Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L00803g82781539660.0
Scas_715.465705475813e-65
YIL045W (PIG2)5385345171e-56
YER054C (GIP2)5481844006e-41
CAGL0J02904g5431753911e-39
Scas_704.415821743733e-37
Sklu_2260.63992033211e-31
ADL083C3541863057e-30
Kwal_23.57644621762664e-24
KLLA0F27533g498961571e-10
YOR178C (GAC1)7931101106e-05
CAGL0H04037g915801017e-04
AGR275C679811018e-04
YLR273C (PIG1)648102930.006
Scas_526.491598900.014
Scas_521.1579109850.050
Kwal_56.2326242961820.10
Scas_659.21594109820.12
CAGL0F04917g68280790.25
YLR299W (ECM38)66092780.37
KLLA0D09240g74856686.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L00803g
         (815 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L00803g 98548..101031 some similarities with sp|P40036 Sacc...  1532   0.0  
Scas_715.46                                                           228   3e-65
YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interac...   203   1e-56
YER054C (GIP2) [1483] chr5 complement(262051..263697) Glc7p-inte...   158   6e-41
CAGL0J02904g complement(279516..281147) similar to sp|P40036 Sac...   155   1e-39
Scas_704.41                                                           148   3e-37
Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement       128   1e-31
ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C (...   122   7e-30
Kwal_23.5764                                                          107   4e-24
KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036 Saccha...    65   1e-10
YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulator...    47   6e-05
CAGL0H04037g complement(379169..381916) weakly similar to sp|P28...    44   7e-04
AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C (...    44   8e-04
YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein t...    40   0.006
Scas_526.4                                                             39   0.014
Scas_521.1                                                             37   0.050
Kwal_56.23262                                                          36   0.10 
Scas_659.21                                                            36   0.12 
CAGL0F04917g complement(499132..501180) weakly similar to sp|P28...    35   0.25 
YLR299W (ECM38) [3688] chr12 (726071..728053) Gamma-glutamyltran...    35   0.37 
KLLA0D09240g complement(775848..778094) some similarities with s...    31   6.2  

>CAGL0L00803g 98548..101031 some similarities with sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 or sp|P40187
           Saccharomyces cerevisiae YIL045w PIG2, hypothetical
           start
          Length = 827

 Score = 1532 bits (3966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 751/815 (92%), Positives = 751/815 (92%)

Query: 1   MYIDEEIDSVFVRRLDGDRSSEMXXXXXXXXXXXXXXXXXXXXXXXXXAHNDKPVKQSAV 60
           MYIDEEIDSVFVRRLDGDRSSEM                         AHNDKPVKQSAV
Sbjct: 1   MYIDEEIDSVFVRRLDGDRSSEMKSRSTRRSLKKKKKSNGSTAKSTSSAHNDKPVKQSAV 60

Query: 61  GQQPMAAKANMRSNGTAGKTVVAQDDSKMDAERIHQEATKRFAVIESIRNDKALEAQTPF 120
           GQQPMAAKANMRSNGTAGKTVVAQDDSKMDAERIHQEATKRFAVIESIRNDKALEAQTPF
Sbjct: 61  GQQPMAAKANMRSNGTAGKTVVAQDDSKMDAERIHQEATKRFAVIESIRNDKALEAQTPF 120

Query: 121 TKNFTIHEKLPDHKDNKDVKTTAGSGKSDLVVDTDDHIKTAESMDIRLNNPLLKDSQNSV 180
           TKNFTIHEKLPDHKDNKDVKTTAGSGKSDLVVDTDDHIKTAESMDIRLNNPLLKDSQNSV
Sbjct: 121 TKNFTIHEKLPDHKDNKDVKTTAGSGKSDLVVDTDDHIKTAESMDIRLNNPLLKDSQNSV 180

Query: 181 ENGKAINVESKKNEEPMTILRKHNNQNITENKNDTVPKQKDAMPNVKYSPKVNDTKIETE 240
           ENGKAINVESKKNEEPMTILRKHNNQNITENKNDTVPKQKDAMPNVKYSPKVNDTKIETE
Sbjct: 181 ENGKAINVESKKNEEPMTILRKHNNQNITENKNDTVPKQKDAMPNVKYSPKVNDTKIETE 240

Query: 241 NVLKKNHDTYTQLNSKVAISMENPVEKVPLSLDTYQSQPKIKAETTPDLITGERNIRRTS 300
           NVLKKNHDTYTQLNSKVAISMENPVEKVPLSLDTYQSQPKIKAETTPDLITGERNIRRTS
Sbjct: 241 NVLKKNHDTYTQLNSKVAISMENPVEKVPLSLDTYQSQPKIKAETTPDLITGERNIRRTS 300

Query: 301 NVIGTGKGRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAKILPDDRINDK 360
           NVIGTGKGRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAKILPDDRINDK
Sbjct: 301 NVIGTGKGRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAKILPDDRINDK 360

Query: 361 IDDITTPEEEITGLKHELGKMSIGNGSANSPAINSIKAEEIIELAQDESISPTEHHYPIL 420
           IDDITTPEEEITGLKHELGKMSIGNGSANSPAINSIKAEEIIELAQDESISPTEHHYPIL
Sbjct: 361 IDDITTPEEEITGLKHELGKMSIGNGSANSPAINSIKAEEIIELAQDESISPTEHHYPIL 420

Query: 421 NRANQAQQDVCLPLHDSYDQSPVEDHMMPLPPVYKKSGELVXXXXXXXXXXXPVTPNSNR 480
           NRANQAQQDVCLPLHDSYDQSPVEDHMMPLPPVYKKSGELV           PVTPNSNR
Sbjct: 421 NRANQAQQDVCLPLHDSYDQSPVEDHMMPLPPVYKKSGELVKSSLKRRSKSLPVTPNSNR 480

Query: 481 RTQNSRGVRMNNPRDQLIRSKSVHFDQRLPVKYFFKEESPSVVSIRDEEDDVLSFQHKPL 540
           RTQNSRGVRMNNPRDQLIRSKSVHFDQRLPVKYFFKEESPSVVSIRDEEDDVLSFQHKPL
Sbjct: 481 RTQNSRGVRMNNPRDQLIRSKSVHFDQRLPVKYFFKEESPSVVSIRDEEDDVLSFQHKPL 540

Query: 541 VRSIDRNNGRKKRLDLNRRLEGGFMXXXXXXXXXXXXXXXXXXXXXXXXXXXXRYMDEYD 600
           VRSIDRNNGRKKRLDLNRRLEGGFM                            RYMDEYD
Sbjct: 541 VRSIDRNNGRKKRLDLNRRLEGGFMDDDEDGYPYSYDYDEDDDETTRGGTDLDRYMDEYD 600

Query: 601 YENGFSQGDSIFSRGLKSLMMNDRGSGLKDNFKDPTPPVSQSSTSKKEEKMTTLVSKNFP 660
           YENGFSQGDSIFSRGLKSLMMNDRGSGLKDNFKDPTPPVSQSSTSKKEEKMTTLVSKNFP
Sbjct: 601 YENGFSQGDSIFSRGLKSLMMNDRGSGLKDNFKDPTPPVSQSSTSKKEEKMTTLVSKNFP 660

Query: 661 TLGSKTSKSLKLNIFLNSTSDKKVLLQEVSLNVQKRKSNYYNSNFGGPGIGFSTGRDEDD 720
           TLGSKTSKSLKLNIFLNSTSDKKVLLQEVSLNVQKRKSNYYNSNFGGPGIGFSTGRDEDD
Sbjct: 661 TLGSKTSKSLKLNIFLNSTSDKKVLLQEVSLNVQKRKSNYYNSNFGGPGIGFSTGRDEDD 720

Query: 721 KLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMIDN 780
           KLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMIDN
Sbjct: 721 KLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMIDN 780

Query: 781 TVLSNGQYVSNRSRELEFCIQYTTRSNTAREEYWD 815
           TVLSNGQYVSNRSRELEFCIQYTTRSNTAREEYWD
Sbjct: 781 TVLSNGQYVSNRSRELEFCIQYTTRSNTAREEYWD 815

>Scas_715.46
          Length = 570

 Score =  228 bits (581), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 178/547 (32%), Positives = 261/547 (47%), Gaps = 103/547 (18%)

Query: 300 SNVIG----TGKGRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAKILPDD 355
           +N IG    T    +NS+DFL+KPQRVTQM  + F   EE+KRNTD+NK I +       
Sbjct: 73  TNKIGGERKTSLNSLNSMDFLYKPQRVTQMNVDKF-PEEEVKRNTDLNKNIRLV------ 125

Query: 356 RINDKIDDITTPEEEITGLKHELGKMSIGNGSANSPAINSIKAEEIIELAQDESISPTEH 415
                       +EE TG ++    MS  +    SP  ++I++ E I+            
Sbjct: 126 -----TSGSVAKDEEETGREY----MSPIDLPEISPR-STIQSSEFIQ------------ 163

Query: 416 HYPILNRANQAQQDVCLPLHDSYDQSPVEDHMMPLPPVYKKSGELVXXXXXXXXXXXPVT 475
                   N+ Q+ V     + YD       + PL P+YKKSGEL+           P T
Sbjct: 164 -------NNKTQEGV----DERYDG------ITPLSPIYKKSGELLKSSLKRRSKSLPST 206

Query: 476 PNSNRRTQNSRGVRMNNPRDQLIRSKSVHFDQRLPVKYFFKEESPSVVSIRDEEDDVLSF 535
               +++     +R  N   +++RSKSVHFDQ+ PVKYF ++ESPS V++  E D++L+ 
Sbjct: 207 SEILQKS-----LRFENDAMEMVRSKSVHFDQKAPVKYFREDESPSTVNMMAEFDNLLNL 261

Query: 536 QHKPLVRSIDR------------------NNGRKKRLDLNRRLEGGFMXXXXXXXXXXXX 577
            HKP+ R  +                   N G + +L  ++R +                
Sbjct: 262 MHKPVNRVFEYGDKELAALGLDKVGDTAVNKGAETKLRKSKRFQNVIKDKKKDNDANGNA 321

Query: 578 XXXXXXXXXXXXXXXXRYMDEYDYENGFSQGDSIFSRGLKSLMMNDRGSGLKDNFKDPTP 637
                           +  +E D EN   +     +  LK           K N K  T 
Sbjct: 322 NGNDNDNINDRENNKKKIKNE-DSENEIRRVSDAIADNLKI--------NTKKNNKIVTN 372

Query: 638 PVSQSSTSK--KEEKMTTLVSKNFPTLGSKTSKSLKLNIFLNSTSDKKVLLQEVSLNVQK 695
           P S S         K+  L + NFP L +K  KSLKLNIF+  + DKK  LQEV+L+++K
Sbjct: 373 PYSNSKRMNVITHTKVVGLYNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEK 432

Query: 696 RK-------SNYYNSNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKKVSIRYTWDHW 748
                    +N  NS FG   I   + R      +ITG +LVKNI++DK+V +RYTW+ W
Sbjct: 433 ENPLKRLLPANGSNSEFGQGSIIQRSTR------LITGKILVKNIFYDKRVIVRYTWNDW 486

Query: 749 RSCNEVESMYVGSGNNYLPGSQMDIFRFMIDNTVLSNGQYVSNRSRELEFCIQYTTRSNT 808
           R+ ++VE ++V  G+  +PG+ MD+FRF+ID     +   +  R++ LEFCIQYT R++T
Sbjct: 487 RTVHDVECIWVSDGDGIVPGTNMDVFRFLID-----DANKLEARAK-LEFCIQYTARNDT 540

Query: 809 AREEYWD 815
            R EYWD
Sbjct: 541 ERLEYWD 547

>YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interacts
           with Gsy2p, possible regulatory subunit for the
           PP1-family protein phosphatase Glc7p [1617 bp, 538 aa]
          Length = 538

 Score =  203 bits (517), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 166/534 (31%), Positives = 248/534 (46%), Gaps = 109/534 (20%)

Query: 308 GRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAKILPDDRINDKIDDITTP 367
            R+NSL+FLHKP+R++ +K    +  +EL+RNTDMNK                       
Sbjct: 48  ARLNSLEFLHKPRRLSNVKLHR-LPQDELQRNTDMNK----------------------- 83

Query: 368 EEEITGLKHELGKMSIGNGSANSPAINSIKAEEIIELAQDE-SISPTEHHYPILNRANQA 426
                G+     ++   +   NS A  +   +++ +L ++E  ISP  H           
Sbjct: 84  -----GMYFNGKQVHAHHPFINSGANFNAHHQDVSKLGEEEDEISPLSH----------- 127

Query: 427 QQDVCLPLHDSYDQSPVEDHMMPLPPVYKKSGELVXXXXXXXXXXXPVTPNS--NRRTQN 484
                    D++ Q   E++  P PP+YKKSGELV           P+TP S  N+    
Sbjct: 128 ---------DNF-QYESEENGNPSPPIYKKSGELVKSSLKRRSKSLPITPKSIFNKTGSK 177

Query: 485 SRGVRMNNPRDQLI-RSKSVHFDQRLPVKYFFKEESPSVVSIRDEEDDVLSFQHKPLVRS 543
           S+ V +++   +L+ RSKSVHFD+ LP+K F + E P  V  +  + DVL+F+HKPL R 
Sbjct: 178 SKHVNLDHVDTRLLQRSKSVHFDRVLPIKLFNENEKPIDVGKQMVQQDVLNFKHKPLTRL 237

Query: 544 IDRNNGR-----KKRLDLNRRLEGGFMXXXXXXXXXXXXXXXXXXXXXXXXXXXXRYMDE 598
              N G      +  L  N + E G                                 D+
Sbjct: 238 SALNGGSDSVPIEDLLSENNQNEYGDTWLQNPKGVFLFGTNSNNRRNKKKKFKLSD--DD 295

Query: 599 YDYENGFSQGDSI-------------FSRGLKSLMMNDRGSGLKDNFKDPTPPVSQSSTS 645
            D EN     D+I              + GLK+L++ND      D++ +     ++S  +
Sbjct: 296 SDIENDNDSDDAINRLVRQQDKDQAHLAHGLKNLLIND-----DDDYLETRTNSAKSGAN 350

Query: 646 ---KKEEKMTTLVSKNFPTLGSKTSKSLKLNIFLNSTSDKKVLLQEVSLNVQKRKSNYYN 702
                 +++  L +KNFP L  +  KSLKLNIFLN +  + V LQE++L      + ++N
Sbjct: 351 LFIGNSKRIVGLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITL-----LTGFHN 405

Query: 703 SNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSG 762
                              ++I G V VKNIYFDKK+ +RYTWD WR+ +E E +Y  + 
Sbjct: 406 -------------------MVIIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNA 446

Query: 763 NNYLPGSQMDIFRFMIDNTVLSNGQYVSNRSRELEFCIQYTTRS-NTAREEYWD 815
           N  LPGS MDIF+F ID+  + N     +   +LEFCIQY T   + +R+EYWD
Sbjct: 447 NGILPGSNMDIFKFSIDD--IHNPNDKDSNISQLEFCIQYLTWGVDRSRKEYWD 498

>YER054C (GIP2) [1483] chr5 complement(262051..263697)
           Glc7p-interacting protein, possible regulatory subunit
           for the PP1 family protein phosphatase Glc7p [1647 bp,
           548 aa]
          Length = 548

 Score =  158 bits (400), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 114/184 (61%), Gaps = 17/184 (9%)

Query: 642 SSTSKKEEKMTTLVSKNFPTLGSKTSKSLKLNIFLNSTSDKKVLLQEVSLNVQKRKSNYY 701
           S  + K   +  L SKNFP L +K  KSLKLNIF+N + +KKV LQE+SL +  R +NY+
Sbjct: 348 SDRNSKNYHVVGLYSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQELSLYIH-RDNNYF 406

Query: 702 ----------NSNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKKVSIRYTWDHWRSC 751
                     NS+ G    G + G +     +I G +LVKNI++DK+V +RYTWD WR+ 
Sbjct: 407 SNSSSFYNIPNSHNGNDCNGVAKGYNAGCTRLIAGRILVKNIFYDKRVVVRYTWDSWRTT 466

Query: 752 NEVESMYVGSGNNYLPGSQMDIFRFMIDNTVLSNGQYVSNRSRELEFCIQYTTRSNTARE 811
           +EVE +Y+  G+  LPG+ MDIF F+ID+        V  R + LEFCI Y+TR++  RE
Sbjct: 467 HEVECVYISDGDGILPGTNMDIFHFIIDDV-----SKVDPRGK-LEFCIHYSTRNDYERE 520

Query: 812 EYWD 815
           EYWD
Sbjct: 521 EYWD 524

 Score =  120 bits (302), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 138/271 (50%), Gaps = 36/271 (13%)

Query: 282 KAETTPDLITGERNIRRTSNVI-----GTGKGRINSLDFLHKPQRVTQMKSEDFISPEEL 336
           K +  PDL T  +  R  S++      G+ +  +NSL FLHKPQRVTQM++  F   EE+
Sbjct: 23  KNQQLPDLETDFKGYRVNSDLYNKERDGSTEETLNSLKFLHKPQRVTQMRANRFPE-EEV 81

Query: 337 KRNTDMNKQILMAKILPDDRINDKIDDITTPEEEITGLKHELGKMSIGNGSANSPAINSI 396
           +RNTD+NK+I  A        ND+  D  +   +I   K+     S+ NGS   P     
Sbjct: 82  QRNTDLNKRIFSAG-------NDENVDNESGWSKIAAAKNHTSVESL-NGSTRPPF---- 129

Query: 397 KAEEIIELAQDESISPT-EHHYPILNRANQAQQDVCLPLHDSYDQSPVEDHMMPL-PPVY 454
              E+  L+   ++  + +  YP    A     D+       YD    E+ ++P  PPVY
Sbjct: 130 -KIELPPLSPKSTVPKSFQAEYP---EAKSPGNDMNF----EYD----EEILIPFAPPVY 177

Query: 455 KKSGELVXXXXXXXXXXXPVTPNSNRRTQNSRGVRMNNPRDQLIRSKSVHFDQRLPVKYF 514
           KKSGEL+           P TP      ++  GV+  +    LIRSKSVHFDQ  PVKYF
Sbjct: 178 KKSGELLKSSLKRRSKSLPTTPG----IRSGNGVQARDGSPMLIRSKSVHFDQAAPVKYF 233

Query: 515 FKEESPSVVSIRDEEDDVLSFQHKPLVRSID 545
            ++ESP  V+  ++ D+ LSF+HKP+   +D
Sbjct: 234 AEDESPINVNKTEQHDNCLSFKHKPVNLMVD 264

>CAGL0J02904g complement(279516..281147) similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2, hypothetical
           start
          Length = 543

 Score =  155 bits (391), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 113/175 (64%), Gaps = 14/175 (8%)

Query: 642 SSTSKKEEKMTTLVSKNFPTLGSKTSKSLKLNIFLNSTSDKKVLLQEVSLNVQKRKSNYY 701
           S + K+++++  L ++NFP L +K  KSLKLNIF+N +  K+V LQE+SL++ + ++ Y 
Sbjct: 357 SYSGKQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRERAFY- 415

Query: 702 NSNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGS 761
                 PG G   G   + +L+ +G VLVKNI+FDK+V IRYTWD WR+  +VE ++V S
Sbjct: 416 -----SPGSGVDIGTPINTRLL-SGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSS 469

Query: 762 GNNYLP-GSQMDIFRFMIDNTVLSNGQYVSNRSRELEFCIQYTTRSNTAREEYWD 815
               +P G+ MD+F F+ID+     G+        LEFCIQYTTR +T R E+WD
Sbjct: 470 AQGLVPGGAAMDVFHFVIDDATKWEGK------ASLEFCIQYTTRDDTQRLEFWD 518

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 102/231 (44%), Gaps = 50/231 (21%)

Query: 298 RTSNVIGTGKGRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAKILPDDRI 357
           + +  I  G G++ SL FLHKPQRV+Q+  + F   EEL RNT +NK +           
Sbjct: 28  KMNGAIVGGSGKLTSLQFLHKPQRVSQLNKDRF-PEEELLRNTQLNKNL----------- 75

Query: 358 NDKIDDITTPEEEITGLKHELGKMSIGNGSANSPAINSIKAEEIIELAQDESISPTEHHY 417
             ++D             +       G+G A+             + A+D+ I       
Sbjct: 76  -HQVDS-----------NYREYSQGPGDGGASER-----------QQARDDLI------- 105

Query: 418 PILNRANQAQQDVCLPLHDSYDQSPVEDHMMPL-PPVYKKSGELVXXXXXXXXXXXPVTP 476
           P+  ++   + D  + L ++ D     + + P  PPVYKKSGE V           P TP
Sbjct: 106 PLSPKSTLPELDTNM-LDNTLDSDNSSNDLAPFSPPVYKKSGEPVKSVLKRRSKSLPGTP 164

Query: 477 NSNRRTQNSRGVRMNNPRDQLIRSKSVHFDQRLPVKYFFKEESPSVVSIRD 527
             N     +      +P ++L+RSKSVHFDQ  PV+YF + E P  VS  D
Sbjct: 165 GLNTSMHGA------SPPNKLMRSKSVHFDQTAPVRYFNENERPIDVSNAD 209

>Scas_704.41
          Length = 582

 Score =  148 bits (373), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 113/174 (64%), Gaps = 18/174 (10%)

Query: 642 SSTSKKEEKMTTLVSKNFPTLGSKTSKSLKLNIFLNSTSDKKVLLQEVSLNVQKRKSNYY 701
           ++T   E+ +  L SKNFPTL +K  +SLKLNIF+N +  KKV LQ+++L++Q   ++Y 
Sbjct: 402 TTTLTSEKSVIGLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQ---NDYI 458

Query: 702 NSNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGS 761
           N++ G          ++ +K II G  LV+NIYFDKKV ++YTWD+WRS  ++E++YV  
Sbjct: 459 NNHVGN--------NNKQNKYII-GRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSD 509

Query: 762 GNNYLPGSQMDIFRFMIDNTVLSNGQYVSNRSRELEFCIQYTTRSNTAREEYWD 815
               +PGS MD+F+F+ID+   S  +        LEFCIQY TR+   R+E+WD
Sbjct: 510 AKQIIPGSNMDVFKFLIDDVNKSVSKC------HLEFCIQYQTRNEKERKEFWD 557

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 122/262 (46%), Gaps = 54/262 (20%)

Query: 291 TGERNIRRTSNVIGTGKGRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAK 350
           T  + I   ++ +G+     +SL+FL +P+++ Q+K  + +  EEL+RNT++NK I    
Sbjct: 78  TMHKRIFPANDTLGSSTKPFSSLNFLQEPRKLDQLKL-NALPQEELRRNTNLNKNI---- 132

Query: 351 ILPDDRINDKIDDITTPEEEITGLKHELGKMSIGNGSANSPAINSIKAEEIIELAQDE-S 409
                      + I TP      +K  + K        NS  +N    +   E  ++E  
Sbjct: 133 -----------NPIPTP------IKPTIYK--------NSYYLNDNDTDAFKEEQENEDE 167

Query: 410 ISPTEHHYPILNRANQAQQDVCLPLHDSYDQSPVEDHMMP----LPPVYKKSGELVXXXX 465
           ISP            Q   +  +P        PV ++       + PVYKKSGEL+    
Sbjct: 168 ISPIT----------QVPANAKIPF-------PVPNNAYMEVNRIKPVYKKSGELLKPSL 210

Query: 466 XXXXXXXPVTPN-SNRRTQNSRGVRMNNPR-DQLIRSKSVHFDQRLPVKYFFKEESPSVV 523
                  PVTPN SN   +   G    N R   L RSKSVHF   LPV++F K+ESP +V
Sbjct: 211 KRRSQSLPVTPNISNLNLRRINGHANGNDRAHHLARSKSVHFANTLPVRFFSKDESPIIV 270

Query: 524 SIRDEEDDVLSFQHKPLVRSID 545
           +   E  + L+F+HKPL RS+D
Sbjct: 271 AESHEITNELNFKHKPLQRSMD 292

>Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement
          Length = 399

 Score =  128 bits (321), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 109/203 (53%), Gaps = 43/203 (21%)

Query: 619 LMMNDRGSGLKDNFKDPTPPVSQSSTSKKEEKMTTLVSKNFPTLGSKTSKSLKLNIFLNS 678
           +MMN  GSG       P+P  + S +S     +  L +KNFP L +K   SLKLNIFLN 
Sbjct: 207 MMMN--GSG-------PSPATTASGSSMPP--VPGLYNKNFPILSNKNPTSLKLNIFLNI 255

Query: 679 TSDKKVLLQEVSLNVQKRKSNYYNSNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKK 738
              K+V LQ++SL                  +G        D   + G VLVKNI +DK+
Sbjct: 256 AHGKQVFLQDLSL------------------LG--------DGNYVVGKVLVKNICYDKQ 289

Query: 739 VSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMIDNTVLSNGQYVSNR------ 792
           V +RYTWD W + ++V+ ++  SG+  LPG  MD+F+F++D  V S    ++        
Sbjct: 290 VIVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFKFVVDVPVDSAEATLATTDPDKEG 349

Query: 793 SRELEFCIQYTTRSNTAREEYWD 815
            RE++FCI+YTTR    REE+WD
Sbjct: 350 GREVQFCIRYTTRDGNYREEHWD 372

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 52/103 (50%), Gaps = 10/103 (9%)

Query: 442 PVEDHMMPLPPVYKKSGELVXXXXXXX--XXXXPVTPNSNRRTQNSRGVRMNNPRDQLIR 499
           P  D   P  P+ KKSGELV             P TP    R   +  + M  P+    R
Sbjct: 84  PDVDEYYPPKPIRKKSGELVKSSLKQHHRSKSLPATPTG--REPRTEIIIMEPPK----R 137

Query: 500 SKSVHFDQR--LPVKYFFKEESPSVVSIRDEEDDVLSFQHKPL 540
           SKSVHFDQR  + VKYF K+E P  V+ R+ E+D LSF  K L
Sbjct: 138 SKSVHFDQRDVVSVKYFQKDERPVEVAQREVEEDQLSFTPKQL 180

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (71%), Gaps = 4/46 (8%)

Query: 299 TSNVIGTGKGRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNK 344
           T+N  G  K R  SLDFLHKPQRVTQ+K+    + + L+RNT++N+
Sbjct: 7   TNNYSGENKPR--SLDFLHKPQRVTQLKT--LYAEDSLQRNTNLNR 48

>ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C
           (GIP2) - SH] (537421..538485) [1065 bp, 354 aa]
          Length = 354

 Score =  122 bits (305), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 98/186 (52%), Gaps = 36/186 (19%)

Query: 633 KDPTPPVSQSSTSKKEE---KMTTLVSKNFPTLGSKTSKSLKLNIFLNSTSDKKVLLQEV 689
           K P  P+ +S   ++ +   ++ TL + NFP L +K    L LNIFLN   ++KV LQ++
Sbjct: 190 KSPRKPLRKSKCFRQYQLRPQLRTLRNVNFPILANKDPAVLTLNIFLNIAYNRKVFLQDL 249

Query: 690 SLNVQKRKSNYYNSNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKKVSIRYTWDHWR 749
           SL                           D  L++TG VLVKNI++DK V +RYTWD+W 
Sbjct: 250 SL---------------------------DSMLVMTGRVLVKNIHYDKSVIVRYTWDNWA 282

Query: 750 SCNEVESMYVGSGNNYLPGSQMDIFRFMIDNTVLSNGQYVSNRSRELEFCIQYTTRSNTA 809
             ++  S+++ SGN  LPG  MD+F F ID     +G      +  LEFCI+Y  R N+ 
Sbjct: 283 HTSDTASVWISSGNAVLPGKDMDLFEFAIDVPAPVSG------TPRLEFCIRYQVRDNSD 336

Query: 810 REEYWD 815
            + +WD
Sbjct: 337 FQTHWD 342

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 499 RSKSVHFDQR--LPVKYFFKEESPSVVSIRDEEDDVLSFQH 537
           RSKSVHFD R  + VKYF  +ES  +V+     +D L  + 
Sbjct: 126 RSKSVHFDNRDVVSVKYFNSDESTLLVAHAQSFEDQLRLRQ 166

>Kwal_23.5764
          Length = 462

 Score =  107 bits (266), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 83/176 (47%), Gaps = 40/176 (22%)

Query: 654 LVSKNFPTLGSKTSKSLKLNIFLNSTSDKKVLLQEVSLNVQKRKSNYYNSNFGGPGIGFS 713
           L   NF TL      SLK NIFLN   +    LQE+SL                  IG  
Sbjct: 285 LYHANFATLADDDQCSLKSNIFLNIAHNSSCFLQELSL------------------IG-- 324

Query: 714 TGRDEDDKLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDI 773
                 D+  + G VLVKN+Y++K V +RYT D WR+  ++E ++  SG++ LPG  MD 
Sbjct: 325 ------DQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDR 378

Query: 774 FRFMIDNTVL--------------SNGQYVSNRSRELEFCIQYTTRSNTAREEYWD 815
           F+ +ID   L              S G      +  L+FCIQY +R   +R EYWD
Sbjct: 379 FKLVIDLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVEYWD 434

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 95/230 (41%), Gaps = 58/230 (25%)

Query: 312 SLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAKILPDDRI--NDKIDDIT--TP 367
           SL FLHKPQRVTQ ++    + E L+RNTDMN+  +  +  P+D    N K D  T  T 
Sbjct: 23  SLAFLHKPQRVTQPRA--LYADEWLRRNTDMNRGNVKVENCPEDYFSQNFKGDGPTKQTA 80

Query: 368 EEEITGLKHELGKMSIGNGSANSPAINSIKAEEIIELAQDESISPTEHHYPILNRANQAQ 427
             E  G        S G                       ++ SP         R N   
Sbjct: 81  ASEANGFDPSASNASAG-----------------------DTASPL--------RVN--- 106

Query: 428 QDVCLPLHDSYDQSPVEDHMMPLPPVYKKSGELV--XXXXXXXXXXXPVTPNSNRRTQNS 485
                P   + + S V D   P P V KKSGE+V             P TP+     +  
Sbjct: 107 -----PYFPAEEDSVVADAAAP-PLVRKKSGEVVRPSLKMAQRSRSLPATPSDREPDKRL 160

Query: 486 RGVRMNNPRDQLIRSKSVHFDQR--LPVKYFFKEESPSVVSIRDEEDDVL 533
            G     P+    RSKSVHFDQR  +  KYF++E+SP  V+    E DVL
Sbjct: 161 GGPPAAGPK----RSKSVHFDQRDVVKFKYFWQEDSPLDVA----EQDVL 202

>KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 GLC7P-interacting
           protein, hypothetical start
          Length = 498

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 56/96 (58%), Gaps = 10/96 (10%)

Query: 723 IITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGS---QMDIFRFMID 779
           ++ G V+V+NI ++K+V +RYT D W+S  +VES+++ +  N   G+    +D+F+F ID
Sbjct: 396 MLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAID 455

Query: 780 NTVLSNGQYVSNRSRELEFCIQYTTRSNTAREEYWD 815
              +       N    +E CI Y TR  ++  ++WD
Sbjct: 456 LGKI-------NTIEHIEMCILYQTREGSSWIDHWD 484

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 5/60 (8%)

Query: 308 GRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAKILPDDRINDKIDDITTP 367
           G+ +SL+FL KPQR++  + E     + LKRNTD+NK    +KI+ D  + D   D   P
Sbjct: 13  GKFSSLNFLRKPQRIS-CQVETTAMNDALKRNTDLNK----SKIIVDKSLQDSQHDEHDP 67

>YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulatory
           subunit for protein serine/threonine phosphatase Glc7p
           [2382 bp, 793 aa]
          Length = 793

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 25/110 (22%)

Query: 719 DDKLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMI 778
           DD   ITG V VKN+ F+K + I++T++ WR  +     YV +  N    S +D F+F I
Sbjct: 253 DDSSKITGLVYVKNLSFEKYLEIKFTFNSWRDIH-----YVTANFNRTINSNVDEFKFTI 307

Query: 779 DNTVLSNGQYV-------------SNRSRELEFCIQYTTRSNTAREEYWD 815
           D   L++ +Y+             S+    +E C +Y    +   E Y+D
Sbjct: 308 D---LNSLKYILLIKRIITMEKNTSSCPLNIELCCRY----DVNNETYYD 350

>CAGL0H04037g complement(379169..381916) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 915

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 47/80 (58%), Gaps = 10/80 (12%)

Query: 719 DDKLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMI 778
           DDK++  G +LVKN+ ++K + ++YT+++W   + + + +  S       +++D F F I
Sbjct: 295 DDKIV--GKILVKNLNYEKFIEVKYTFNNWNDIHYITAYFTKSI-----SAEIDEFEFKI 347

Query: 779 DNTVLSNGQYVSNRSRELEF 798
           +   LS+ +Y+    R L+F
Sbjct: 348 N---LSSLKYILQFKRILQF 364

>AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C
           (PIG1) - SH] (1254768..1256807) [2040 bp, 679 aa]
          Length = 679

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 49/81 (60%), Gaps = 9/81 (11%)

Query: 720 DKLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMID 779
           D   I G++ V N++F+K + +++++D W++ + V + Y+ +       S++D F+F+ID
Sbjct: 282 DMHTIKGSLYVTNLHFEKFIEVKFSFDEWKNIHYVTAQYLKTVT-----SKVDEFQFIID 336

Query: 780 NTVLSNGQYVSNRSRELEFCI 800
              LS+ +Y   + + L +C+
Sbjct: 337 ---LSSYKYFM-KVKNLLYCV 353

>YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein that
           interacts with Gsy2p, possible regulatory subunit for
           the PP1 family protein phosphatase Glc7p [1947 bp, 648
           aa]
          Length = 648

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 17/102 (16%)

Query: 724 ITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMID---- 779
           I G + V N+ F+KK+ I++T ++W      +  Y+ +  N      +D F+F+ID    
Sbjct: 224 IWGLIFVNNLNFEKKIEIKFTLNNW-----ADIHYINAHYNKSVTPHVDEFKFIIDISAL 278

Query: 780 --NTVLSNGQYVSNRSRE------LEFCIQYTTRSNTAREEY 813
             N +  N  Y +   R+      L+FC +Y       R  Y
Sbjct: 279 KLNLISKNLIYTNFFERKTTCLLNLQFCCRYDVNGFEYRSFY 320

>Scas_526.4
          Length = 915

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 13/98 (13%)

Query: 713 STGRDEDDKLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMD 772
           S  +D ++   + G + V N+ F+K + I+++++HW+  +     YV +  N    S +D
Sbjct: 297 SLNQDSNNSSKLIGLIYVNNLNFEKFIEIKFSFNHWKDIH-----YVTAFLNKSVTSNID 351

Query: 773 IFRFMIDNTVLSNGQYVSN--------RSRELEFCIQY 802
            F+F+ID   L     V N         +  +E C +Y
Sbjct: 352 EFKFVIDLNSLKFFLQVKNLLSSKLPKNNLNMELCCRY 389

>Scas_521.1
          Length = 579

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 19/109 (17%)

Query: 707 GPGIGFSTGRDEDD--KLIITGTVLVKNIYFDKKVSIRYTWDHWRS-CNEVESMYVGSGN 763
           G  I   + + E+D     + G +LV NI F+K + +++T+++W + C +V   Y     
Sbjct: 186 GQNIKLYSLKSENDGQAFKLVGLILVNNIQFEKNIEVKFTFNNWENICYQV--AYFNRSL 243

Query: 764 NYLPGSQMDIFRFMIDNT----------VLSNGQYVSNRSRELEFCIQY 802
           N    ++ D F+F ID T          +L     V++    +E C +Y
Sbjct: 244 N----AKFDEFKFTIDLTSFKSLLKLQKILYTKDPVTHCPINIEMCCRY 288

>Kwal_56.23262
          Length = 429

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 724 ITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMIDNTVL 783
           + G + V N+ F+K + I++T+++WR     +  YV + ++      +D F+F ID   L
Sbjct: 36  LQGLIYVANLNFEKSLEIKFTFNNWR-----DVHYVAAHHHRSITDAIDEFKFTIDLAGL 90

Query: 784 S 784
           S
Sbjct: 91  S 91

>Scas_659.21
          Length = 594

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 50/109 (45%), Gaps = 19/109 (17%)

Query: 707 GPGIGFSTGRDEDD--KLIITGTVLVKNIYFDKKVSIRYTWDHWRS-CNEVESMYVGSGN 763
           G  I   + + E+D     + G +LV NI F+K + +++T+++W + C +V   Y     
Sbjct: 204 GQNIKLYSLKSENDGQAFKLVGLILVNNIQFEKNIEVKFTFNNWENICYQV--AYFNRSL 261

Query: 764 NYLPGSQMDIFRFMIDNT----------VLSNGQYVSNRSRELEFCIQY 802
           N     + D F+F ID T          +L     V++    +E C +Y
Sbjct: 262 N----VKFDEFKFTIDLTSFKSLLKLQKILYTKDPVTHCPINIEMCCRY 306

>CAGL0F04917g complement(499132..501180) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 682

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 43/80 (53%), Gaps = 9/80 (11%)

Query: 724 ITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMIDNTVL 783
           + G + V N+ F+K + +++++++W+  +   + Y  S  +++     D FRF ID    
Sbjct: 192 LKGLIYVNNLNFEKFIEVKFSFNNWKDIHYATATYNKSITDHI-----DEFRFTIDVMTF 246

Query: 784 SNGQYVSNRSRELEFCIQYT 803
              +Y+  +S+ L +C  Y+
Sbjct: 247 ---KYIL-KSKGLIYCDSYS 262

>YLR299W (ECM38) [3688] chr12 (726071..728053)
           Gamma-glutamyltransferase involved in glutathione
           metabolism [1983 bp, 660 aa]
          Length = 660

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 17/92 (18%)

Query: 689 VSLNVQKRKSNYYNSNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKKV---SIRYTW 745
           V+  + K   N++NS  GG G    +G+D++D L         +I F +K    S ++ +
Sbjct: 139 VTQALCKGMVNFFNSGIGGGGYVVFSGKDDEDHL---------SIDFREKAPMDSHKFMF 189

Query: 746 DHWRSCNEVESMYVGSGNNYLPGSQMDIFRFM 777
           ++   C+++  + VG     +PG  M ++R  
Sbjct: 190 ENCSLCSKIGGLAVG-----VPGELMGLYRLF 216

>KLLA0D09240g complement(775848..778094) some similarities with
           sp|P28006 Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, regulatory chain,
           hypothetical start
          Length = 748

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 724 ITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMID 779
           +TG + V N+ F+K + I+++++ W+  +     YV +         +D F+F+I+
Sbjct: 472 LTGLIYVNNLSFEKFIEIKFSFNGWKDIH-----YVTANFKRTITDTVDEFQFLIN 522

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.129    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,983,128
Number of extensions: 1254160
Number of successful extensions: 4284
Number of sequences better than 10.0: 195
Number of HSP's gapped: 4429
Number of HSP's successfully gapped: 215
Length of query: 815
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 705
Effective length of database: 12,788,129
Effective search space: 9015630945
Effective search space used: 9015630945
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)