Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L00847g28528114790.0
Kwal_47.181592872558631e-116
Sklu_2260.23502728681e-116
Scas_704.433162528411e-113
YIL043C (CBR1)3222448191e-109
KLLA0F27621g2812468061e-108
ADL087W2872777871e-105
Kwal_33.142603082784783e-58
KLLA0C16918g3102824681e-56
YML125C3122804662e-56
Sklu_2184.23102474644e-56
AFR439C3102464541e-54
ACR054C3062514411e-52
CAGL0B02519g3122354383e-52
YML087C3122354358e-52
Scas_692.63142494323e-51
Scas_678.62992404061e-47
KLLA0D04488g2962264024e-47
CAGL0E06424g2982183816e-44
YKL150W (MCR1)3022113609e-41
Kwal_23.54713122173504e-39
CAGL0L06666g3982411266e-08
Scas_595.113982411001e-04
YGR234W (YHB1)399196840.012
KLLA0E21901g357114780.071
CAGL0I00990g343170760.11
Scas_699.41318199760.13
YKL173W (SNU114)1008112750.23
Kwal_8.57631859681.2
YGL117W26564671.4
Kwal_56.23144288990681.4
Sklu_1790.425728652.1
Sklu_2427.7378135652.7
Kwal_23.5644689155644.4
Scas_689.20*96944635.4
YOR260W (GCD1)57892636.1
Sklu_2435.134430626.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L00847g
         (281 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L00847g complement(104034..104891) similar to sp|P38626 Sac...   574   0.0  
Kwal_47.18159                                                         337   e-116
Sklu_2260.2 YIL043C, Contig c2260 2185-3237                           338   e-116
Scas_704.43                                                           328   e-113
YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome...   320   e-109
KLLA0F27621g complement(2560055..2560900) similar to sp|P38626 S...   315   e-108
ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH] complement(...   307   e-105
Kwal_33.14260                                                         188   3e-58
KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces...   184   1e-56
YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein ...   184   2e-56
Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement        183   4e-56
AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH] (1...   179   1e-54
ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH] (454023..45...   174   1e-52
CAGL0B02519g 240486..241424 highly similar to sp|Q12746 Saccharo...   173   3e-52
YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein ...   172   8e-52
Scas_692.6                                                            171   3e-51
Scas_678.6                                                            160   1e-47
KLLA0D04488g complement(381861..382751) similar to sp|P36060 Sac...   159   4e-47
CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces c...   151   6e-44
YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5 ...   143   9e-41
Kwal_23.5471                                                          139   4e-39
CAGL0L06666g 752336..753532 highly similar to sp|P39676 Saccharo...    53   6e-08
Scas_595.11                                                            43   1e-04
YGR234W (YHB1) [2182] chr7 (959906..961105) Flavohemoglobin invo...    37   0.012
KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces...    35   0.071
CAGL0I00990g complement(81437..82468) similar to sp|P38909 Sacch...    34   0.11 
Scas_699.41                                                            34   0.13 
YKL173W (SNU114) [3098] chr11 (122522..125548) Component of the ...    33   0.23 
Kwal_8.576                                                             31   1.2  
YGL117W (YGL117W) [1868] chr7 (288516..289313) Protein of unknow...    30   1.4  
Kwal_56.23144                                                          31   1.4  
Sklu_1790.4 YAL014C, Contig c1790 3313-4086                            30   2.1  
Sklu_2427.7 , Contig c2427 17023-18159 reverse complement              30   2.7  
Kwal_23.5644                                                           29   4.4  
Scas_689.20*                                                           29   5.4  
YOR260W (GCD1) [5048] chr15 (813982..815718) Translation initiat...    29   6.1  
Sklu_2435.1 YPR127W, Contig c2435 1340-2374                            28   6.4  

>CAGL0L00847g complement(104034..104891) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 285

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/281 (100%), Positives = 281/281 (100%)

Query: 1   MDGIKILATFSVLVLFYKLFTYSKKGGVSQKEAVKALLKTEFREFELVEKEQLTHNTAKY 60
           MDGIKILATFSVLVLFYKLFTYSKKGGVSQKEAVKALLKTEFREFELVEKEQLTHNTAKY
Sbjct: 1   MDGIKILATFSVLVLFYKLFTYSKKGGVSQKEAVKALLKTEFREFELVEKEQLTHNTAKY 60

Query: 61  KFKLADESHVLGLPIGQHITVKTIIGGKPVSRSYTPTSLDEECVGFFELLVKSYPEGNIS 120
           KFKLADESHVLGLPIGQHITVKTIIGGKPVSRSYTPTSLDEECVGFFELLVKSYPEGNIS
Sbjct: 61  KFKLADESHVLGLPIGQHITVKTIIGGKPVSRSYTPTSLDEECVGFFELLVKSYPEGNIS 120

Query: 121 KHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRV 180
           KHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRV
Sbjct: 121 KHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRV 180

Query: 181 TLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLDKPERDDWEGGVGYVTLDLMKESFP 240
           TLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLDKPERDDWEGGVGYVTLDLMKESFP
Sbjct: 181 TLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLDKPERDDWEGGVGYVTLDLMKESFP 240

Query: 241 SAEEDVQLLVCGPPGMVSSVKRNAVALGFPRAKPVSKMEDR 281
           SAEEDVQLLVCGPPGMVSSVKRNAVALGFPRAKPVSKMEDR
Sbjct: 241 SAEEDVQLLVCGPPGMVSSVKRNAVALGFPRAKPVSKMEDR 281

>Kwal_47.18159
          Length = 287

 Score =  337 bits (863), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 156/255 (61%), Positives = 203/255 (79%), Gaps = 1/255 (0%)

Query: 28  VSQKEAVKALLKTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVK-TIIG 86
           +S K +   LLK EF+EF LV K  LTHNTA Y+F L   + VLGLPIGQHI+++ T+  
Sbjct: 29  LSSKASKPILLKDEFQEFPLVSKTVLTHNTAVYRFGLPKHTDVLGLPIGQHISIQGTLKD 88

Query: 87  GKPVSRSYTPTSLDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPN 146
           GK + RSYTPTSLD + VGFFELL+KSY +GN+SK IG+++IG+KI + GP+GFY Y PN
Sbjct: 89  GKEIMRSYTPTSLDSDSVGFFELLIKSYEQGNVSKMIGELQIGDKIKVRGPKGFYTYTPN 148

Query: 147 VHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRP 206
           ++  + M+AGGTGI PM+QI+K+I  DP D+T+V+++YG+  E+DILLK+E+D +V+  P
Sbjct: 149 MNSEIGMIAGGTGIAPMYQIIKSIHSDPKDRTKVSIIYGSQTEDDILLKKEIDAIVESNP 208

Query: 207 DQFKITYLLDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSSVKRNAVA 266
           DQFK+ YLLDKP RD W GGVGYVT ++MKE  P+A + VQLLVCGPPGMVSS+KRNAVA
Sbjct: 209 DQFKVHYLLDKPARDTWTGGVGYVTAEVMKEHLPAAGDGVQLLVCGPPGMVSSIKRNAVA 268

Query: 267 LGFPRAKPVSKMEDR 281
           LGF +AKP+SKM D+
Sbjct: 269 LGFEKAKPISKMGDQ 283

>Sklu_2260.2 YIL043C, Contig c2260 2185-3237
          Length = 350

 Score =  338 bits (868), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 205/272 (75%), Gaps = 1/272 (0%)

Query: 10  FSVLVLFYKLFTYSKKGGVSQKEAVKALLKTEFREFELVEKEQLTHNTAKYKFKLADESH 69
           F   VL   +F    K  +S K A   L+K +F++F L+ K  LTHNTA Y+F L   + 
Sbjct: 12  FLATVLVIAVFAIINKT-LSSKSARPVLIKDQFQDFPLISKTVLTHNTAVYRFGLPKPTD 70

Query: 70  VLGLPIGQHITVKTIIGGKPVSRSYTPTSLDEECVGFFELLVKSYPEGNISKHIGDMKIG 129
           VLGLPIGQHI+++ II GK + RSYTPTSLD +  G FELL+KSY +GNISK IG++KIG
Sbjct: 71  VLGLPIGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIG 130

Query: 130 EKINISGPRGFYEYVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLE 189
           ++I + GP+GFY Y  N++  LAMVAGGTGI PM+QI+KAI+ +  DKT+V L+YGNV E
Sbjct: 131 DRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSE 190

Query: 190 EDILLKQELDDLVKQRPDQFKITYLLDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQLL 249
           EDILLK+ELD +V+  PDQFKI Y+LDKP  + W GG+GYVT D+MKE  P+A E VQLL
Sbjct: 191 EDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADVMKEYLPAAGEGVQLL 250

Query: 250 VCGPPGMVSSVKRNAVALGFPRAKPVSKMEDR 281
           VCGPP MVSS+KRNAVALGF RAKP+SKM D+
Sbjct: 251 VCGPPPMVSSIKRNAVALGFERAKPISKMGDQ 282

>Scas_704.43
          Length = 316

 Score =  328 bits (841), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 190/252 (75%), Gaps = 2/252 (0%)

Query: 32  EAVKALLKT-EFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTIIGGKPV 90
            A KA+LK   F +F LV K  LTHNTA Y F L +   VLGLPIGQHI++K  I GK +
Sbjct: 61  HANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLPIGQHISIKENIDGKDI 120

Query: 91  SRSYTPTSLDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKH 150
            RSYTPTSLD E  G FELLVKSYP GNISK IG++ IG++IN+ GP G Y Y PN    
Sbjct: 121 MRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNK 180

Query: 151 LAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFK 210
           L M+AGGTGI PMFQIMKAI  +P D T VTLLYGNV E DILL++ELD++VK RPDQFK
Sbjct: 181 LGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFK 240

Query: 211 ITYLLDKPERDDWEGGVGYVTLDLMKESFPSA-EEDVQLLVCGPPGMVSSVKRNAVALGF 269
           + YLLDK +RDDWEG +GYVTLDLM++  PS  EE VQ+L+CGPP MV S KRNAV +G+
Sbjct: 241 VIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVTMGY 300

Query: 270 PRAKPVSKMEDR 281
            R KP+SKMED+
Sbjct: 301 ARGKPLSKMEDQ 312

>YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome b5
           reductase, converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+), uses FAD cofactor [969 bp,
           322 aa]
          Length = 322

 Score =  320 bits (819), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 152/244 (62%), Positives = 187/244 (76%), Gaps = 1/244 (0%)

Query: 39  KTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTIIGGKPVSRSYTPTS 98
           + +F+ F LVEK  LTHNT+ YKF L     VLGLPIGQHI +K  I GK ++RSYTPTS
Sbjct: 75  RNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKDITRSYTPTS 134

Query: 99  LDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAGGT 158
           LD +  G FELLVKSYP GN+SK IG++KIG+ I I GPRG Y Y  N   HL M+AGGT
Sbjct: 135 LDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGT 194

Query: 159 GITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLDKP 218
           GI PM+QIMKAIA DP D T+V+L++GNV EEDILLK+EL+ LV  +P QFKI Y LD P
Sbjct: 195 GIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSP 254

Query: 219 ERDDWEGGVGYVTLDLMKESFPSAEED-VQLLVCGPPGMVSSVKRNAVALGFPRAKPVSK 277
           +R+DW GGVGY+T D++KE  P+A  D VQ+L+CGPP MV+SV+R+ V LGF R+KP+SK
Sbjct: 255 DREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLGFRRSKPLSK 314

Query: 278 MEDR 281
           MED+
Sbjct: 315 MEDQ 318

>KLLA0F27621g complement(2560055..2560900) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 281

 Score =  315 bits (806), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 152/246 (61%), Positives = 190/246 (77%), Gaps = 3/246 (1%)

Query: 37  LLKTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTIIGGKPVSRSYTP 96
           L K + +EF LV K  LTHNTA Y+F L   + VLGLPIGQHI+V+  I GK + RSYTP
Sbjct: 34  LDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQANINGKDILRSYTP 93

Query: 97  TSLDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAG 156
           TSLD + VG FELL+KSY +GNISKH   + IG+KI + GP+GFY Y PN+++ + M+AG
Sbjct: 94  TSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAG 153

Query: 157 GTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLD 216
           GTGI PM+QIMK+I  + SDKT+V+L+YGN  EEDILLK+ELD  V+++PDQFK+ YLLD
Sbjct: 154 GTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYYLLD 213

Query: 217 K-PERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSSVKRNAVALGFPRAKPV 275
           K PE   W GGVGY+T+D MKE  P+  E VQLLVCGPP MVSS+KRNAV LG+ +AKP+
Sbjct: 214 KAPEA--WTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSIKRNAVTLGYEKAKPI 271

Query: 276 SKMEDR 281
           SKM D+
Sbjct: 272 SKMGDQ 277

>ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH]
           complement(532195..533058) [864 bp, 287 aa]
          Length = 287

 Score =  307 bits (787), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 200/277 (72%), Gaps = 3/277 (1%)

Query: 7   LATFSVLVLFYKLFTYSKKGGVSQKE-AVKALLKTEFREFELVEKEQLTHNTAKYKFKLA 65
           L T  VL + + +F Y K  G  Q + AVK  L  +++EF L+ K  LTHNTA Y+F L 
Sbjct: 8   LVTALVLAVSF-IFIYGKFSGAKQSQPAVKTTLNKDWQEFSLLTKTVLTHNTAIYRFGLP 66

Query: 66  DESHVLGLPIGQHITVKTIIGGKPVSRSYTPTSLDEECVGFFELLVKSYPEGNISKHIGD 125
           +   VLGLPIGQHI++  +I GK + RSYTPTSLD +  G+FELLVKSY +GNISK + +
Sbjct: 67  EADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNISKMLAE 126

Query: 126 MKIGEKINISGPRGFYEYVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYG 185
           + IG++I + GP+GFY Y PN++K + M+AGGTGI+PM+QI++AI  +P DKTRV L+YG
Sbjct: 127 LAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYG 186

Query: 186 NVLEEDILLKQELDDLVKQRPDQFKITYLLDK-PERDDWEGGVGYVTLDLMKESFPSAEE 244
           N  ++DILLK ELD +V  +PDQFKI Y+LDK  E + WEG +GY+T  +M+E  P+   
Sbjct: 187 NQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREHLPAPSS 246

Query: 245 DVQLLVCGPPGMVSSVKRNAVALGFPRAKPVSKMEDR 281
             QLL+CGPP MVSS KR AV+LGF +AKP+SK  D+
Sbjct: 247 SAQLLLCGPPPMVSSAKRIAVSLGFEKAKPISKKGDQ 283

>Kwal_33.14260
          Length = 308

 Score =  188 bits (478), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 102/278 (36%), Positives = 162/278 (58%), Gaps = 12/278 (4%)

Query: 4   IKILATFSVLVLFYKLFTYSKKGGVSQKEAVKALLKTEFREFELVEKEQLTHNTAKYKFK 63
           + IL   +V+V F  L  Y ++         K++   ++   EL ++  L+ NTA Y+FK
Sbjct: 39  LWILPFAAVIVGFRFLTAYKRR---------KSVFPDKWSALELEDQTLLSKNTAMYRFK 89

Query: 64  LADESHVLGLPIGQHITVKTIIGGKPVSRSYTPTSLDEECVGFFELLVKSYPEGNISKHI 123
           +      L  P+G H+ V+  I GK   R YTP S   +  G+F+++VKSY +G +SK+ 
Sbjct: 90  MKTSFETLNFPVGHHLAVRVPIDGKDQIRYYTPVSPQYQP-GYFDIIVKSYADGQVSKYF 148

Query: 124 GDMKIGEKINISGPRGFYEYVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLL 183
             +K G  ++  GP G + YV N +K + M+AGG+GITPM QI+  I   P D T+V+L+
Sbjct: 149 AGLKAGSAVDFKGPVGRFNYVVNSYKQIGMIAGGSGITPMLQILNKIITTPEDLTKVSLI 208

Query: 184 YGNVLEEDILLKQELDDLVKQRPDQFKITYLLDKPERDDWEGGVGYVTLDLMKESFPSAE 243
           Y N  E DILLK+E+D++ ++ P+ F++ Y+L  P    W+G VG VT +LM++  P + 
Sbjct: 209 YANETENDILLKEEIDEIAEKYPN-FEVHYVLRTPS-STWKGDVGLVTNELMQKYLPISS 266

Query: 244 EDVQLLVCGPPGMVSSVKRNAVALGFPRAKPVSKMEDR 281
            D +L++ G P M+  +   A  LG+P+    SK +DR
Sbjct: 267 SDNRLVMSGKPEMIRMLLEYAEELGWPKGIEKSKGDDR 304

>KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces
           cerevisiae YML125c, start by similarity
          Length = 310

 Score =  184 bits (468), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 100/282 (35%), Positives = 162/282 (57%), Gaps = 13/282 (4%)

Query: 2   DGIKILATFSVL--VLFYKLFTYSKKGGVSQKEAVKALLKTEFREFELVEKEQLTHNTAK 59
           + +K L  F +L  +L Y++        V  +  +K++    +   EL ++  ++ NTA 
Sbjct: 36  NDLKFLLGFVILGAILAYRM--------VVARSRLKSIYSDRWTALELEDQTIVSKNTAI 87

Query: 60  YKFKLADESHVLGLPIGQHITVKTIIGGKPVSRSYTPTSLDEECVGFFELLVKSYPEGNI 119
           Y+FKL      L +P G H+ V+  +  K   R YTP S   E  G F+++VKSY +G +
Sbjct: 88  YRFKLKTSLECLDIPTGHHLAVRIPLEDKDEIRYYTPISNKFET-GHFDIMVKSYADGQV 146

Query: 120 SKHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTR 179
           SK+   ++ G+ ++  GP G + Y  N  KH+ M+AGG+G+TPM Q++  I   P+D TR
Sbjct: 147 SKYFASLRPGQTVDFKGPVGRFAYEANSSKHIGMIAGGSGLTPMLQVLNTIITTPTDLTR 206

Query: 180 VTLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLDKPERDDWEGGVGYVTLDLMKESF 239
           VTLLY N  E DILLK ELD++ ++ P+ F + YL++ P    W+G VG+VT ++M +  
Sbjct: 207 VTLLYANETENDILLKDELDEISEKYPN-FLVHYLVNHPS-SSWQGEVGWVTKEIMSKYL 264

Query: 240 PSAEEDVQLLVCGPPGMVSSVKRNAVALGFPRAKPVSKMEDR 281
           P    + +LL+CG P M  ++ + A  LG+P+    S  +D+
Sbjct: 265 PDPSAENRLLICGKPEMKKTLLKYAEELGWPKGILKSNPDDQ 306

>YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein
           with similarity to NADH-cytochrome b5 reductase [939 bp,
           312 aa]
          Length = 312

 Score =  184 bits (466), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 103/280 (36%), Positives = 156/280 (55%), Gaps = 13/280 (4%)

Query: 4   IKILATFSVL--VLFYKLFTYSKKGGVSQKEAVKALLKTEFREFELVEKEQLTHNTAKYK 61
           +KIL +  +L  ++F + ++  K+         ++L    +   EL ++  ++ NTA Y+
Sbjct: 40  LKILWSLPILFMIIFVRAYSAYKRR--------RSLYPDRWTSLELEDQTIISKNTALYR 91

Query: 62  FKLADESHVLGLPIGQHITVKTIIGGKPVSRSYTPTSLDEECVGFFELLVKSYPEGNISK 121
           FKL      L +P G H+ V+  I GK   R Y P S   E  G+ +L+VK+Y +G +SK
Sbjct: 92  FKLKTRLESLDIPAGHHVAVRVPIDGKQEVRYYNPISSKLES-GYLDLVVKAYVDGKVSK 150

Query: 122 HIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVT 181
           +   +  G+ ++  GP G   Y PN  KHL +VAGG+GITP+ QI+  I   P D T+V+
Sbjct: 151 YFAGLNSGDTVDFKGPIGTLNYEPNSSKHLGIVAGGSGITPVLQILNEIITVPEDLTKVS 210

Query: 182 LLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLDKPERDDWEGGVGYVTLDLMKESFPS 241
           LLY N  E DILLK ELD++ ++ P  F++ Y++  P  D W G VGY+T D M    P 
Sbjct: 211 LLYANETENDILLKDELDEMAEKYP-HFQVHYVVHYPS-DRWTGDVGYITKDQMNRYLPE 268

Query: 242 AEEDVQLLVCGPPGMVSSVKRNAVALGFPRAKPVSKMEDR 281
             ED +LL+CGP GM +   + A  LG+      S  +D+
Sbjct: 269 YSEDNRLLICGPDGMNNLALQYAKELGWKVNSTRSSGDDQ 308

>Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement
          Length = 310

 Score =  183 bits (464), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 146/247 (59%), Gaps = 3/247 (1%)

Query: 35  KALLKTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTIIGGKPVSRSY 94
           K++    +   EL ++  ++ N+A Y+FKL      L +P+G H+ VK  I GK   R Y
Sbjct: 63  KSVYPNAWTALELEDQILISKNSAIYRFKLKTSLETLKIPVGHHLAVKIPIEGKNEIRYY 122

Query: 95  TPTSLDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMV 154
           TP +   +  G F+++VKSY +G +SK+   +K G+ +   GP G + Y  N  K + M+
Sbjct: 123 TPITQRYDT-GHFDIIVKSYTDGKVSKYFASLKPGQLVEFQGPVGRFNYATNSSKAIGMI 181

Query: 155 AGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFKITYL 214
           AGG+GITPM Q++  I   P D T+V+L+Y N  E DILLK ELD++  + P+ F++ Y+
Sbjct: 182 AGGSGITPMLQVLSQIVTTPEDTTKVSLIYANETENDILLKDELDEMADKYPN-FEVHYV 240

Query: 215 LDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSSVKRNAVALGFPRAKP 274
           L KP    W G  GYVT D M++  P   ++ +LL+CGP  M++ +   +  LG+PR   
Sbjct: 241 LHKPS-PGWTGDTGYVTKDQMQKYLPGPSDENRLLICGPLAMINMLLNYSEELGWPRGIV 299

Query: 275 VSKMEDR 281
            SK +D+
Sbjct: 300 KSKPDDQ 306

>AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH]
           (1228716..1229648) [933 bp, 310 aa]
          Length = 310

 Score =  179 bits (454), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 139/246 (56%), Gaps = 3/246 (1%)

Query: 36  ALLKTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTIIGGKPVSRSYT 95
           ++L  E+   EL E+  L+ N A Y+FKL      L +P G H+  K ++ G    R YT
Sbjct: 64  SILPNEWTPLELEERIVLSKNAAIYRFKLRSSVETLDIPTGFHLAAKVMLDGVEEVRYYT 123

Query: 96  PTSLDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVA 155
           P S ++   G F+++VKSY +G +SK    ++ G+ +   GP G + YV N +K + MV 
Sbjct: 124 PIS-NKFAEGHFDIIVKSYVDGKVSKWFAGLQPGQTVEFKGPVGRFSYVTNAYKKIGMVT 182

Query: 156 GGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLL 215
           GG+ ITPM  ++  I   P D T+V L+Y N  E DILLK ELDDL  + P+ F++ Y++
Sbjct: 183 GGSAITPMLSVLNKIVTTPEDTTQVCLIYANETENDILLKDELDDLASKYPN-FEVHYVV 241

Query: 216 DKPERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSSVKRNAVALGFPRAKPV 275
            KP    W G VGYVT   +++  P      +LL+CGPP M   V   A  LG+P+    
Sbjct: 242 RKPSA-SWTGEVGYVTKQHLEKYLPPCNPAHRLLICGPPKMKQMVLEYAEQLGWPKGAMK 300

Query: 276 SKMEDR 281
           SK ED+
Sbjct: 301 SKPEDQ 306

>ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH]
           (454023..454943) [921 bp, 306 aa]
          Length = 306

 Score =  174 bits (441), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 88/251 (35%), Positives = 144/251 (57%), Gaps = 4/251 (1%)

Query: 18  KLFTYSKKGGVSQKEAVKALL-KTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIG 76
            L T   KG V+ + A +      ++   ++ + EQ++H+T ++ F L  + HV GL   
Sbjct: 34  NLSTSLNKGDVTGQAAAQTFTGDGQWHALKIAKIEQVSHDTRRFTFALPSQDHVTGLTTA 93

Query: 77  QHITVKTII-GGKPVSRSYTPTSLDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINIS 135
             +  K +   G  V R YTP S D    G F+L++K Y  G  + H+  +K  + +   
Sbjct: 94  SALLAKYVTPKGSNVIRPYTPVS-DNMARGMFQLVIKHYDGGKFTTHLFGLKENDTVEFK 152

Query: 136 GPRGFYEYVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLK 195
           GP   + + PN+   + ++  GTGITP+FQ+M  IA +P+D T+V LLYGN   +DILL+
Sbjct: 153 GPIQKWRWDPNMFDSIVLMGAGTGITPLFQMMHHIAENPTDNTKVHLLYGNKTPQDILLR 212

Query: 196 QELDDLVKQRPDQFKITYLLDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPG 255
           +EL++L  + PDQ K+TY +DKPE  D++G  G++T D +K++ P+   +  + VCGPP 
Sbjct: 213 KELEELASKYPDQVKVTYFVDKPE-GDYKGEKGFITKDFLKQNLPTPGSNSHIFVCGPPP 271

Query: 256 MVSSVKRNAVA 266
            + +   N V+
Sbjct: 272 FMDAFSGNKVS 282

>CAGL0B02519g 240486..241424 highly similar to sp|Q12746
           Saccharomyces cerevisiae YML125c, start by similarity
          Length = 312

 Score =  173 bits (438), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 89/235 (37%), Positives = 139/235 (59%), Gaps = 3/235 (1%)

Query: 35  KALLKTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTIIGGKPVSRSY 94
           ++L   ++   EL ++  ++ NTA Y+FKL      + +P G H+ V+  I GK   R+Y
Sbjct: 65  RSLYPDKWTSLELEDQTLISRNTAIYRFKLKTPLETIDIPSGHHVQVRVFIDGKEEVRNY 124

Query: 95  TPTSLDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMV 154
            P S   E  G  +LLVKSY +G +SK+   MK GE ++  GP G   Y PN +K++ MV
Sbjct: 125 NPISTRFE-KGHIDLLVKSYKDGKVSKYFASMKPGETVDFRGPVGSLVYKPNTYKNIGMV 183

Query: 155 AGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFKITYL 214
            GG+GITP  Q++  I   P D T+++L+Y N  E+DILLK+ELD++ ++ P  F + Y+
Sbjct: 184 CGGSGITPALQMLNDIITVPEDLTKLSLIYCNETEKDILLKEELDEMAEKYP-HFNVHYI 242

Query: 215 LDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSSVKRNAVALGF 269
           + +P    WEG VG+++ + M +  P   +D +LL+CGP G    V   A  +G+
Sbjct: 243 VSQP-TGQWEGEVGHISKETMVKHLPHPADDSRLLICGPEGFTQKVFDQAKEIGW 296

>YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein
           containing an oxidoreductase FAD-binding domain and an
           oxidoreductase FAD or NAD-binding domain, has moderate
           similarity to cytochrome b5 reductase (S. cerevisiae
           Cbr1p), which converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+) [939 bp, 312 aa]
          Length = 312

 Score =  172 bits (435), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 91/235 (38%), Positives = 138/235 (58%), Gaps = 3/235 (1%)

Query: 35  KALLKTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTIIGGKPVSRSY 94
           K+L + ++    L +K +++ NT+ Y FKL      L +P+G H+ V+  I G+ + R Y
Sbjct: 65  KSLYRNKWVALPLSKKTRISRNTSLYCFKLKYPFERLHIPMGYHLAVRVTINGERLVRYY 124

Query: 95  TPTSLDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMV 154
           TP ++     G  EL+VK+Y  G +SK+   +KI + +   GP G  EY  +    L ++
Sbjct: 125 TPVNVPNT-EGHLELVVKTYKHGVVSKYFDKLKIRQYVEFKGPLGELEYDQDTATELGII 183

Query: 155 AGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFKITYL 214
           AGG+GITP+ Q+++ I   P D T ++L+Y N  E+DIL+K +LD + K+ P  FK+ Y+
Sbjct: 184 AGGSGITPVLQVLQEIIPSPEDLTHISLIYANETEDDILMKSQLDHMAKEYP-HFKVHYV 242

Query: 215 LDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSSVKRNAVALGF 269
           + KP    W G VGYVTL+ MK   P   ED +LL+CGPP M   V   A  LG+
Sbjct: 243 IHKPN-GKWNGDVGYVTLEEMKRYLPKQAEDHRLLICGPPKMNEMVLNYAKELGW 296

>Scas_692.6
          Length = 314

 Score =  171 bits (432), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 94/249 (37%), Positives = 144/249 (57%), Gaps = 7/249 (2%)

Query: 35  KALLKTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTIIGGKPVSRSY 94
           ++L    +   EL ++  ++ NTA Y+FKL      L +P G HI V+  I  K   R Y
Sbjct: 67  RSLFPDRWTSLELDDQTVVSKNTALYRFKLKTNLESLDIPAGYHIAVRVFIDDKEEIRYY 126

Query: 95  TPTS--LDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKHLA 152
            P S  LD    G F+LL+KSY +G +SK+   +K G+ +   GP G   Y PN  K L 
Sbjct: 127 NPISSKLD---TGHFDLLIKSYADGKVSKYFAGLKPGDTVEFKGPIGELHYAPNSSKALG 183

Query: 153 MVAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFKIT 212
           +VAGG+GITP+ Q++  I   P D T+++L+Y N  E DILLK ELD++ ++ P  F++ 
Sbjct: 184 IVAGGSGITPVLQMLNEIITVPEDLTKLSLIYANDTENDILLKDELDEMSEKYP-HFEVH 242

Query: 213 YLLDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSSVKRNAVALGFPRA 272
           Y++  P  + WEG VG V+ + M++  P   +D +LL+CGP  M   V + A  LG+ ++
Sbjct: 243 YVVRNP-SESWEGDVGLVSKEQMEKYLPKYSDDHRLLICGPEAMEKMVVKYAEELGWKQS 301

Query: 273 KPVSKMEDR 281
              +K +D+
Sbjct: 302 VSKNKGDDQ 310

>Scas_678.6
          Length = 299

 Score =  160 bits (406), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 85/240 (35%), Positives = 142/240 (59%), Gaps = 8/240 (3%)

Query: 20  FTYSKKGGVSQKEAVKALL-KTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQH 78
           + Y++     QKE  +  +    + +  +V+ E  +H+T ++ FKL  E  + GL +   
Sbjct: 27  YFYTRPRVAVQKEKQRVFVGDGNWIDLPIVKIEDESHDTKRFTFKLPSEDAITGLTLASA 86

Query: 79  ITVKTIIG-GKPVSRSYTPTS-LDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISG 136
           I  K +   G  V R YTP S LD++  G FEL++K Y +G +S H+  +K  + ++  G
Sbjct: 87  IFTKYVTAKGNNVVRPYTPVSPLDQQ--GTFELVIKHYNDGKMSSHLFSLKPNDVVSFKG 144

Query: 137 PRGFYEYVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQ 196
           P   +++VPN  K + ++  GTG TP++Q+   IAR+P DKT++ + YGN    DILLK+
Sbjct: 145 PIKKWQWVPNSFKSITLLGAGTGTTPLYQLASHIARNPEDKTKINVFYGNKTSSDILLKK 204

Query: 197 ELDDLVKQRPDQFKITYLLDKPERDDWEGGV--GYVTLDLMKESFPSAEEDVQLLVCGPP 254
           E ++L ++ PDQ K+TY +DK + D  E GV  G+++ + + ++ P  +ED  L +CGPP
Sbjct: 205 EWNELQEKYPDQVKVTYFVDKLD-DGKENGVELGFISKEFIAKNAPGPKEDTHLFICGPP 263

>KLLA0D04488g complement(381861..382751) similar to sp|P36060
           Saccharomyces cerevisiae YKL150w MCR1 cytochrome-b5
           reductase, start by similarity
          Length = 296

 Score =  159 bits (402), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 128/226 (56%), Gaps = 4/226 (1%)

Query: 31  KEAVKALL-KTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTII-GGK 88
            +  KA L   E+ +  +++ E+L+H+T ++ F L  +  V GL     I  K +   G 
Sbjct: 37  NDTSKAFLGDNEWIDLPIIKIEKLSHDTKRFTFALPKKDQVSGLITASCILAKFVTPKGS 96

Query: 89  PVSRSYTPTSLDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVH 148
            V R YTP S D    G  EL+VK Y  G  + H+  +K  + ++  GP   +E+ PN +
Sbjct: 97  NVIRPYTPVS-DNGTKGKMELVVKHYENGKFTSHLFGLKENDTVSFKGPITKWEWKPNSY 155

Query: 149 KHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQ 208
             + ++  GTGI P++Q++  IA +P D T++ L YGN   EDILLK ELD+L K+ PDQ
Sbjct: 156 DSITLLGAGTGINPLYQLVHHIAENPEDNTKIHLYYGNKTPEDILLKSELDNLQKKYPDQ 215

Query: 209 FKITYLLDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPP 254
            KITY +DK E  ++EG  G++T D +    P   E  Q+ VCGPP
Sbjct: 216 VKITYFVDKAE-GNFEGETGFITKDYLSHQAPKPSEKNQVFVCGPP 260

>CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces
           cerevisiae YKL150w MCR1 cytochrome-b5 reductase, start
           by similarity
          Length = 298

 Score =  151 bits (381), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 127/218 (58%), Gaps = 2/218 (0%)

Query: 44  EFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTII-GGKPVSRSYTPTSLDEE 102
           + EL +  + +H+T ++ FKL  +  V GL +   +  K +   G PV R YTP S D  
Sbjct: 52  DLELEKIIEESHDTKRFFFKLPTDDSVSGLTLASAVLTKFMTPKGNPVIRPYTPVS-DLS 110

Query: 103 CVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAGGTGITP 162
             G+ E ++K Y  G ++ H+  +K  + +   GP   +++ PN    + ++ GGTGITP
Sbjct: 111 EKGYIEFVIKHYEGGKMTDHLFQLKPKDTLAFQGPIPKWQWKPNSFDTITLLGGGTGITP 170

Query: 163 MFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLDKPERDD 222
           ++Q++  I ++  DKT++ L YG+    DILLK+ELDDL K+ P+Q  I Y +DK +   
Sbjct: 171 LYQLVHHITQNKEDKTKINLFYGSKTPSDILLKKELDDLQKKYPEQLNIQYFVDKDDTGK 230

Query: 223 WEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSSV 260
           ++G  G++T D + ++ P  +E  Q+ VCGPP  + S+
Sbjct: 231 FDGNKGFITKDFLAKNAPGPKEKTQVFVCGPPPFMDSL 268

>YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5
           reductase, mitochondrial protein that may be involved in
           the response to oxidative damage [909 bp, 302 aa]
          Length = 302

 Score =  143 bits (360), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 124/211 (58%), Gaps = 3/211 (1%)

Query: 51  EQLTHNTAKYKFKLADESHVLGLPIGQHITVKTII-GGKPVSRSYTPTSLDEECVGFFEL 109
           E+ +H+T ++ FKL  E   +GL +   +  K +   G  V R YTP S D    G F+L
Sbjct: 62  EEESHDTRRFTFKLPTEDSEMGLVLASALFAKFVTPKGSNVVRPYTPVS-DLSQKGHFQL 120

Query: 110 LVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAGGTGITPMFQIMKA 169
           +VK Y  G ++ H+  +K  + ++  GP   +++ PN  K + ++  GTGI P++Q+   
Sbjct: 121 VVKHYEGGKMTSHLFGLKPNDTVSFKGPIMKWKWQPNQFKSITLLGAGTGINPLYQLAHH 180

Query: 170 IARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLDKPERDDWEGG-VG 228
           I  +P+DKT+V LLYGN   +DILL++ELD L ++ PD+F +TY +D  + D    G + 
Sbjct: 181 IVENPNDKTKVNLLYGNKTPQDILLRKELDALKEKYPDKFNVTYFVDDKQDDQDFDGEIS 240

Query: 229 YVTLDLMKESFPSAEEDVQLLVCGPPGMVSS 259
           +++ D ++E  P  +E   L VCGPP  +++
Sbjct: 241 FISKDFIQEHVPGPKESTHLFVCGPPPFMNA 271

>Kwal_23.5471
          Length = 312

 Score =  139 bits (350), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 73/217 (33%), Positives = 124/217 (57%), Gaps = 3/217 (1%)

Query: 44  EFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVK-TIIGGKPVSRSYTPTSLDEE 102
           E  + + E ++H+T ++ F L  E  V GL     +  K     G  V R YTP S D  
Sbjct: 67  ELPIAKIEDVSHDTRRFVFSLPQEDQVSGLITASALLAKLQTPKGSNVIRPYTPVS-DVS 125

Query: 103 CVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAGGTGITP 162
             G  E ++K Y  G +++ + D K  + +   GP   +E+ PN    + ++  G+GITP
Sbjct: 126 TKGHIEFVIKHYKGGKMTEMLFDKKPSDTVAFKGPIIKWEWKPNSFDSITLIGAGSGITP 185

Query: 163 MFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLDKPERDD 222
           ++Q++  I+++P DKT++ LLYGN    DILLK+EL+++  +  DQ KI + +DK E   
Sbjct: 186 LYQLLHHISQNPEDKTKIHLLYGNKTPNDILLKKELEEVQAKYADQVKIHFFVDKAE-GP 244

Query: 223 WEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSS 259
           ++G +G++T + ++++ P A E  Q+ VCGPP  + +
Sbjct: 245 FDGEIGFITKEFLEKNVPKASEKNQVFVCGPPPFMQA 281

>CAGL0L06666g 752336..753532 highly similar to sp|P39676
           Saccharomyces cerevisiae YGR234w YHB1 flavohemoglobin,
           start by similarity
          Length = 398

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 114/241 (47%), Gaps = 41/241 (17%)

Query: 42  FREFELVEKEQLTHNTAKYKFKLADESHV--LGLPI--GQHITVKTIIGGKPVS------ 91
           +++FE+V K+++  +  ++  K   +S V    LPI  GQ+ITV +     PV       
Sbjct: 149 WKQFEVVGKDKVAEDIYEFTVKPTGDSGVDLAKLPIIPGQYITVNS----HPVRQDNKYD 204

Query: 92  --RSYTPTSLDEECVGFFELLVKSY---PEGNISKHIG-DMKIGEKINISGPRGFYEYVP 145
             R Y+  S D      F + +++    P+G +S+ +  D+K+G+ + +S P G +    
Sbjct: 205 ALRHYSICSADTTNGLKFAVKLQTSTNNPDGLVSEFLHKDVKVGDVLKLSAPAGDFAVNK 264

Query: 146 NVHKH----LAMVAGGTGITPMFQIMKA-IARDPSDKTRVTLLYGNVLEEDILLKQELDD 200
           ++       L +++ G G+TP+  +++A +  +PS    +  +     E  +  K  +D+
Sbjct: 265 DLINQNDIPLVLLSSGVGVTPIVSMLEAQVKENPS--RPIVWIQSAYNEPHVAFKNHVDN 322

Query: 201 LVKQRPDQFKITYLLD-KPERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSS 259
           L+KQ  D  K+  L D +P  DD            +KE+ P A  DV   +CG    + S
Sbjct: 323 LLKQAKDAKKVVVLTDSQPRIDD----------KFLKENVP-AHADV--YICGSLNFMQS 369

Query: 260 V 260
           +
Sbjct: 370 M 370

>Scas_595.11
          Length = 398

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 114/241 (47%), Gaps = 41/241 (17%)

Query: 42  FREFELVEKEQLTHNTAKYKFKLADES--HVLGLPI--GQHITVKTIIGGKPVS------ 91
           ++ F +V+KE + ++   +  K   ES  ++  LPI  GQ+ITV T     PV       
Sbjct: 149 WKPFTVVDKELVANDVYAFTVKPTTESGINLSTLPIVAGQYITVNT----HPVRQDNQYD 204

Query: 92  --RSYTPTSLDEECVGFFELLV---KSYPEGNISKHIG-DMKIGEKINISGPRGFYEYVP 145
             R Y+  S+  +    F + +   K++P G +S+ +  D+K+G+++ +S P G +    
Sbjct: 205 ALRHYSLCSISTKDGLKFAVKLETDKTHPAGLVSEFLHKDVKVGDELKLSAPAGDFALTD 264

Query: 146 N-VHKH---LAMVAGGTGITPMFQIM-KAIARDPSDKTRVTLLYGNVLEEDILLKQELDD 200
             +H++   L +++ G G+TP+  ++ K +  +P+    +  +  +  E     K+ +D+
Sbjct: 265 KLIHQNEIPLVLLSAGVGVTPILAMLEKQVTENPNRP--IYWIQSSYNEGTQSFKKHVDE 322

Query: 201 LV-KQRPDQFKITYLLDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSS 259
           L+ K    +  I Y   +P  D           + ++E  P A  DV L  CG  G + +
Sbjct: 323 LLDKATTTKKTILYTDTQPAID----------AEFLQEQIP-ANADVYL--CGSLGFMQA 369

Query: 260 V 260
           +
Sbjct: 370 M 370

>YGR234W (YHB1) [2182] chr7 (959906..961105) Flavohemoglobin
           involved in protection from nitrosative stress,
           distantly related to animal hemoglobins [1200 bp, 399
           aa]
          Length = 399

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 89/196 (45%), Gaps = 26/196 (13%)

Query: 42  FREFELVEKEQLTHN----TAKYKFKLADESHVLGLPIGQHITVKTIIGGKPVS------ 91
           ++ F++  KE +  +    T K KF    E   L +  GQ+ITV T     P+       
Sbjct: 149 WKPFDITAKEYVASDIVEFTVKPKFGSGIELESLPITPGQYITVNT----HPIRQENQYD 204

Query: 92  --RSYTPTSLDEECVGFF----ELLVKSYPEGNISKHIG-DMKIGEKINISGPRGFY--- 141
             R Y+  S   +    F    E   +++P G +S+++  D K+G++I +S P G +   
Sbjct: 205 ALRHYSLCSASTKNGLRFAVKMEAARENFPAGLVSEYLHKDAKVGDEIKLSAPAGDFAIN 264

Query: 142 -EYVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDD 200
            E +      L +++ G G+TP+  +++   +   ++  +  +  +  E+    K+ +D+
Sbjct: 265 KELIHQNEVPLVLLSSGVGVTPLLAMLEEQVKCNPNRP-IYWIQSSYDEKTQAFKKHVDE 323

Query: 201 LVKQRPDQFKITYLLD 216
           L+ +  +  KI    D
Sbjct: 324 LLAECANVDKIIVHTD 339

>KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces
           cerevisiae YOR037w CYC2 cytochrome-c mitochondrial
           import factor singleton, hypothetical start
          Length = 357

 Score = 34.7 bits (78), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 44/114 (38%), Gaps = 37/114 (32%)

Query: 90  VSRSYTPTSL-------------DEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISG 136
           V RSYTP  L             +E   G     +K Y +G +++ I  + +G  + + G
Sbjct: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175

Query: 137 PRGFYEY--------------------VPNVHKH----LAMVAGGTGITPMFQI 166
           P   YE+                    V + +K+    +    GGTGI P+ Q+
Sbjct: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQM 229

>CAGL0I00990g complement(81437..82468) similar to sp|P38909
           Saccharomyces cerevisiae YOR037w CYC2, hypothetical
           start
          Length = 343

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 64/170 (37%), Gaps = 31/170 (18%)

Query: 111 VKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKH-----------------LAM 153
           +KSY  G +++ I  + +G  + + GP   Y++  ++ KH                 +  
Sbjct: 155 IKSYNNGEVARWIKSLPVGSTLELRGPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPF 214

Query: 154 VAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELD---DLVKQRPDQFK 210
            AGGTGI    Q        P         Y   L       QEL     LV     Q K
Sbjct: 215 FAGGTGIVTALQ--------PILNPYGQFNYNMTLFHSCKSIQELGCLYHLVNGLAQQNK 266

Query: 211 ITYLLDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSSV 260
           ITY L +  + D    + +  L     +  +   D   +VCGP G +++V
Sbjct: 267 ITYHLFETSKGD--NIIDFKQLIPGPNTSNAGNLDTS-IVCGPEGYITTV 313

>Scas_699.41
          Length = 318

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 76/199 (38%), Gaps = 25/199 (12%)

Query: 90  VSRSYTPTSL-------------DEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISG 136
           V R+YTP  L             D+   G     +K Y  G +++ +  + +   + I G
Sbjct: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160

Query: 137 PRGFYEY--VPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLY--GNVLEEDI 192
           P   Y++    N    ++M   G G+   FQ++ + +     +  V L +  G++ E   
Sbjct: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGP 220

Query: 193 LLKQELDDLVKQRPDQFKITYLLDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQL---- 248
           L K          P   K     +  + DD    +  V+  L  +  PS      L    
Sbjct: 221 LKKIMFSLQHDNGPIDMK---FFESEKGDDIRTQLKSVS-QLFPQFKPSQLGRSNLRQLA 276

Query: 249 LVCGPPGMVSSVKRNAVAL 267
           LVCGP G + +V   +V L
Sbjct: 277 LVCGPEGFIDTVAGASVDL 295

>YKL173W (SNU114) [3098] chr11 (122522..125548) Component of the U5
           small nuclear ribonucleoprotein (U5 snRNP) required for
           pre-mRNA splicing [3027 bp, 1008 aa]
          Length = 1008

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 16/112 (14%)

Query: 12  VLVLFYKLFTYSKKGGVSQKEAVKALLKTEFREFELVEKEQLTHNTAKYKFKLADESHVL 71
           +L+  YK+F+Y+      +K+ +K LL++ FR    + +E L ++   +        HVL
Sbjct: 377 ILIPLYKIFSYALS---MEKDKLKNLLRSNFRVN--LSQEALQYDPQPFL------KHVL 425

Query: 72  GLPIGQHITVKTIIGGKPVSRSYTPTSLDEECVGFFELLVKSYPEGNISKHI 123
            L   Q   +   I     +R Y P  L +       +  KS PEG +  H+
Sbjct: 426 QLIFRQQTGLVDAI-----TRCYQPFELFDNKTAHLSIPGKSTPEGTLWAHV 472

>Kwal_8.576
          Length = 318

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 156 GGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQ--RPDQFKIT 212
           GG G + +F  M A+  +  +     LLYG++ +++I+L +   D+V    R D F +T
Sbjct: 246 GGGGCSGIFSPMGALISEELNPQFDGLLYGDIEKDEIVLAKHFLDVVGHYSRSDLFSMT 304

>YGL117W (YGL117W) [1868] chr7 (288516..289313) Protein of unknown
           function [798 bp, 265 aa]
          Length = 265

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 30/64 (46%)

Query: 150 HLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQF 209
           H  ++      T    + + + R+ S++T V L +  +   D+ L  E DD ++ R    
Sbjct: 198 HKRIIHNSNAYTEYHVMKRGMQRNQSEETLVELEFRILDVSDVNLDNEFDDFLQHRKTSL 257

Query: 210 KITY 213
           KIT+
Sbjct: 258 KITH 261

>Kwal_56.23144
          Length = 2889

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 45/90 (50%), Gaps = 5/90 (5%)

Query: 143  YVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLV 202
            +VPN++K++ +     G   +  I++ + R     TR+ ++Y   +   ++L+    DLV
Sbjct: 2224 WVPNLYKYVYLADDEKGPENVSFILRTLIRLSVRDTRLIMIYSQCIWSTLILEA---DLV 2280

Query: 203  KQRPDQFKITYLLDK-PERDDWEGGVGYVT 231
                D+  + + +D+  E  DW+  +  +T
Sbjct: 2281 SVIVDEI-VNHSIDRDSEGADWKNVISLLT 2309

>Sklu_1790.4 YAL014C, Contig c1790 3313-4086
          Length = 257

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 184 YGNVLEEDILLKQELDDLVKQRPDQFKI 211
           Y +  +ED+ LKQ+ D L  QRP++ K+
Sbjct: 125 YSDTPDEDVTLKQDKDRLFNQRPEELKV 152

>Sklu_2427.7 , Contig c2427 17023-18159 reverse complement
          Length = 378

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 55/135 (40%), Gaps = 19/135 (14%)

Query: 103 CVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNV--HKHLAMVAGGTGI 160
           C G  E     YP+G +S+       G   ++     +  +VP     KH+A +  G G+
Sbjct: 127 CTGCIETYCSEYPDGYVSQG------GYASHVRAHEHYIVHVPPQLDSKHVAPLQCG-GL 179

Query: 161 TPMFQIMKAIARDPSDKTRVTLL-YGNVLEEDILLKQELD---------DLVKQRPDQFK 210
           T    I +A+      K RV ++  G +    I++ + LD         D  K+   +  
Sbjct: 180 TVYSPIKRALKDVTDKKPRVAIIGIGGLGHMAIMISKALDCEVWALSTSDSKKEDAKKMG 239

Query: 211 ITYLLDKPERDDWEG 225
             + ++  E+D W G
Sbjct: 240 ADHFVNTTEKDVWGG 254

>Kwal_23.5644
          Length = 689

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 61/155 (39%), Gaps = 25/155 (16%)

Query: 77  QHITVKTIIGGKPVSRSYTPTSLDEECV-GFFELLVKSYPEGNISKHIGDMKIGEKINIS 135
           Q ITV  I+   P      PTS   E V G    L++        + I    +    ++S
Sbjct: 453 QTITVTAIVENMP-----NPTSEHAEPVTGVATNLLRHIQLSQNKQDIASSGLPVHYDLS 507

Query: 136 GPRGFYE-------------YVP-NVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVT 181
           GPR  +               +P N    + M+  GTG+ P    ++   +    ++ VT
Sbjct: 508 GPRKLFSPFKLPIHVRRSAFRLPSNPATPVIMIGPGTGVAPFRGFVRDRVKFVEQQSNVT 567

Query: 182 -----LLYGNVLEEDILLKQELDDLVKQRPDQFKI 211
                L YG+  + D L ++E  +  K+  D F++
Sbjct: 568 LGKHILFYGSRDQNDYLYQEEWPEYSKKLGDAFEM 602

>Scas_689.20*
          Length = 969

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 6/44 (13%)

Query: 9   TFSVLVL--FYKLFTYSKKGGVSQKEAVKALLKTEFREFELVEK 50
           TF   +L   YKLFT++  G +SQ   +KALL  +F +FEL EK
Sbjct: 365 TFVEFILNPLYKLFTHTLSGELSQ---LKALLLKDF-QFELEEK 404

>YOR260W (GCD1) [5048] chr15 (813982..815718) Translation initiation
           factor eIF2B (guanine nucleotide exchange factor), 58
           kDa (gamma) subunit [1737 bp, 578 aa]
          Length = 578

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 7/92 (7%)

Query: 107 FELLVKSYPEGNISKHIGDMK----IGEKINISGPRGFYEYVPNVHKHLAMVAGG--TGI 160
           FEL+ K+    N S H+ D K    I  K N +G     E +P ++    ++     T I
Sbjct: 119 FELIYKALSNSNHSHHLQDPKKINFIPSKANSTGESLQKELLPRINGDFVILPCDFVTDI 178

Query: 161 TPMFQIMKAIARDPSDKTRVTLLYGNVLEEDI 192
            P   + +   RD  +   +T+ Y N L+  I
Sbjct: 179 PPQVLVDQFRNRD-DNNLAMTIYYKNSLDSSI 209

>Sklu_2435.1 YPR127W, Contig c2435 1340-2374
          Length = 344

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 21/30 (70%)

Query: 183 LYGNVLEEDILLKQELDDLVKQRPDQFKIT 212
            +G+ ++++++L Q L  L+ QRPD  KIT
Sbjct: 247 FHGDSMKQNLVLVQFLQKLLSQRPDSEKIT 276

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.138    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,359,879
Number of extensions: 413941
Number of successful extensions: 1207
Number of sequences better than 10.0: 44
Number of HSP's gapped: 1170
Number of HSP's successfully gapped: 44
Length of query: 281
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 181
Effective length of database: 13,134,309
Effective search space: 2377309929
Effective search space used: 2377309929
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)