQQALDNFHKLPGAQTVSLYDHMYDADARRVAAACKLSNTSLQSMA 425

Query: 351 KES---GASAYVIPGEDINIVS-----GMGFGLPMCKAYIEMFDGKLDIQSLWGWGTDVY 402
           + +   G   +  P   + ++       +G GL MCK Y E ++G L + S+ G GTD  
Sbjct: 426 ETNLTKGRYKFDFPRPLVGLLERPFRYKLGIGLAMCKVYAEYWNGDLTVHSIHGHGTDTV 485

Query: 403 IKL 405
           +KL
Sbjct: 486 LKL 488

>Scas_563.9
          Length = 492

 Score = 70.1 bits (170), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 117/291 (40%), Gaps = 71/291 (24%)

Query: 178 IMDFLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNH---NRDSDPNMIGTIHKALPVAD 234
           I++ L +D I   L   LR RI+ +++   HL++S +    +  +  ++G I +     D
Sbjct: 195 ILELLPRDEIDALLSSLLRARISRRLIVEEHLSISANYLSGKKENTLVLGDIFQECQALD 254

Query: 235 MVKKVSEFVSDLCFVK---YDQLVAP-VKIYGGHDVTFPCIPTILEYVLTEILKNSYRAH 290
              + S       FVK   +D +  P + I G  D+TF  +PT L+Y+L EIL+N Y A 
Sbjct: 255 YFMEASRTCEK--FVKAMYFDDIPIPELIIEGQKDLTFYFLPTHLQYILGEILRNIYEAT 312

Query: 291 IENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEYSYTTVESDK 350
           I++         +P+ + IVK+   D     R  D  GGI  + E     +S+   +   
Sbjct: 313 IKDYIRKGLAKPEPIVITIVKN---DSSFIFRFSDKAGGILHHEED---IWSFGKSKERA 366

Query: 351 KESGASAYVIPG---------------EDINIVSGM------------------------ 371
            ES  + + +PG                D+N  + M                        
Sbjct: 367 AESLNNFHKLPGLQTVSLYDHLYNGEEHDMNTRTLMANRPYMHTSLEAMGHSNLKKGPYK 426

Query: 372 -----------------GFGLPMCKAYIEMFDGKLDIQSLWGWGTDVYIKL 405
                            G GL MCK Y E ++G L + ++ G GTD  + L
Sbjct: 427 FEMPLIEMLERAPRYKLGIGLAMCKIYAEYWNGDLSLTTIPGHGTDTVLTL 477

>YGL059W (YGL059W) [1920] chr7 (392226..393701) Protein with
           similarity to human branched-chain alpha-ketoacid
           dehydrogenase kinase, transcription is induced by the
           drug FK506 in a GCN4-dependent manner [1476 bp, 491 aa]
          Length = 491

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 121/270 (44%), Gaps = 22/270 (8%)

Query: 105 CRRLNAIQKLPYVAAVNPSIEKSYSLYLKTLESLLSIEFPYALHDK----DIIHGLLIEF 160
             +LN +Q+LP+    N    + Y  Y    ES         L D     D I  +L  F
Sbjct: 116 AHKLNQLQQLPFNVVNNFHFVQVYESYYNIFESFRKYPTIRTLEDASQFADFIKNMLEGF 175

Query: 161 LDDHQDTVETLSRGLE-EIMDFLEKDTIFKFLDEHLRDRIAMKILATNHLA-VSNHNRDS 218
             +  +    +   LE  I+D   ++ + + L + LR RI+ +++   H+   +N+    
Sbjct: 176 --NTLNLPHLIMGALECTILDLYPREKMDQLLSDLLRARISRRLIVEEHVVYTANYTSGK 233

Query: 219 DPN--MIGTIHKALPVADMVKKVSE----FVSDLCFVKYDQLVAPVKIYGGHDVTFPCIP 272
           + N  ++G I +       + + SE    F+ D+ F   D  +    I G   ++F  +P
Sbjct: 234 EENTLVLGDIFQECSAKKYLLEASEESQKFIQDMYFK--DIPMPEFIIEGDTQLSFYFLP 291

Query: 273 TILEYVLTEILKNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFGGGIPP 332
           T L+Y+L EIL+N+Y A +++         +P+ V +V +   DE    RI D  GG+  
Sbjct: 292 THLKYLLGEILRNTYEATMKHYIRKGLEKPEPIIVTVVSN---DESYLFRISDKAGGVLH 348

Query: 333 NVESHIFEYSYTTVESDKKESGASAYVIPG 362
           + E+    +S+   +   +ES  + + +PG
Sbjct: 349 DDEN---LWSFGKSKERAQESLNNFHKLPG 375

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%)

Query: 371 MGFGLPMCKAYIEMFDGKLDIQSLWGWGTDVYIKL 405
           +G GL MCK Y E ++G L + S+ G+GTDV +KL
Sbjct: 442 LGIGLAMCKVYAEYWNGDLSLHSMPGYGTDVVLKL 476

>Scas_698.14
          Length = 1183

 Score = 37.0 bits (84), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 15/81 (18%)

Query: 319 LEIRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMC 378
           + I ++D G GI P+++  +FE      ++  ++ G               G G GL +C
Sbjct: 839 IAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 883

Query: 379 KAYIEMFDGKLDIQSLWGWGT 399
           +    M +G ++++S  G G+
Sbjct: 884 RQLANMMNGTMELKSEVGVGS 904

>KLLA0A00638g complement(60378..63845) gi|5531277|emb|CAB50891.1
           Kluyveromyces lactis SLN1 homologue, start by similarity
          Length = 1155

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 319 LEIRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMC 378
           + + + D G GI P+++  +FE      ++  ++ G               G G GL +C
Sbjct: 849 ISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 893

Query: 379 KAYIEMFDGKLDIQSLWGWGT 399
           +   +M  G + + S  G G+
Sbjct: 894 RQLAKMMKGTMKLDSKVGVGS 914

>YIL147C (SLN1) [2530] chr9 complement(69791..73453) Two-component
           signal transducer involved in the osmotic stress signal
           transduction pathway that initiates a phosphorelay from
           Sln1p to Ypd1p to the response regulators Ssk1p and
           Skn7p [3663 bp, 1220 aa]
          Length = 1220

 Score = 32.7 bits (73), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 36/87 (41%), Gaps = 15/87 (17%)

Query: 319 LEIRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMC 378
           + I + D G GI P+++  +F   +  V+ D+  S                G G GL +C
Sbjct: 853 ISIEVEDTGPGIDPSLQESVF---HPFVQGDQTLSRQ------------YGGTGLGLSIC 897

Query: 379 KAYIEMFDGKLDIQSLWGWGTDVYIKL 405
           +    M  G + ++S  G G+     L
Sbjct: 898 RQLANMMHGTMKLESKVGVGSKFTFTL 924

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C
           (HFA1) - SH] complement(466791..473486) [6696 bp, 2231
           aa]
          Length = 2231

 Score = 32.3 bits (72), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 7/91 (7%)

Query: 126 KSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFLDDHQDTVETLSRGLEEIMDFLEKD 185
           KS  L+   +E L SI   Y    +D  H +L  FL+++  +VE L  G +      E+D
Sbjct: 893 KSDPLFQTVVEPLTSITTRYKTGLQDHEHAVLGSFLENYY-SVEKLFSGSK----VNEED 947

Query: 186 TIFKFLDEHLRD--RIAMKILATNHLAVSNH 214
            I K  DE+  D  ++ M +L+ + ++  N+
Sbjct: 948 VILKLRDENADDLNKVVMTVLSHSRVSAKNN 978

>YMR246W (FAA4) [4202] chr13 (759806..761890) Acyl-CoA synthase
           (long-chain fatty acid CoA ligase); contributes to
           activation of imported myristate [2085 bp, 694 aa]
          Length = 694

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

Query: 178 IMDFLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNRDSDPN---MIGTIHKALPVAD 234
           I   +E D++  F D  L  ++A+ +    ++    HN   DP+     G ++KA    D
Sbjct: 166 IHSMVETDSVAIFTDNQLLSKLAVPLKTAKNVKFVIHNEPIDPSDKRQNGKLYKA--AKD 223

Query: 235 MVKKVSEFVSDLCFVKYDQLV 255
            V K+ E   D+    +D+++
Sbjct: 224 AVDKIKEVRPDIKIYSFDEII 244

>CAGL0H06567g 645707..649216 similar to sp|P39928 Saccharomyces
           cerevisiae YIL147c SLN1, hypothetical start
          Length = 1169

 Score = 32.3 bits (72), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 32/79 (40%), Gaps = 15/79 (18%)

Query: 321 IRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMCKA 380
           I + D G GI P +   +FE      ++  ++ G               G G GL +C+ 
Sbjct: 806 IEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYG---------------GTGLGLSICRQ 850

Query: 381 YIEMFDGKLDIQSLWGWGT 399
              M  G + ++S  G G+
Sbjct: 851 LATMMHGTMKLESKVGVGS 869

>AFR284W [3476] [Homologous to ScYIL147C (SLN1) - SH]
           complement(947124..950435) [3312 bp, 1103 aa]
          Length = 1103

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 34/79 (43%), Gaps = 15/79 (18%)

Query: 321 IRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMCKA 380
           I ++D G GI P++   +F+      ++  ++ G               G G GL +C+ 
Sbjct: 803 IEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYG---------------GTGLGLSICRQ 847

Query: 381 YIEMFDGKLDIQSLWGWGT 399
              M  G + ++S  G G+
Sbjct: 848 LATMMKGTMKLESKVGSGS 866

>Kwal_55.19850
          Length = 390

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 38/67 (56%), Gaps = 8/67 (11%)

Query: 84  LSANEEYMLTIKTINLLLSYTCRRLN-----AIQKLPYVAAVNPSIEKSYSLYLKTLESL 138
           ++A E+  L   ++N+    TC  +N     ++ K+P+V A     EK+ S +L+ +E++
Sbjct: 107 VNALEKCCLVRSSLNVDGETTCDAVNDGGDLSLSKIPWVTAEE---EKTLSSFLRDVEAM 163

Query: 139 LSIEFPY 145
           +S+ F Y
Sbjct: 164 VSVNFGY 170

>Kwal_23.6157
          Length = 2230

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 15/124 (12%)

Query: 125  EKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFLDDHQDTVETLSRGLEEIMDFLEK 184
            E    L+   +E L+ I   YA   +   H +  +FL ++   VE L  G     +  E+
Sbjct: 892  ESDDGLFGTVIEPLVDITTRYANGLEAHEHSVFAKFLQNYYQ-VEKLFSG----SNVREE 946

Query: 185  DTIFKFLDEHLRD--RIAMKILATNHLAVSNHNRDSDPNMIGTIHKAL-PVADMVKKVSE 241
            D I K  DE+  D  R+A+ +L+ + ++  N       N+I  I +   P+  M  +VS 
Sbjct: 947  DVILKLRDENPEDLNRVALTVLSHSRVSAKN-------NLILAILRHYQPLCKMSSEVSL 999

Query: 242  FVSD 245
            F+++
Sbjct: 1000 FIAE 1003

>CAGL0H09218g complement(904209..905048) similar to sp|P53078
           Saccharomyces cerevisiae YGL224c, hypothetical start
          Length = 279

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 6/62 (9%)

Query: 334 VESHIFEYSYTTVESDKKESG----ASAYVIPGEDINIVSGMGFGLPMCKAYIEMFDGKL 389
            ES I +      E  K+ESG     +AY +     NI +G+  G+P C   +E  D  L
Sbjct: 192 AESLICKPDPAAFEKAKRESGLGDFKNAYYVDDSGSNIKTGLSLGIPKCAHLVE--DKVL 249

Query: 390 DI 391
           D+
Sbjct: 250 DV 251

>KLLA0C16203g complement(1414169..1418533) weakly similar to
           sp|Q03214 Saccharomyces cerevisiae YMR176w ECM5 involved
           in cell wall biogenesis and architecture singleton,
           start by similarity
          Length = 1454

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 33/73 (45%)

Query: 165 QDTVETLSRGLEEIMDFLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNRDSDPNMIG 224
           ++ ++   R + E  D LE+  +FK    HL D  AM+ L   H  V+    +S    + 
Sbjct: 926 KEVIKESQRIMNECQDILERAEVFKSEKFHLEDSFAMRRLEVPHFDVTIDELNSVCRELN 985

Query: 225 TIHKALPVADMVK 237
             +  + + D VK
Sbjct: 986 KSYVRIEIGDNVK 998

>Scas_581.14
          Length = 214

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 146 ALHDKDIIHGLLIEFLDDHQDTVETLSRGLEEIMDFLEKDTIFKFLD 192
           A+ DKDI +GLL+   +D  D+  T    +E  MD  E+ + F +LD
Sbjct: 138 AIRDKDIDNGLLLIQCNDKLDS--TFLTQIESQMDTNEQASKFPWLD 182

>Kwal_56.23687
          Length = 1576

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 49/101 (48%), Gaps = 11/101 (10%)

Query: 115  PYVAAVNPS----IEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFLDDHQDTVET 170
            P+ A  NP+    + K++  Y++T+  +  +E P +   +     L  + L DH+D +  
Sbjct: 1031 PHCA--NPTQFSQLRKTFERYIRTISGVREVEIPTS---RSSFVCLTFDDLTDHKDKLSN 1085

Query: 171  LSRGLEEIMDFLEKDTIFKFLDEHLRDRIAMKILATNHLAV 211
            +  G + +   L  D +  F  + +  ++++  +ATN L V
Sbjct: 1086 ICSGCDAVE--LRVDHLKSFEPDFVIKQLSLLRMATNSLPV 1124

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,089,164
Number of extensions: 642939
Number of successful extensions: 1973
Number of sequences better than 10.0: 47
Number of HSP's gapped: 1976
Number of HSP's successfully gapped: 54
Length of query: 413
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 309
Effective length of database: 12,995,837
Effective search space: 4015713633
Effective search space used: 4015713633
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)