Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L00825g26526111621e-163
Scas_704.423112255224e-65
YIL044C (AGE2)2981244798e-59
Kwal_47.181722732874709e-58
Sklu_2260.42691294246e-51
KLLA0F27555g2792284231e-50
ADL084W2331244173e-50
Kwal_33.131018731212214e-20
AFR725C8731192039e-18
ABL164C360981938e-17
KLLA0D18942g357781931e-16
CAGL0H01617g3491161893e-16
CAGL0G05445g354781869e-16
Scas_677.6357761832e-15
Kwal_23.4569370751797e-15
Sklu_2267.4359751771e-14
YDR524C (AGE1)4821131753e-14
YDL226C (GCS1)352791709e-14
Scas_685.25877771641e-12
KLLA0E06787g515711612e-12
YGL181W (GTS1)3961211576e-12
Scas_707.333961201577e-12
AGL279C451801577e-12
Kwal_27.10676466691569e-12
YNL204C (SPS18)300761541e-11
ACL055W4711231542e-11
Scas_672.9485641523e-11
CAGL0G03707g486581499e-11
YER122C (GLO3)493581481e-10
Sklu_2181.34141341452e-10
Kwal_47.172483111201408e-10
CAGL0L06028g5051231392e-09
Scas_602.104471061284e-08
KLLA0C17138g3831131274e-08
Kwal_26.776624345671.3
AFL014C55778643.7
CAGL0C02277g82340626.9
CAGL0E03355g153527627.3
Sklu_2109.357438617.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L00825g
         (261 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L00825g complement(102709..103506) similar to sp|P40529 Sac...   452   e-163
Scas_704.42                                                           205   4e-65
YIL044C (AGE2) [2623] chr9 complement(272949..273845) GTPase-act...   189   8e-59
Kwal_47.18172                                                         185   9e-58
Sklu_2260.4 YIL044C, Contig c2260 5970-6779                           167   6e-51
KLLA0F27555g complement(2554571..2555410) some similarities with...   167   1e-50
ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH] complement(...   165   3e-50
Kwal_33.13101                                                          90   4e-20
AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH] (1771660..1...    83   9e-18
ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C (S...    79   8e-17
KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces...    79   1e-16
CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces c...    77   3e-16
CAGL0G05445g complement(514769..515833) similar to sp|P35197 Sac...    76   9e-16
Scas_677.6                                                             75   2e-15
Kwal_23.4569                                                           74   7e-15
Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement         73   1e-14
YDR524C (AGE1) [1336] chr4 complement(1487530..1488978) ADP-ribo...    72   3e-14
YDL226C (GCS1) [649] chr4 complement(51116..52174) GTPase-activa...    70   9e-14
Scas_685.25                                                            68   1e-12
KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces c...    67   2e-12
YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger...    65   6e-12
Scas_707.33                                                            65   7e-12
AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH] (182187..18...    65   7e-12
Kwal_27.10676                                                          65   9e-12
YNL204C (SPS18) [4399] chr14 complement(258374..259276) Sporulat...    64   1e-11
ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH] complement(2...    64   2e-11
Scas_672.9                                                             63   3e-11
CAGL0G03707g complement(355469..356929) similar to sp|P38682 Sac...    62   9e-11
YER122C (GLO3) [1552] chr5 complement(402867..404348) GTPase-act...    62   1e-10
Sklu_2181.3 YGL181W, Contig c2181 6465-7709                            60   2e-10
Kwal_47.17248                                                          59   8e-10
CAGL0L06028g complement(675584..677101) weakly similar to sp|P40...    58   2e-09
Scas_602.10                                                            54   4e-08
KLLA0C17138g 1497245..1498396 some similarities with sp|P40956 S...    54   4e-08
Kwal_26.7766                                                           30   1.3  
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    29   3.7  
CAGL0C02277g complement(230496..232967) weakly similar to sp|P18...    28   6.9  
CAGL0E03355g complement(307242..311849) similar to sp|P14772 Sac...    28   7.3  
Sklu_2109.3 YPL169C, Contig c2109 2842-4566 reverse complement         28   7.7  

>CAGL0L00825g complement(102709..103506) similar to sp|P40529
           Saccharomyces cerevisiae YIL044c AGE2, hypothetical
           start
          Length = 265

 Score =  452 bits (1162), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 222/261 (85%), Positives = 222/261 (85%)

Query: 1   MTSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKV 60
           MTSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKV
Sbjct: 1   MTSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKV 60

Query: 61  KSVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKYE 120
           KSVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKYE
Sbjct: 61  KSVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKYE 120

Query: 121 RKRWMDSSVDLSRDQPXXXXXXXXXXXXXXXXXXXXXXXXXXXAVEEKLKPQSTHSSSLL 180
           RKRWMDSSVDLSRDQP                           AVEEKLKPQSTHSSSLL
Sbjct: 121 RKRWMDSSVDLSRDQPVVSQANSSSSSLVSTMSSSNESTNNTVAVEEKLKPQSTHSSSLL 180

Query: 181 NLQGRKEIVENKRPARPTQQDTPQRNDLKKSILSLYXXXXXXXXXXXXTMNVSSGMGMTT 240
           NLQGRKEIVENKRPARPTQQDTPQRNDLKKSILSLY            TMNVSSGMGMTT
Sbjct: 181 NLQGRKEIVENKRPARPTQQDTPQRNDLKKSILSLYSSANASKSNNNSTMNVSSGMGMTT 240

Query: 241 PFNTTPQNNSSLSIDDDELFK 261
           PFNTTPQNNSSLSIDDDELFK
Sbjct: 241 PFNTTPQNNSSLSIDDDELFK 261

>Scas_704.42
          Length = 311

 Score =  205 bits (522), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 138/225 (61%), Gaps = 14/225 (6%)

Query: 2   TSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVK 61
           TS  VKKALT LLRDPGN++CADCK QSHPRWASWSLGVF+CIKCAGVHRSLGTHI+KVK
Sbjct: 3   TSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVK 62

Query: 62  SVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKF-NGKSLGNDINLLQEFIRQKYE 120
           SVDLDTWKEEHL+ L++MRNNV ANR YEA LPDSS   NG +   D N LQ FIR KYE
Sbjct: 63  SVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGIT---DTNKLQLFIRTKYE 119

Query: 121 RKRWMDSSVDLSRDQPXXXXXXXXXXXXXXXXXXXXXXXXXXXAVEEKLKPQST-----H 175
            K+W+ +  ++S + P                            +    K   +      
Sbjct: 120 LKKWVGTPREVS-EPPMSTTHEQVAKLSLESTSNPNSNSSSLLDIGSAAKKSVSANTNLK 178

Query: 176 SSSLLNLQGRKEIVENKRPARPTQQDT----PQRNDLKKSILSLY 216
           S+SLLNL       E+ +      + T     QR DLKKSILSLY
Sbjct: 179 STSLLNLATPSNSTEHVKKTHSHNERTDRVVTQRPDLKKSILSLY 223

>YIL044C (AGE2) [2623] chr9 complement(272949..273845)
           GTPase-activating protein for Arf1p, has overlapping
           function with Gcs1p in transport from the trans-Golgi
           network (TGN), involved in endocytosis [897 bp, 298 aa]
          Length = 298

 Score =  189 bits (479), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (80%), Gaps = 3/124 (2%)

Query: 2   TSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVK 61
           TSVPVKKAL+ LLRDPGN+ CADCK+Q HPRWASWSLGVFICIKCAG+HRSLGTHISKVK
Sbjct: 3   TSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVK 62

Query: 62  SVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKYER 121
           SVDLDTWKEEHL +L+Q +NN+ AN  YEA L D  K   +    D + LQ FI+ KYE 
Sbjct: 63  SVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELK---QRKITDTSSLQNFIKNKYEY 119

Query: 122 KRWM 125
           K+W+
Sbjct: 120 KKWI 123

 Score = 31.2 bits (69), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 13/71 (18%)

Query: 204 QRNDLKKSILSLYXXXXXXXXXXXXTMN-------------VSSGMGMTTPFNTTPQNNS 250
           QRNDLKKSILSLY                            V++G+  T   +    ++S
Sbjct: 224 QRNDLKKSILSLYSKPSAQTQSQNSFFTSTTPQPCNTPSPFVNTGITATNNNSMNSNSSS 283

Query: 251 SLSIDDDELFK 261
           ++S+DD+ELFK
Sbjct: 284 NISLDDNELFK 294

>Kwal_47.18172
          Length = 273

 Score =  185 bits (470), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 117/287 (40%), Positives = 147/287 (51%), Gaps = 44/287 (15%)

Query: 1   MTSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKV 60
           M+S  VKK L+ LLRDP N +CADCK+  HPRWASWSLGVFICI+CAG+HRSLGTHISKV
Sbjct: 1   MSSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKV 60

Query: 61  KSVDLDTWKEEHLKELVQMRNNVNANRVYEAKL-----PDSSKFNGKSLGNDINLLQEFI 115
           KSVDLDTW+EEHL+++V+  NN  AN VYE KL     PD+SK            L +FI
Sbjct: 61  KSVDLDTWQEEHLRKVVEFGNNAAANAVYECKLSGNHTPDASK------------LSDFI 108

Query: 116 RQKYERKRWMDSSVDLSRDQPXXXXXXXXXXXXXXXXXXXXXXXXXXXAVEEKLKPQSTH 175
           R KYE K+W+ SS + +   P                             +  L  Q+T 
Sbjct: 109 RSKYELKKWLGSSANAT--TPASGSNSVVTNSKPERTQEKTQVSQQTHNSQTSLLSQTTS 166

Query: 176 SSSLLNLQGRKEIVENKRPAR-PTQQDTPQ-------RNDLKKSILSLYXX-XXXXXXXX 226
            S       + ++  N  P R PT+  T Q       R DLKKSILSLY           
Sbjct: 167 VSIGSGSSSQVDL--NLAPPRAPTRTTTSQAARELNGRPDLKKSILSLYSRPRASATSVA 224

Query: 227 XXTMNVS------------SGMGMTTPFNTTPQNNSSLSIDDDELFK 261
               N+S             G   + P  +     +S S++D+ELFK
Sbjct: 225 SGASNISLGSSTGNSSNSTPGANFSVPAGS--NTTASASLEDNELFK 269

>Sklu_2260.4 YIL044C, Contig c2260 5970-6779
          Length = 269

 Score =  167 bits (424), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 82/129 (63%), Positives = 93/129 (72%), Gaps = 17/129 (13%)

Query: 1   MTSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKV 60
           M+S  VKK L TLLRDP NA CADCK  SHPRW SWSLGVF+CIKCAG+HRSLGTHISKV
Sbjct: 1   MSSPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKV 60

Query: 61  KSVDLDTWKEEHLKELVQMRNNVNANRVYEAKL-----PDSSKFNGKSLGNDINLLQEFI 115
           KSVDLDTW+E+HL+++++  NN  AN  YEAKL     PD SK            LQ FI
Sbjct: 61  KSVDLDTWQEQHLQQVIRWGNNKRANLYYEAKLQGSHTPDPSK------------LQSFI 108

Query: 116 RQKYERKRW 124
           R KYE K+W
Sbjct: 109 RTKYELKKW 117

>KLLA0F27555g complement(2554571..2555410) some similarities with
           sp|P40529 Saccharomyces cerevisiae YIL044c AGE2,
           hypothetical start
          Length = 279

 Score =  167 bits (423), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 121/228 (53%), Gaps = 32/228 (14%)

Query: 1   MTSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKV 60
           MTSV VKK LTTLLRDP N  C DCK  +HPRWASWSLGVF+CIKCAG HRS+GTHISKV
Sbjct: 1   MTSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKV 60

Query: 61  KSVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKYE 120
           KSVDLDTW EEHL+ +++  NN   N  YE KL       G +   D + + +FIR KYE
Sbjct: 61  KSVDLDTWTEEHLEAVLEFGNNKKFNEYYENKL------GGGTYVPDQSKIGQFIRTKYE 114

Query: 121 RKRWM--DSSVDLSRDQPXXXXXXXXXXXXXXXXXXXXXXXXXXXAVEEKLKPQSTHSSS 178
            K+W+  D  VD+   +                            AV       S  S  
Sbjct: 115 LKKWVGDDPIVDVKSSK--------------HTAEAKDRVAQKAAAVRNSPSSDSPRSLD 160

Query: 179 LLNLQGRKEIVENKR-----PARPTQQDT-----PQRNDLKKSILSLY 216
           L        +V +K        +P+  +T     P R DLKKSILSLY
Sbjct: 161 LDLGLNLNSVVTDKNVPQISSEKPSATNTNVYRPPDRPDLKKSILSLY 208

>ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH]
           complement(536243..536944) [702 bp, 233 aa]
          Length = 233

 Score =  165 bits (417), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 74/124 (59%), Positives = 94/124 (75%), Gaps = 6/124 (4%)

Query: 1   MTSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKV 60
           MTSV V++ L  LLRDP N  CADCK+ +HPRWASWSLGVF+CI+CAG HRSLGTH+SKV
Sbjct: 1   MTSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKV 60

Query: 61  KSVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKYE 120
           KSVDLDTWKEEHL+++V+  NN  AN+V+E +L       G S   D + + +FI+ KYE
Sbjct: 61  KSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRL------GGGSYVPDQSKMGQFIKTKYE 114

Query: 121 RKRW 124
            ++W
Sbjct: 115 VRKW 118

>Kwal_33.13101
          Length = 873

 Score = 89.7 bits (221), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 7/121 (5%)

Query: 16  DPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLDTWKEEHLKE 75
           D  N +C DC   +   W S +L   +CI+C+ VHRSLG+HISKV+S+ LD++    +KE
Sbjct: 575 DASNTTCCDCGDSNQVEWISINLLCVLCIQCSAVHRSLGSHISKVRSLLLDSFTSREIKE 634

Query: 76  LVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKYERKRWMDSSVDLSRDQ 135
           L++  +N N N +YEA+L   S   G S+ +       FI  KY  K+++     L  D+
Sbjct: 635 LLKYVSNKNLNSIYEAELTQKSIIPGSSVADRT----RFITDKYVSKKYVS---PLQEDE 687

Query: 136 P 136
           P
Sbjct: 688 P 688

>AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH]
           (1771660..1774281) [2622 bp, 873 aa]
          Length = 873

 Score = 82.8 bits (203), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 71/119 (59%), Gaps = 7/119 (5%)

Query: 16  DPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLDTWKEEHLKE 75
           DP N++C DC+S     W S ++   +CI C+GVHRSLG H+SK++S+ LD++      +
Sbjct: 559 DPSNSACCDCRSDKQVEWISLNILCVVCINCSGVHRSLGAHVSKMRSLTLDSFSSPESLQ 618

Query: 76  LVQMRNNVNANRVYEAK-LPDSSKFNGKSLGNDINLLQEFIRQKYERKRWMDSSVDLSR 133
           L++  +N N N +YE++ LP           N I+  + +I  KY  K++++ + D+S+
Sbjct: 619 LLKCVSNQNVNSLYESEDLPPIFP------ENSIDQRKSYITDKYVSKKYVNRTEDISK 671

>ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C
           (SPS18) - SH] (91566..92648) [1083 bp, 360 aa]
          Length = 360

 Score = 79.0 bits (193), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 58/98 (59%), Gaps = 5/98 (5%)

Query: 7   KKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLD 66
           ++ L  L +  GN  CADC +  +P+WAS   G+FIC++CAG+HR LG HIS V+S+ +D
Sbjct: 11  RRRLLQLQKLGGNKKCADCGA-PNPQWASPKFGIFICLECAGIHRGLGVHISFVRSITMD 69

Query: 67  TWKEEHLKELVQMRN----NVNANRVYEAKLPDSSKFN 100
            +K E L+ +    N       A    + KLP  +K++
Sbjct: 70  QFKPEELERMEHGGNAQFHEYLAKHGVDQKLPQKAKYD 107

>KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces
          cerevisiae YDL226c GCS1 ADP-ribosylation factor
          GTPase-activating protein (ARF-GAP), start by
          similarity
          Length = 357

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 4/78 (5%)

Query: 7  KKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLD 66
          ++ L  L +  GN  C DC +  +P+WAS   GVFIC++CAG+HR LG HIS V+S+ +D
Sbjct: 11 RRRLLQLQKVGGNKKCLDCGAH-NPQWASPKFGVFICLECAGIHRGLGVHISFVRSITMD 69

Query: 67 TWKEEHLKELVQMRNNVN 84
           +K +   ELV+M N  N
Sbjct: 70 QFKSD---ELVRMENGGN 84

>CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces
           cerevisiae YDR524c AGE1, hypothetical start
          Length = 349

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 65/116 (56%), Gaps = 5/116 (4%)

Query: 16  DPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLDTWKE-EHLK 74
           D  N  C DC S+ +  W S +L   +CI+C+GVHRSLG+HISKV+S+++D       LK
Sbjct: 18  DESNKRCCDCGSRHNVDWVSINLLCVVCIQCSGVHRSLGSHISKVRSLNMDDLHSNRELK 77

Query: 75  E-LVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKYERKRWMDSSV 129
             LV    N N N VYEA++P   K    +   D      +I  KY  K++++ ++
Sbjct: 78  YLLVNHLINRNVNSVYEARIPAGIKIRKDAQPAD---RARYIVDKYMHKKYVERTM 130

>CAGL0G05445g complement(514769..515833) similar to sp|P35197
          Saccharomyces cerevisiae YDL226c GCS1 ADP-ribosylation
          factor GTPase-activating protein, start by similarity
          Length = 354

 Score = 76.3 bits (186), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 50/78 (64%), Gaps = 4/78 (5%)

Query: 7  KKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLD 66
          ++ L  L +   N  C DC +  +P+WAS   G+FIC++CAG HRSLG HIS V+S+ +D
Sbjct: 11 RRRLLQLQKIGANKKCVDCGA-PNPQWASPKFGIFICLECAGTHRSLGVHISFVRSITMD 69

Query: 67 TWKEEHLKELVQMRNNVN 84
           +K+E   ELV+M    N
Sbjct: 70 QFKQE---ELVRMEEGGN 84

>Scas_677.6
          Length = 357

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 6  VKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDL 65
           ++ L  L +   N  C DC +  +P+WAS   GVFIC++CAG HRSLG HIS V+S+ +
Sbjct: 10 TRRRLLQLQKIGANKKCVDCHA-PNPQWASPKFGVFICLECAGTHRSLGVHISFVRSITM 68

Query: 66 DTWKEEHLKELVQMRN 81
          D +K E L+ + +  N
Sbjct: 69 DQFKPEELERMEKGGN 84

>Kwal_23.4569
          Length = 370

 Score = 73.6 bits (179), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 7  KKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLD 66
          ++ L  L +   N  C DC++  +P+WAS   G+FIC++CAG+HR LG HIS V+S+ +D
Sbjct: 12 RRRLLQLQKVGSNKKCVDCEA-PNPQWASPKFGIFICLECAGLHRGLGVHISFVRSITMD 70

Query: 67 TWKEEHLKELVQMRN 81
           +K E L+ + +  N
Sbjct: 71 QFKPEELERMEKGGN 85

>Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement
          Length = 359

 Score = 72.8 bits (177), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 7  KKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLD 66
          ++ L  L +   N  C DC +  +P+WAS   G+FIC++CAG+HR LG HIS V+S+ +D
Sbjct: 12 RRRLLQLQKIGSNKKCIDCNA-PNPQWASPKFGIFICLECAGIHRGLGVHISFVRSITMD 70

Query: 67 TWKEEHLKELVQMRN 81
           +K E L  + +  N
Sbjct: 71 QFKPEELARMEKGGN 85

>YDR524C (AGE1) [1336] chr4 complement(1487530..1488978)
           ADP-ribosylation factor (ARF) GTPase activating protein
           (GAP) with effector functions, involved in endocytosis
           and protein secretion [1449 bp, 482 aa]
          Length = 482

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 64/113 (56%), Gaps = 6/113 (5%)

Query: 16  DPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLDTWKEEHLKE 75
           D  N  C DC S +   W S +L   +CIKC+GVHRSLG+HISK++S+ LD +    L  
Sbjct: 180 DKSNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLDNFTSLELMH 239

Query: 76  LVQMRNNVNANR-VYEAKLPDSSKFNGKSL--GNDINLLQEFIRQKYERKRWM 125
           L+Q   + +    +YE+ L +   F  K +   +D +   +FI  KY+ K+++
Sbjct: 240 LLQNNVSNSNVNAIYESNLRN---FPVKKITANSDDSERSKFIIDKYQFKKFV 289

>YDL226C (GCS1) [649] chr4 complement(51116..52174)
          GTPase-activating protein (GAP) for ADP-ribosylation
          factors Arf1p and Arf2p, involved in endocytosis,
          exocytosis, secretion, and mitochondrial and vacuolar
          organization, member of the Gcs1p/Glo3p/Sps18p family
          [1059 bp, 352 aa]
          Length = 352

 Score = 70.1 bits (170), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 48/79 (60%), Gaps = 4/79 (5%)

Query: 6  VKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDL 65
           ++ L  L +   N  C DC +  +P+WA+   G FIC++CAG+HR LG HIS V+S+ +
Sbjct: 10 TRRRLLQLQKIGANKKCMDCGA-PNPQWATPKFGAFICLECAGIHRGLGVHISFVRSITM 68

Query: 66 DTWKEEHLKELVQMRNNVN 84
          D +K E   EL++M    N
Sbjct: 69 DQFKPE---ELLRMEKGGN 84

>Scas_685.25
          Length = 877

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (59%), Gaps = 2/77 (2%)

Query: 17  PGNASCADCK-SQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLDTWKEEHLKE 75
           P N  C DC  S     W S +L   +CIKC+GVHRS+G HISK++S+ LD +  + +  
Sbjct: 590 PSNQRCCDCNTSDGTVEWISLNLLCLVCIKCSGVHRSMGAHISKIRSLTLDNFTSKEMIY 649

Query: 76  LVQ-MRNNVNANRVYEA 91
           L++   +N   N +YE+
Sbjct: 650 LIKNYISNEKVNSIYES 666

>KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces
          cerevisiae YER122c GLO3 zinc finger protein, start by
          similarity
          Length = 515

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 6  VKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDL 65
          V K    L     N +C DC ++ +P W S   GV +CI C+G HR++GTHI+ VKS +L
Sbjct: 17 VTKVFARLTTKSENRACFDCGAK-NPTWTSVPFGVLLCIDCSGEHRNMGTHITFVKSSNL 75

Query: 66 DTWKEEHLKEL 76
          D W   +L+  
Sbjct: 76 DKWTVNNLRRF 86

>YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger
           transcription factor of the Gcs1p/Glo3p/Sps18p family,
           involved in heat resistance, flocculation, timing of bud
           emergence, and regulation of biological rhythms [1191
           bp, 396 aa]
          Length = 396

 Score = 65.1 bits (157), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 63/121 (52%), Gaps = 13/121 (10%)

Query: 6   VKKALTTLLRDPGNAS-CADCKSQSHPRWASWSLGVFICIKCAGVHRS-LGTH----ISK 59
           V + L  L+    NA+ C +C    +P W S +LGVF+C +CA VHR   G+      S 
Sbjct: 13  VDRELKELINSSENANKCGEC-GNFYPTWCSVNLGVFLCGRCASVHRKVFGSRDDDAFSN 71

Query: 60  VKSVDLDTWKEEHLKELVQMRNNVNANRVYEAK-LPDSSKFNGKSLGNDINLLQEFIRQK 118
           VKS+ +D W  E + ELV +  N    R +  K +P    F+G    +D  +++ +IR K
Sbjct: 72  VKSLSMDRWTREDIDELVSLGGNKGNARFWNPKNVP--FPFDGD---DDKAIVEHYIRDK 126

Query: 119 Y 119
           Y
Sbjct: 127 Y 127

>Scas_707.33
          Length = 396

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 64/120 (53%), Gaps = 11/120 (9%)

Query: 6   VKKALTTLLRDPGNAS-CADCKSQSHPRWASWSLGVFICIKCAGVHRSL-----GTHISK 59
           ++  L  LL  P NA+ C +C S + P W S +LGVF+C +CA VHR +         S 
Sbjct: 21  IENELRDLLNAPENANKCGECGS-TFPTWCSINLGVFLCGRCASVHRKILNGREDDVFSN 79

Query: 60  VKSVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKY 119
           +KS+ LD W  + +  L ++  N   ++ +  K  +   F+G    +D ++++ FIR KY
Sbjct: 80  LKSLSLDKWNNDDMDILAELGGNKGNHKFWNPKH-EPFPFDGD---DDKSIVEHFIRDKY 135

>AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH]
          (182187..183542) [1356 bp, 451 aa]
          Length = 451

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query: 10 LTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLDTWK 69
           + L   P N +C DC ++ +P W S   G+ +CI+C+G HR LG HI+ VKS +LD W 
Sbjct: 19 FSKLNSKPENRTCFDCGNK-NPTWTSVPFGIMLCIQCSGEHRKLGVHITFVKSSNLDKWT 77

Query: 70 EEHLKELVQMRNNVNANRVY 89
            +L+   +M  N  A   +
Sbjct: 78 INNLRRF-KMGGNHRAREFF 96

>Kwal_27.10676
          Length = 466

 Score = 64.7 bits (156), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 8  KALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLDT 67
          K    L     N +C DC ++ +P W S   GV +CI+C+ VHR+LG HI+ VKS +LD 
Sbjct: 17 KVFQKLASKQDNRACFDCGTK-NPTWTSVPFGVMLCIQCSAVHRNLGVHITFVKSSNLDK 75

Query: 68 WKEEHLKEL 76
          W   +L+  
Sbjct: 76 WTVNNLRRF 84

>YNL204C (SPS18) [4399] chr14 complement(258374..259276)
          Sporulation-specific zinc finger protein involved in
          activation of sporulation, member of Gcs1p/Glo3p/Sps18p
          family of zinc-finger proteins [903 bp, 300 aa]
          Length = 300

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 49/76 (64%), Gaps = 1/76 (1%)

Query: 7  KKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLD 66
          +K L    +  GN +C +CKS  +P++ S S G+FIC+ CA + R +GT+I  VKS+ +D
Sbjct: 13 RKRLLRAKKAAGNNNCFECKS-VNPQFVSCSFGIFICVNCANLLRGMGTNIFCVKSITMD 71

Query: 67 TWKEEHLKELVQMRNN 82
           ++E+ ++ + +  NN
Sbjct: 72 NFEEKDVRRVEKSGNN 87

>ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH]
           complement(267925..269340) [1416 bp, 471 aa]
          Length = 471

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 65/123 (52%), Gaps = 17/123 (13%)

Query: 6   VKKALTTLLRDPGNAS-CADCKSQSHPRWASWSLGVFICIKCAGVHRSL-----GTHISK 59
           V++ L  L+  P NA+ C +C + ++P W S +LG F+C +CA VHR +     G   S 
Sbjct: 9   VERELKALVSSPENANRCGECGA-TYPTWCSVNLGAFLCGRCAAVHRKVLTGEQGGPESH 67

Query: 60  VKSVDLDTWKEEHLKELVQM---RNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIR 116
           VKS+ LD W  + L+E+      R N +   V     P    ++G    +D + +++FIR
Sbjct: 68  VKSLTLDRWTVDELEEITNSGGNRRNHHTWNVRNVAFP----YDGD---DDRSRVEDFIR 120

Query: 117 QKY 119
            KY
Sbjct: 121 NKY 123

>Scas_672.9
          Length = 485

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 19 NASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLDTWKEEHLKELVQ 78
          N  C DC ++ +P W S   GV +CI+C+ VHR+LG HI+ VKS  LD W   +L+    
Sbjct: 28 NRVCFDCGNK-NPTWTSVPFGVMLCIQCSAVHRNLGVHITFVKSSTLDKWTINYLRRFKL 86

Query: 79 MRNN 82
            NN
Sbjct: 87 GGNN 90

>CAGL0G03707g complement(355469..356929) similar to sp|P38682
          Saccharomyces cerevisiae YER122c GLO3, hypothetical
          start
          Length = 486

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 19 NASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLDTWKEEHLKEL 76
          N  C DC ++ +P W S   GV +CI+C+ VHR+LG HI+ VKS  LD W   +L+  
Sbjct: 26 NRVCFDCGNK-NPTWTSVPFGVLLCIQCSAVHRNLGVHITFVKSSTLDKWTVNNLRRF 82

>YER122C (GLO3) [1552] chr5 complement(402867..404348)
          GTPase-activating protein (GAP) for ADP-ribosylation
          factors Arf1p and Arf2p, involved in retrograde
          transport between Golgi and ER as well as endocytosis
          [1482 bp, 493 aa]
          Length = 493

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 19 NASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVKSVDLDTWKEEHLKEL 76
          N  C DC ++ +P W S   GV +CI+C+ VHR++G HI+ VKS  LD W   +L+  
Sbjct: 28 NRVCFDCGNK-NPTWTSVPFGVMLCIQCSAVHRNMGVHITFVKSSTLDKWTINNLRRF 84

>Sklu_2181.3 YGL181W, Contig c2181 6465-7709
          Length = 414

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 70/134 (52%), Gaps = 19/134 (14%)

Query: 6   VKKALTTLLRDPGNAS-CADCKSQSHPRWASWSLGVFICIKCAGVHRS-LGTH----ISK 59
           V+K L  L+  P N + C +C +  +P W S +LGVF+C +CA VHR  LG       S 
Sbjct: 9   VEKELKDLVNLPENGNRCGECGA-PYPTWCSVNLGVFLCGRCASVHRKVLGNRDDDAHSD 67

Query: 60  VKSVDLDTWKEEHLKELVQMRNNVNANR----VYEAKLPDSSKFNGKSLGNDINLLQEFI 115
           VKS+ LD WKE  L  +    NN   NR    V+  K      F+G    +D + +++FI
Sbjct: 68  VKSLTLDRWKESDLDCV----NNGGGNRRNKSVWNPK-DHPFPFDGD---DDKSAVEKFI 119

Query: 116 RQKYERKRWMDSSV 129
           R KY   ++  +++
Sbjct: 120 RDKYILGKFRHTAI 133

>Kwal_47.17248
          Length = 311

 Score = 58.5 bits (140), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 61/120 (50%), Gaps = 11/120 (9%)

Query: 6   VKKALTTLLRDPGNAS-CADCKSQSHPRWASWSLGVFICIKCAGVHRS-LGTH----ISK 59
            ++ L  +L  P N + C +C   + P W S +LGVF+C +CA VHR+ LG       S 
Sbjct: 10  AERELKNILNSPENGNKCGEC-GNTFPTWCSINLGVFLCGRCASVHRNILGNRDDEIYSD 68

Query: 60  VKSVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKY 119
           V+S+ +D W    L E+ +   N   NR+          F+G     D + +++F+R+KY
Sbjct: 69  VRSLTMDRWSTRDLDEIAESGGN-RRNRMLWNPQNVPFPFDGDE---DKSAVEQFVREKY 124

>CAGL0L06028g complement(675584..677101) weakly similar to sp|P40956
           Saccharomyces cerevisiae YGL181w GTS1, start by
           similarity
          Length = 505

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 61/123 (49%), Gaps = 14/123 (11%)

Query: 6   VKKALTTLLRDPGNAS-CADCKSQSHPRWASWSLGVFICIKCAGVHRS-LGTH------- 56
           +   L  ++  P N + C +C S + P W S +LGVF+C +CA VHR  LGT        
Sbjct: 16  IDGELKDIVNAPENGNRCGECGS-AVPTWCSTNLGVFLCGRCASVHRKILGTDPDEESGI 74

Query: 57  ISKVKSVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIR 116
            S VKS+ ++ W+ E +  +     N    R +  K  +   F+G     D + ++ F+R
Sbjct: 75  FSNVKSLSMERWEAEDIDSVASSGGNKGNMRKWNPKN-EPFPFDGDE---DKSAVERFVR 130

Query: 117 QKY 119
           +KY
Sbjct: 131 EKY 133

>Scas_602.10
          Length = 447

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 13/106 (12%)

Query: 22  CADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTH---ISKVKSVDLDTWKEEHLKELVQ 78
           C +C    +P W S +  +F+C +CA VH+ +  H   +S +KS+ LD W  + L + + 
Sbjct: 25  CGEC-GLPNPTWCSTTYNLFLCTRCATVHKKILNHDPDLSIIKSIKLDYWTNDELNKFIN 83

Query: 79  MRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKYERKRW 124
              N    R +  K  D   F+  +  N       F+R KY  K++
Sbjct: 84  SGGNAYNKRFWNPK--DIKNFDDANWEN-------FLRDKYILKKF 120

>KLLA0C17138g 1497245..1498396 some similarities with sp|P40956
           Saccharomyces cerevisiae YGL181w GTS1 transcription
           factor of the GCS1P/GLO3P/SPS18P family singleton,
           hypothetical start
          Length = 383

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 10/113 (8%)

Query: 22  CADCKSQSHPRWASWSLGVFICIKCAGVHRS-LGTH----ISKVKSVDLDTWKEEHLKEL 76
           C +C +   P + S +LGVF+C +CA VHR  LG+      S VKS+ LD W +  ++ +
Sbjct: 26  CGECGT-PFPTYCSVNLGVFLCGRCASVHRKVLGSREDGATSIVKSLSLDRWSKRDVQTV 84

Query: 77  VQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKYERKRWMDSSV 129
             +  N + +  +  K  +   F+G     D   ++ FIR KY + ++  ++V
Sbjct: 85  ADLGGNKHNSSFWNPKK-EPFPFDGDE---DRTAVEMFIRDKYLKGKFRHTAV 133

>Kwal_26.7766
          Length = 243

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 56  HISKVKSVDLDTWKEEHLKELVQMRNNVN-ANRVYEAKLPDSSKF 99
           H+     VDLDTW + ++K +V +   V    R+++ K P  + +
Sbjct: 88  HVGGATVVDLDTWSKNNIKYMVHVPTVVAPTRRIFDEKRPIETGY 132

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 11/78 (14%)

Query: 12  TLLRDPGNASCADCKSQSHPRWASWSLGVFIC-------IKCAGVHRSLGTHISKVKSVD 64
           ++ +D GN    D ++ SH R    SLGV IC       + C G  +S    ++ V+  D
Sbjct: 279 SIGKDDGNTEIWDVETMSHVRTMRSSLGVRICSQDWLDTVVCIGA-KSGEIQVNDVRVKD 337

Query: 65  --LDTWKEEHLKELVQMR 80
             + TW E+H  E+  ++
Sbjct: 338 HIVSTW-EKHTSEVCGIK 354

>CAGL0C02277g complement(230496..232967) weakly similar to sp|P18494
           Saccharomyces cerevisiae YER040w GLN3 transcription
           factor for positive nitrogen regulation, hypothetical
           start
          Length = 823

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 16/40 (40%)

Query: 16  DPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGT 55
           DP    C +CK+   P W     G  +C  C    +  GT
Sbjct: 332 DPDAVHCDNCKTYKTPLWRRSPEGKVLCNACGLFQKLHGT 371

>CAGL0E03355g complement(307242..311849) similar to sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, hypothetical
           start
          Length = 1535

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 57  ISKVKSVDLDTWKEEHLKELVQMRNNV 83
           +S +KS+ L  W+E  LK L  +RN++
Sbjct: 462 LSSIKSIKLYAWEEPMLKRLFHIRNDL 488

>Sklu_2109.3 YPL169C, Contig c2109 2842-4566 reverse complement
          Length = 574

 Score = 28.1 bits (61), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 25/38 (65%)

Query: 56  HISKVKSVDLDTWKEEHLKELVQMRNNVNANRVYEAKL 93
            ISK +S+++   K + L+EL+ M N + A+ +Y A++
Sbjct: 200 QISKFRSLEVWKNKFKELRELLMMNNPITADALYRAEM 237

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.127    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,835,525
Number of extensions: 287277
Number of successful extensions: 817
Number of sequences better than 10.0: 45
Number of HSP's gapped: 797
Number of HSP's successfully gapped: 50
Length of query: 261
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 161
Effective length of database: 13,134,309
Effective search space: 2114623749
Effective search space used: 2114623749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 60 (27.7 bits)