Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L00781g67366234970.0
YIL046W (MET30)64061822010.0
Scas_704.4060863021430.0
Kwal_23.576962765319620.0
KLLA0F27511g62366218970.0
ADL082C56960018450.0
YCR072C5153702992e-28
AER263C5133222878e-27
Sklu_2173.25153752799e-26
Scas_720.955153732781e-25
Kwal_23.63245143662638e-24
CAGL0J03476g5173612638e-24
KLLA0C08547g5153642621e-23
Scas_721.115*3182102452e-22
KLLA0D07546g6474302542e-22
Scas_592.4*3183142452e-22
AFR199C3341922401e-21
Kwal_26.87764332002441e-21
YMR116C (ASC1)3192112372e-21
Kwal_23.50357443362453e-21
CAGL0H03729g3032982327e-21
ACR137W4252672342e-20
YFL009W (CDC4)7793772392e-20
CAGL0L02629g7953742364e-20
YPL151C (PRP46)4512842315e-20
AEL246C8152892346e-20
KLLA0F11231g4342952306e-20
Sklu_2420.24411582299e-20
YJL112W (MDV1)7142532321e-19
Scas_695.153272982241e-19
Scas_624.1112052762312e-19
ADR077C12042842312e-19
Scas_707.227303792293e-19
Kwal_27.126677212752274e-19
CAGL0G04345g7112562212e-18
Scas_721.328223092212e-18
KLLA0E23529g8262912213e-18
CAGL0I03718g12012792223e-18
YGL137W (SEC27)8892852213e-18
YDL145C (COP1)12012842213e-18
Kwal_26.75702181472063e-18
YBR198C (TAF5)7982932194e-18
KLLA0E12287g3262002124e-18
AEL314W7152422194e-18
AGL024W7563332186e-18
Scas_711.116953412177e-18
CAGL0M05335g8062982168e-18
Kwal_56.2452612102842161e-17
KLLA0D04840g3033112062e-17
CAGL0H08932g9022822142e-17
YNL006W (LST8)3033012052e-17
KLLA0F04884g12122842142e-17
Kwal_0.2123033092034e-17
Sklu_2431.127492532114e-17
CAGL0D02090g2771492015e-17
CAGL0M02277g4272712057e-17
Scas_630.66212502061e-16
Scas_603.55892362042e-16
Sklu_2442.23032981963e-16
AGL234W6293102024e-16
KLLA0F10263g6822302024e-16
Kwal_27.120537552992007e-16
AAL009C3032941938e-16
AFL118W8322792009e-16
Scas_629.126712861999e-16
Kwal_23.64297502861944e-15
KLLA0B01958g8901661901e-14
CAGL0E00561g8362981892e-14
CAGL0C02937g4672161872e-14
KLLA0F21406g7053421864e-14
AER448W7141771845e-14
YKR036C (CAF4)659961838e-14
Kwal_33.155917141591839e-14
CAGL0C03608g6433141829e-14
AGL196C9352011821e-13
Scas_558.37251651802e-13
Sklu_2160.37601651783e-13
YCR084C (TUP1)7132981765e-13
YKL213C (DOA1)7151581741e-12
YLR129W (DIP2)9431821731e-12
YCR057C (PWP2)9231611722e-12
YOR269W (PAC1)4943031712e-12
Scas_713.509831821722e-12
CAGL0C00737g8161931712e-12
AGR180W8063101703e-12
AAR057W9221821703e-12
Kwal_23.53514742381683e-12
CAGL0A02772g4411781674e-12
CAGL0M04279g9401821685e-12
CAGL0K00275g7151581676e-12
KLLA0C07425g4443071666e-12
CAGL0L03201g5792751667e-12
YLR222C (UTP13)8171151678e-12
Scas_720.83d9151601651e-11
KLLA0E24508g3271611611e-11
Scas_631.174741801632e-11
Kwal_27.115858231351642e-11
Scas_679.288151211623e-11
Kwal_23.62409132011623e-11
AEL269C4552611594e-11
KLLA0D16390g9361431597e-11
Scas_658.14421721568e-11
Sklu_2172.62631161529e-11
Kwal_26.89754453321561e-10
CAGL0K09284g9111601571e-10
Sklu_2318.17112781542e-10
Scas_721.73251291512e-10
Sklu_1880.34711791532e-10
YDR364C (CDC40)4551791532e-10
KLLA0E07073g4521531523e-10
Kwal_56.239209371731543e-10
CAGL0L10890g4573341523e-10
Kwal_26.89534583041514e-10
YBR175W (SWD3)3151281494e-10
KLLA0C08976g9111941534e-10
AGR207C3201631485e-10
ADL184W4491641505e-10
ADR176W4613171505e-10
KLLA0E07942g3901371487e-10
YKL021C (MAK11)4681361489e-10
KLLA0E21263g4292041471e-09
CAGL0G09845g5002801462e-09
AER337W4453081462e-09
CAGL0M06193g3161311432e-09
Kwal_55.220674511721452e-09
KLLA0B14410g7061561462e-09
CAGL0M04081g4551651452e-09
AER255C4671741443e-09
CAGL0F06853g3881301415e-09
Scas_685.113841381408e-09
Scas_692.254882001409e-09
Kwal_55.215593511741389e-09
KLLA0F13244g8141871411e-08
YPR178W (PRP4)4652511391e-08
Scas_717.689082861391e-08
ACR091W3281541352e-08
Kwal_56.241637291281373e-08
Sklu_1963.23141581343e-08
Scas_720.457551341373e-08
CAGL0M08646g3371581343e-08
ADL322C5011981363e-08
Kwal_27.122393161401343e-08
KLLA0E21879g3331591343e-08
Sklu_2416.54591721353e-08
KLLA0E18986g9901311356e-08
KLLA0C07513g4392061327e-08
YGL004C (RPN14)4171171327e-08
ACR166W3881371318e-08
Kwal_14.8843951631319e-08
YOR272W (YTM1)4603471329e-08
YNL317W (PFS2)4651491311e-07
Scas_700.27*4332931311e-07
Scas_692.294563381301e-07
Scas_659.94752941302e-07
KLLA0F16038g8621051283e-07
Scas_585.84601611264e-07
KLLA0E04741g4591731264e-07
Kwal_55.214505031771255e-07
Kwal_33.151364733171247e-07
Sklu_2430.9966771222e-06
AAL157C4793011202e-06
AFL056C976971212e-06
KLLA0D02530g7071431203e-06
YMR146C (TIF34)347911183e-06
CAGL0G03399g3691371183e-06
KLLA0F22000g7932541194e-06
Scas_721.1288512311194e-06
ABL024W7341941185e-06
CAGL0K12188g5351961185e-06
CAGL0A00561g412741166e-06
YLR429W (CRN1)6512001176e-06
KLLA0F15598g4783161167e-06
Kwal_26.86284222601167e-06
AER114W6331801177e-06
Kwal_26.76557431071177e-06
Sklu_2291.4997911178e-06
AFL009C413841158e-06
YDR267C3301941149e-06
Kwal_34.158183492611149e-06
Scas_571.46011411141e-05
CAGL0L02761g4192561131e-05
Scas_719.526282191142e-05
YMR102C8342271142e-05
YBR103W (SIF2)5352281132e-05
KLLA0B12804g852771132e-05
KLLA0A08866g423731122e-05
CAGL0L06952g347901103e-05
Scas_615.113491691103e-05
Scas_660.7*6031351113e-05
CAGL0J06512g545891113e-05
CAGL0C01441g10051571113e-05
Sklu_2423.19441151113e-05
ACR097W467701104e-05
CAGL0K03377g978791114e-05
Kwal_27.107853671291094e-05
YOR212W (STE4)4232511094e-05
Kwal_47.175554171891095e-05
Scas_680.11347901076e-05
ADR264C346761077e-05
CAGL0D05588g477851087e-05
YLL011W (SOF1)4893181077e-05
Kwal_27.11126996561088e-05
AGL301C361961078e-05
CAGL0J10340g3381701068e-05
Kwal_27.10385536711071e-04
Kwal_33.154757831481071e-04
Sklu_2364.45551501071e-04
CAGL0M09845g936571071e-04
Kwal_27.125865091311061e-04
AGR168W8251441061e-04
YGL003C (CDH1)5661251052e-04
KLLA0E11297g512901052e-04
Sklu_675.13081021022e-04
CAGL0A00605g6401251042e-04
YER066W185120992e-04
Scas_605.18424731032e-04
Scas_397.2410861033e-04
Scas_465.41002901033e-04
CAGL0J04818g6541781023e-04
AER081C1023611024e-04
Kwal_47.175675901251015e-04
Sklu_2332.7367127996e-04
YPL183C1013951006e-04
Scas_512.3534731007e-04
Scas_510.5362122997e-04
Kwal_23.4118939691007e-04
ACR017W423164989e-04
YER107C (GLE2)365135980.001
Sklu_1926.550998980.001
CAGL0K00957g793172980.001
Kwal_56.24399369199970.001
YLR409C (UTP21)939145980.001
Sklu_1659.261390970.001
Scas_718.6*54699970.001
Sklu_2364.241187960.002
KLLA0D06787g436267960.002
Scas_702.16816155960.002
AFL007C551125950.002
KLLA0A08822g582123950.002
Sklu_1870.2569206950.003
Kwal_33.13515398162930.003
YGL116W (CDC20)610165940.003
Scas_719.30940105940.003
KLLA0E20779g37196930.004
Scas_670.21595125930.004
Kwal_55.21144570288920.006
KLLA0F06754g344150900.007
Kwal_47.17465800128910.008
Sklu_2435.13575225910.008
Sklu_2406.1142669900.009
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L00781g
         (662 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...  1351   0.0  
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...   852   0.0  
Scas_704.40                                                           830   0.0  
Kwal_23.5769                                                          760   0.0  
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...   735   0.0  
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...   715   0.0  
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...   119   2e-28
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...   115   8e-27
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                           112   9e-26
Scas_720.95                                                           111   1e-25
Kwal_23.6324                                                          105   8e-24
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...   105   8e-24
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...   105   1e-23
Scas_721.115*                                                          99   2e-22
KLLA0D07546g complement(647984..649927) some similarities with s...   102   2e-22
Scas_592.4*                                                            99   2e-22
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    97   1e-21
Kwal_26.8776                                                           99   1e-21
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    96   2e-21
Kwal_23.5035                                                           99   3e-21
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    94   7e-21
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    95   2e-20
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    97   2e-20
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    96   4e-20
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    94   5e-20
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    95   6e-20
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    93   6e-20
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            93   9e-20
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    94   1e-19
Scas_695.15                                                            91   1e-19
Scas_624.11                                                            94   2e-19
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    94   2e-19
Scas_707.22                                                            93   3e-19
Kwal_27.12667                                                          92   4e-19
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    90   2e-18
Scas_721.32                                                            90   2e-18
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    90   3e-18
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    90   3e-18
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    90   3e-18
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    90   3e-18
Kwal_26.7570                                                           84   3e-18
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    89   4e-18
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    86   4e-18
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    89   4e-18
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    89   6e-18
Scas_711.11                                                            88   7e-18
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    88   8e-18
Kwal_56.24526                                                          88   1e-17
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    84   2e-17
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    87   2e-17
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    84   2e-17
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    87   2e-17
Kwal_0.212                                                             83   4e-17
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      86   4e-17
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    82   5e-17
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    84   7e-17
Scas_630.6                                                             84   1e-16
Scas_603.5                                                             83   2e-16
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            80   3e-16
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    82   4e-16
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    82   4e-16
Kwal_27.12053                                                          82   7e-16
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    79   8e-16
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    82   9e-16
Scas_629.12                                                            81   9e-16
Kwal_23.6429                                                           79   4e-15
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    78   1e-14
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    77   2e-14
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    77   2e-14
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    76   4e-14
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    75   5e-14
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    75   8e-14
Kwal_33.15591                                                          75   9e-14
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    75   9e-14
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    75   1e-13
Scas_558.3                                                             74   2e-13
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         73   3e-13
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    72   5e-13
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    72   1e-12
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    71   1e-12
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    71   2e-12
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    70   2e-12
Scas_713.50                                                            71   2e-12
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    70   2e-12
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    70   3e-12
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    70   3e-12
Kwal_23.5351                                                           69   3e-12
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    69   4e-12
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    69   5e-12
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    69   6e-12
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    69   6e-12
CAGL0L03201g complement(366795..368534) some similarities with s...    69   7e-12
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    69   8e-12
Scas_720.83d                                                           68   1e-11
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    67   1e-11
Scas_631.17                                                            67   2e-11
Kwal_27.11585                                                          68   2e-11
Scas_679.28                                                            67   3e-11
Kwal_23.6240                                                           67   3e-11
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    66   4e-11
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    66   7e-11
Scas_658.1                                                             65   8e-11
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       63   9e-11
Kwal_26.8975                                                           65   1e-10
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    65   1e-10
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          64   2e-10
Scas_721.7                                                             63   2e-10
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            64   2e-10
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    64   2e-10
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    63   3e-10
Kwal_56.23920                                                          64   3e-10
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    63   3e-10
Kwal_26.8953                                                           63   4e-10
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    62   4e-10
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    64   4e-10
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    62   5e-10
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    62   5e-10
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    62   5e-10
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    62   7e-10
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    62   9e-10
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    61   1e-09
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    61   2e-09
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    61   2e-09
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    60   2e-09
Kwal_55.22067                                                          60   2e-09
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    61   2e-09
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    60   2e-09
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    60   3e-09
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    59   5e-09
Scas_685.11                                                            59   8e-09
Scas_692.25                                                            59   9e-09
Kwal_55.21559                                                          58   9e-09
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    59   1e-08
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    58   1e-08
Scas_717.68                                                            58   1e-08
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    57   2e-08
Kwal_56.24163                                                          57   3e-08
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         56   3e-08
Scas_720.45                                                            57   3e-08
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    56   3e-08
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    57   3e-08
Kwal_27.12239                                                          56   3e-08
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    56   3e-08
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           57   3e-08
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    57   6e-08
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    55   7e-08
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    55   7e-08
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    55   8e-08
Kwal_14.884                                                            55   9e-08
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    55   9e-08
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    55   1e-07
Scas_700.27*                                                           55   1e-07
Scas_692.29                                                            55   1e-07
Scas_659.9                                                             55   2e-07
KLLA0F16038g complement(1487475..1490063) weakly similar to ca|C...    54   3e-07
Scas_585.8                                                             53   4e-07
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    53   4e-07
Kwal_55.21450                                                          53   5e-07
Kwal_33.15136                                                          52   7e-07
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                          52   2e-06
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    51   2e-06
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    51   2e-06
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    51   3e-06
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    50   3e-06
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    50   3e-06
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    50   4e-06
Scas_721.128                                                           50   4e-06
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...    50   5e-06
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    50   5e-06
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    49   6e-06
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    50   6e-06
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    49   7e-06
Kwal_26.8628                                                           49   7e-06
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    50   7e-06
Kwal_26.7655                                                           50   7e-06
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         50   8e-06
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    49   8e-06
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    49   9e-06
Kwal_34.15818                                                          49   9e-06
Scas_571.4                                                             49   1e-05
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    48   1e-05
Scas_719.52                                                            49   2e-05
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    49   2e-05
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    48   2e-05
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...    48   2e-05
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    48   2e-05
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    47   3e-05
Scas_615.11                                                            47   3e-05
Scas_660.7*                                                            47   3e-05
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    47   3e-05
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    47   3e-05
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             47   3e-05
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    47   4e-05
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...    47   4e-05
Kwal_27.10785                                                          47   4e-05
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    47   4e-05
Kwal_47.17555                                                          47   5e-05
Scas_680.11                                                            46   6e-05
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    46   7e-05
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    46   7e-05
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    46   7e-05
Kwal_27.11126                                                          46   8e-05
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    46   8e-05
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    45   8e-05
Kwal_27.10385                                                          46   1e-04
Kwal_33.15475                                                          46   1e-04
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         46   1e-04
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    46   1e-04
Kwal_27.12586                                                          45   1e-04
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    45   1e-04
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    45   2e-04
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    45   2e-04
Sklu_675.1 YMR146C, Contig c675 761-1687                               44   2e-04
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    45   2e-04
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    43   2e-04
Scas_605.18                                                            44   2e-04
Scas_397.2                                                             44   3e-04
Scas_465.4                                                             44   3e-04
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    44   3e-04
AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372) [...    44   4e-04
Kwal_47.17567                                                          44   5e-04
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       43   6e-04
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    43   6e-04
Scas_512.3                                                             43   7e-04
Scas_510.5                                                             43   7e-04
Kwal_23.4118                                                           43   7e-04
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    42   9e-04
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    42   0.001
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         42   0.001
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    42   0.001
Kwal_56.24399                                                          42   0.001
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    42   0.001
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             42   0.001
Scas_718.6*                                                            42   0.001
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         42   0.002
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    42   0.002
Scas_702.16                                                            42   0.002
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    41   0.002
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    41   0.002
Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement         41   0.003
Kwal_33.13515                                                          40   0.003
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    41   0.003
Scas_719.30                                                            41   0.003
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    40   0.004
Scas_670.21                                                            40   0.004
Kwal_55.21144                                                          40   0.006
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    39   0.007
Kwal_47.17465                                                          40   0.008
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         40   0.008
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      39   0.009
Kwal_14.1235                                                           39   0.009
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    39   0.010
YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown func...    39   0.010
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    39   0.010
Scas_693.22                                                            39   0.010
Scas_652.16                                                            39   0.011
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    39   0.013
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         39   0.014
Scas_721.29                                                            39   0.016
Kwal_56.24596                                                          38   0.016
CAGL0K05599g 544932..547064 similar to tr|Q08496 Saccharomyces c...    39   0.016
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    39   0.021
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    38   0.021
Sklu_1710.1 YDR267C, Contig c1710 17-739                               37   0.023
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    38   0.025
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    38   0.025
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    38   0.026
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    38   0.027
CAGL0H00781g complement(77292..78833) similar to tr|Q12523 Sacch...    38   0.028
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    37   0.029
Scas_442.2*                                                            38   0.030
Scas_705.2                                                             38   0.030
Scas_660.8                                                             38   0.032
CAGL0L09757g complement(1046898..1047878) highly similar to sp|P...    37   0.033
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    37   0.036
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    37   0.042
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    37   0.045
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    37   0.051
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          37   0.052
Kwal_56.23685                                                          37   0.053
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    37   0.055
Scas_715.22                                                            37   0.060
Scas_699.5                                                             37   0.063
YPL247C (YPL247C) [5203] chr16 complement(82625..84196) Protein ...    37   0.066
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    36   0.071
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    36   0.073
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    37   0.082
Kwal_14.1710                                                           36   0.085
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            36   0.089
YKL018W (SWD2) [3238] chr11 (403745..404734) Component of SET1 a...    36   0.092
Kwal_33.14971                                                          36   0.093
Scas_542.5                                                             35   0.11 
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    36   0.11 
Sklu_2384.3 YKL018W, Contig c2384 6547-7533                            35   0.12 
Scas_642.1                                                             36   0.13 
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    35   0.14 
Sklu_2113.2 YCL039W, Contig c2113 2538-4865                            35   0.15 
KLLA0D12760g complement(1090428..1091909) weakly similar to sgd|...    35   0.16 
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    35   0.16 
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    35   0.17 
AFR715C [3908] [Homologous to ScYCL039W - SH] (1752847..1754997)...    35   0.18 
YJL102W (MEF2) [2813] chr10 (231218..233677) Putative mitochondr...    35   0.18 
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    35   0.19 
KLLA0F21076g 1966373..1969036 highly similar to sp|Q9P4C0 Kluyve...    35   0.19 
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    35   0.20 
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    35   0.21 
Scas_469.3                                                             35   0.22 
YNL035C (YNL035C) [4552] chr14 complement(568520..569689) Protei...    35   0.22 
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    35   0.24 
AFR153W [3345] [Homologous to ScYLR055C (SPT8) - SH] complement(...    35   0.25 
ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH] complement(3...    35   0.25 
Kwal_56.24332                                                          35   0.26 
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    34   0.26 
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    35   0.26 
Scas_656.15                                                            35   0.27 
Scas_595.3*                                                            35   0.27 
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         35   0.28 
ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [...    35   0.28 
KLLA0F08811g complement(819834..821744) some similarities with s...    35   0.29 
Kwal_56.22345                                                          34   0.29 
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    35   0.29 
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    35   0.31 
YBR097W (VPS15) [288] chr2 (436908..441272) Serine/threonine pro...    35   0.31 
AAR078W [264] [Homologous to ScYLR196W (PWP1) - SH] complement(4...    34   0.35 
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    34   0.35 
ACR085C [1132] [Homologous to NOHBY] (508364..511228) [2865 bp, ...    34   0.36 
Kwal_33.13148                                                          34   0.39 
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          34   0.39 
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    34   0.41 
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    33   0.46 
Scas_674.20                                                            33   0.48 
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    33   0.52 
KLLA0B11924g complement(1043344..1047582) similar to sp|P22219 S...    34   0.53 
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    33   0.56 
Scas_646.14                                                            33   0.56 
AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH] (168010..16...    33   0.62 
ADR230W [1971] [Homologous to ScYOR080W (DIA2) - SH] complement(...    33   0.66 
Kwal_14.906                                                            33   0.69 
KLLA0E18139g 1608371..1609351 highly similar to sp|P36104 Saccha...    33   0.72 
ADL054W [1687] [Homologous to ScYER124C (DSE1) - SH] complement(...    33   0.73 
Kwal_26.7738                                                           33   0.80 
ADR331C [2072] [Homologous to ScYHR186C - SH] (1285564..1290252)...    33   0.81 
AFR634W [3826] [Homologous to ScYNL253W - SH] complement(1593772...    33   0.81 
KLLA0E18964g complement(1676876..1680310) similar to sp|P53010 S...    33   1.00 
YLR055C (SPT8) [3472] chr12 complement(251273..253081) Component...    33   1.0  
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    33   1.1  
Kwal_26.7736                                                           33   1.2  
Scas_649.10                                                            33   1.2  
Kwal_55.22076                                                          33   1.3  
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    33   1.3  
CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...    32   1.3  
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    32   1.3  
ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH] complement(1...    32   1.4  
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    32   1.4  
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    32   1.5  
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...    32   1.5  
YBR281C (YBR281C) [459] chr2 complement(764928..767564) Member o...    32   1.7  
Kwal_56.23035                                                          32   1.7  
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         32   1.8  
AFR438W [3630] [Homologous to ScYML088W (UFO1) - SH] complement(...    32   1.9  
ACR116W [1163] [Homologous to ScYPL139C (UME1) - SH] complement(...    32   1.9  
Kwal_56.24661                                                          32   2.0  
YLR218C (YLR218C) [3618] chr12 complement(573468..573920) Protei...    31   2.0  
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    32   2.1  
KLLA0E19613g complement(1733708..1735426) similar to sp|P21304 S...    32   2.2  
YDL156W (YDL156W) [714] chr4 (174919..176487) Protein containing...    32   2.4  
Kwal_47.17310                                                          32   2.5  
Sklu_2359.2 YER124C, Contig c2359 3062-4807                            32   2.5  
CAGL0J08998g 882655..886500 highly similar to sp|P38968 Saccharo...    31   3.1  
KLLA0E04026g complement(373677..375335) similar to sp|P43609 Sac...    31   3.1  
Kwal_27.12070                                                          31   3.3  
KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomy...    31   3.4  
YDR488C (PAC11) [1304] chr4 complement(1429176..1430777) Dynein ...    31   3.6  
AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH] (1203152..1...    31   4.2  
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    31   4.2  
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    31   4.5  
Sklu_2416.2 YOL138C, Contig c2416 613-4674 reverse complement          31   4.6  
YDR324C (UTP4) [1154] chr4 complement(1114426..1116756) Protein ...    31   4.6  
Scas_640.17                                                            30   4.8  
Kwal_33.14248                                                          30   5.0  
KLLA0F17237g 1577197..1578768 similar to sp|Q04225 Saccharomyces...    30   5.1  
YHR186C (KOG1) [2471] chr8 complement(475997..480670) Component ...    31   5.3  
Scas_706.24                                                            30   5.3  
Sklu_1701.1 YOR229W, Contig c1701 334-1536 reverse complement          30   6.2  
KLLA0A09471g complement(827264..831784) similar to sp|P38873 Sac...    30   6.3  
KLLA0C01177g 89978..92131 weakly similar to sp|P25569 Saccharomy...    30   6.3  
Scas_636.4                                                             30   6.7  
CAGL0F03883g 375906..377477 similar to sp|Q03655 Saccharomyces c...    30   7.2  
Kwal_14.1933                                                           30   7.4  
CAGL0A04037g complement(399371..401122) highly similar to sp|P21...    30   7.6  
CAGL0E01485g complement(138830..142840) similar to tr|Q08281 Sac...    30   7.8  
Scas_589.13                                                            30   7.9  
Kwal_26.8275                                                           30   8.1  
CAGL0M01430g 164428..166683 highly similar to tr|Q06679 Saccharo...    30   8.2  
Scas_701.22                                                            30   8.2  
Kwal_56.23895                                                          30   8.2  
YGL094C (PAN2) [1889] chr7 complement(331119..334466) Component ...    30   8.7  
KLLA0E13585g complement(1195444..1197186) some similarities with...    30   9.9  
YGL213C (SKI8) [1783] chr7 complement(90057..91250) Protein invo...    29   9.9  
CAGL0J03960g complement(373177..374484) similar to sp|Q12206 Sac...    30   10.0 

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 1351 bits (3497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/662 (97%), Positives = 646/662 (97%)

Query: 1   MEVRQVKHSRDDTEAEGAKRRKMPYDEQIQMLAXXXXXDTMKRDMGDALATSTESQSGVS 60
           MEVRQVKHSRDDTEAEGAKRRKMPYDEQIQMLA     DTMKRDMGDALATSTESQSGVS
Sbjct: 1   MEVRQVKHSRDDTEAEGAKRRKMPYDEQIQMLAEEEEEDTMKRDMGDALATSTESQSGVS 60

Query: 61  VLPRDNFQRYCYRHNPEIQTSNTHELCYKQDMQRIKMINNKISQLACPKEQADIHHIISK 120
           VLPRDNFQRYCYRHNPEIQTSNTHELCYKQDMQRIKMINNKISQLACPKEQADIHHIISK
Sbjct: 61  VLPRDNFQRYCYRHNPEIQTSNTHELCYKQDMQRIKMINNKISQLACPKEQADIHHIISK 120

Query: 121 YTNSNDKVRKLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQS 180
           YTNSNDKVRKLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQS
Sbjct: 121 YTNSNDKVRKLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQS 180

Query: 181 LCNASMVCKNWHLLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARVCYIKAKNPNT 240
           LCNASMVCKNWHLLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARVCYIKAKNPNT
Sbjct: 181 LCNASMVCKNWHLLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARVCYIKAKNPNT 240

Query: 241 TVNDRKMIQDNDNRISPLTDRTQGNESPGATFSTNVCTTASNNTVXXXXXXXXXXXENGR 300
           TVNDRKMIQDNDNRISPLTDRTQGNESPGATFSTNVCTTASNNTV           ENGR
Sbjct: 241 TVNDRKMIQDNDNRISPLTDRTQGNESPGATFSTNVCTTASNNTVSGSKSSGQGQQENGR 300

Query: 301 CRQKSWKMVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWD 360
           CRQKSWKMVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWD
Sbjct: 301 CRQKSWKMVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWD 360

Query: 361 LFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV 420
           LFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV
Sbjct: 361 LFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV 420

Query: 421 DSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
           DSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW
Sbjct: 421 DSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW 480

Query: 481 DIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVN 540
           DIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVN
Sbjct: 481 DIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVN 540

Query: 541 GQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSH 600
           GQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSH
Sbjct: 541 GQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSH 600

Query: 601 DGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHDERTKSAPVACVCIGDSECFSGDE 660
           DGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHDERTKSAPVACVCIGDSECFSGDE
Sbjct: 601 DGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHDERTKSAPVACVCIGDSECFSGDE 660

Query: 661 FG 662
           FG
Sbjct: 661 FG 662

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/618 (67%), Positives = 484/618 (78%), Gaps = 66/618 (10%)

Query: 49  LATSTESQSGVSVLPRDNFQRYCYRHNPEIQTSNTHELCYKQDMQRIKMINNKISQLACP 108
           LAT+ +S + V  LP  NF ++CYRHNP+IQ S TH  CYKQD++R + IN  I++L   
Sbjct: 74  LATN-DSGTRVQPLPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQEINANIAKLPL- 131

Query: 109 KEQADIHHIISKYTNSNDKVRKLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQEL 168
           +EQ+DIHHIISKY+NSNDK+RKLILDGIL++SCFPQLSYI+  +  MIKIDFIS+LPQEL
Sbjct: 132 QEQSDIHHIISKYSNSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIKIDFISILPQEL 191

Query: 169 SLKILGYLDCQSLCNASMVCKNWHLLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRA 228
           SLKIL YLDCQSLCNA+ VC+ W  LADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRA
Sbjct: 192 SLKILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRA 251

Query: 229 RVCYIKAKNPNTTVNDRKMIQDNDNRISPLTDRTQGNESPGATFSTNVCTTASNNTVXXX 288
           R                  IQ N               S G++ + ++ T  +       
Sbjct: 252 R------------------IQQN---------------STGSSSNADIQTQTT------- 271

Query: 289 XXXXXXXXENGRCRQKSWKMVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLF 348
                          + WK++YRERFKVESNWRKG C IQEFKGHMDGVLTLQFNYRLLF
Sbjct: 272 ---------------RPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYRLLF 316

Query: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECIS 408
           TGSYD+T+ IWDLFTGKLIRRL+GHSDGVKTLYFDD+KLITGSLDKTIRVWNYITGECIS
Sbjct: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECIS 376

Query: 409 TYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSC 468
           TYRGH+DSV+SVDS++K+IVSGSADKTVKVWHVESRTCYTL+GHTEWVNCVKLHPKSFSC
Sbjct: 377 TYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSC 436

Query: 469 YSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPG---EEDDI 525
           +SCSDDTTIRMWDIRTN+CL+VFRGHVGQVQK+IPLTI D +NL T     G   ++D  
Sbjct: 437 FSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPT 496

Query: 526 ASNGTGEDD-PENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEG 584
            ++G  E D P N    +  LD+ +PYPTHLLSC LDNTIKLW+V++G+CIRTQFGHVEG
Sbjct: 497 MTDGADESDTPSN--EQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEG 554

Query: 585 VWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHDERTKSAP 644
           VWDIAADNFRIISGSHDGSIK+WDLQSGKCMHTF+GR+L+    +T +    D   K AP
Sbjct: 555 VWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQSLGD---KVAP 611

Query: 645 VACVCIGDSECFSGDEFG 662
           +ACVCIGDSECFSGDEFG
Sbjct: 612 IACVCIGDSECFSGDEFG 629

>Scas_704.40
          Length = 608

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/630 (65%), Positives = 476/630 (75%), Gaps = 87/630 (13%)

Query: 60  SVLPRDNFQRYCYRHNPEIQTSNTHELCYKQDMQRIKMINNKISQLACPKEQADIHHIIS 119
           S LP+ NF ++CYRHNPEI +S TH  CY QD++R K +N+ I++L   +EQA+IHHIIS
Sbjct: 31  SALPQFNFTKFCYRHNPEILSSPTHTACYNQDLKRFKDLNDNITKLP-AQEQAEIHHIIS 89

Query: 120 KYTNSNDKVRKLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQ 179
           K+  SNDK+RKLILDGIL SSCFPQLSYI+  ++ MI+IDFIS+LPQELSLKIL YLDCQ
Sbjct: 90  KFNKSNDKLRKLILDGILASSCFPQLSYISSQVSNMIRIDFISILPQELSLKILSYLDCQ 149

Query: 180 SLCNASMVCKNWHLLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARVCYIKAKNPN 239
           SLCNA+ VC+ W +LADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRAR  ++K     
Sbjct: 150 SLCNATKVCRKWQILADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRAR--FVK----- 202

Query: 240 TTVNDRKMIQDNDNRISPLTDRTQGNESPGATFSTNVCTTASNNTVXXXXXXXXXXXENG 299
                                    N S  AT   N CT  SN  +              
Sbjct: 203 -------------------------NASICAT--NNTCTKDSNGKL-------------- 221

Query: 300 RCRQKSWKMVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIW 359
               + WK++YRERFKVESNWRKG C +QEFKGHMDGVLTLQFNYRLLFTGSYD+TVAIW
Sbjct: 222 ---MRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIW 278

Query: 360 DLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMS 419
           DL + KLIRRL+GH+DGVKTLYFD+ KL+TGSLDKTIRVWNY TGECISTYRGHTDSVMS
Sbjct: 279 DLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMS 338

Query: 420 VDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
           VD+ KKIIVSGSADKTVK+WHVESRTCYTL+GHTEWVNCVKLHPKSF+C+S SDDTTIRM
Sbjct: 339 VDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398

Query: 480 WDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGV 539
           WDIRTN+CL+VFRGHVGQVQKVIPLTIIDA+NLV         D+I+ +  G+D+P +  
Sbjct: 399 WDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVV--------DNISGSNEGDDEPASTT 450

Query: 540 NG--------------QRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGV 585
                            + LDK +PYPTHLLSC+LDNTIKLW+V++G+CIRTQFGHVEGV
Sbjct: 451 TPTAAIAAEAATNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV 510

Query: 586 WDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSD-------------VNTSS 632
           WDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG++L+  D               TS+
Sbjct: 511 WDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDEEGSTHLASTSNATGTST 570

Query: 633 NPDHDERTKSAPVACVCIGDSECFSGDEFG 662
           +  +  + K +P+ACV IGDSE FSGDE G
Sbjct: 571 STANPVQNKVSPIACVSIGDSEFFSGDELG 600

>Kwal_23.5769
          Length = 627

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/653 (56%), Positives = 450/653 (68%), Gaps = 72/653 (11%)

Query: 10  RDDTEAEGAKRRKMPYDEQIQMLAXXXXXDTMKRDMGDALATSTESQSGVSVLPRDNFQR 69
           +D  + +  KR+   Y++     A              A + ++ +   V  LP+ NF R
Sbjct: 39  KDKVKEQNGKRKAAEYEDGQLQEAQVDSVVPRGEVTESAASANSRTNKRVRGLPQYNFLR 98

Query: 70  YCYRHNPEIQTSNTHELCYKQDMQRIKMINNKISQLACPKEQADIHHIISKYTNSNDKVR 129
           +CYRHNP+ Q S TH  CY QD QR + +N KI QL  P+EQ  + ++++ +   ND++R
Sbjct: 99  FCYRHNPDFQHSQTHTACYMQDQQRHQKLNKKIEQLE-PEEQRQVQNVLTTFAGCNDRIR 157

Query: 130 KLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQSLCNASMVCK 189
           KL+L+G+L + CFPQLS++A  +  MIKIDFIS LP+E++LKILGYLDC+SLCNA+ VC+
Sbjct: 158 KLLLEGLLANCCFPQLSFVASEVQKMIKIDFISTLPEEVALKILGYLDCESLCNAARVCR 217

Query: 190 NWHLLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARVCYIKAKNPNTTVNDRKMIQ 249
            W  +ADDD+VWYHMC+QHIDRKCPNCGWGLPLLHMKRAR                    
Sbjct: 218 RWQQMADDDKVWYHMCQQHIDRKCPNCGWGLPLLHMKRARF------------------- 258

Query: 250 DNDNRISPLTDRTQGNESPGATFSTNVCTTASNNTVXXXXXXXXXXXENGRCRQKSWKMV 309
                I P  +   G +  G     +  TT                      + + WK++
Sbjct: 259 -----IEPPAESKPGQKGAGNPPVASETTTR---------------------KTRPWKVI 292

Query: 310 YRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRR 369
           YRERFKVESNWRKG   IQEFKGHMDGVL+LQFNYRLLFTGSYD+TVAIWDL TGKL+RR
Sbjct: 293 YRERFKVESNWRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRR 352

Query: 370 LTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVS 429
           LTGH DGVK +YFD QKLITGSLD+ IRVWNY+TG C++ Y GH+DSV+SVDS+KKIIVS
Sbjct: 353 LTGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVS 412

Query: 430 GSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLR 489
           GSADKTVKVWHVESRTCYTL+GHTEWV  VKLHPKSF+C+S SDDTTIRMWDIR+NTC++
Sbjct: 413 GSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVK 472

Query: 490 VFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKM 549
           VFRGHVGQVQKV+PLTI+D +NLVT        D   +  T   DP +G      LD  +
Sbjct: 473 VFRGHVGQVQKVLPLTILDTENLVTDR----TSDPPRNEATTAQDPPDG--QLSALDDSL 526

Query: 550 PYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDL 609
           PYP+HLLSC+LDNTIKLWEVR+G+C+RT FGHVEG+WDIAADNFRI+SG+HD ++K+WDL
Sbjct: 527 PYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDL 586

Query: 610 QSGKCMHTFHGRKLKGSDVNTSSNPDHDERTKSAPVACVCIGDSECFSGDEFG 662
           QSGKC+HTF   +                    AP+ CV IGDSE  SGDE G
Sbjct: 587 QSGKCIHTFDSHQ--------------------APITCVGIGDSEFVSGDELG 619

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 53/92 (57%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGEC 406
           L + S D T+ +W++ TGK +R   GH +G+  +  D+ ++++G+ DKT++VW+  +G+C
Sbjct: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKC 591

Query: 407 ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKV 438
           I T+  H   +  V       VSG     VKV
Sbjct: 592 IHTFDSHQAPITCVGIGDSEFVSGDELGCVKV 623

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/662 (56%), Positives = 450/662 (67%), Gaps = 66/662 (9%)

Query: 6   VKHSRDDTEAEGAKRRKMPYDEQIQMLAXXXXXDTMKRDMGDALATSTESQSGVSVLPRD 65
           +K   +D ++ G   ++   D + ++L          R+    +  + E     S +P+ 
Sbjct: 13  LKRKFEDVDSNGVSDQRQDTDGKGEIL----------RNKASKVNQNNEEIQLPSEMPQF 62

Query: 66  NFQRYCYRHNPEIQTSNTHELCYKQDMQRIKMINNKISQLACPKEQADIHHIISKYTNSN 125
           NF ++CYRHNP+IQ +    + + QD  R +    K+  L    ++A I   +  + +SN
Sbjct: 63  NFFKFCYRHNPDIQHTCKDSMVF-QDQVRSEKWMEKMKALDKESDRAIIKQTLDNFQHSN 121

Query: 126 DKVRKLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQSLCNAS 185
           DK+R+L+L+GIL   CFPQLSYIA  +  +IKIDFIS LP+ELSLKILGYLDCQSLC AS
Sbjct: 122 DKIRRLMLEGILQLCCFPQLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLCIAS 181

Query: 186 MVCKNWHLLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARVCYIKAKNPNTTVNDR 245
           + CK W  LADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRAR  Y+     +    + 
Sbjct: 182 LTCKRWKTLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRAR--YLPVNEAHVHNQNG 239

Query: 246 KMIQDNDNRISPLTDRTQGNESPGATFSTNVCTTASNNTVXXXXXXXXXXXENGRCRQKS 305
              Q+  N         +   +PG + +  V   A                 N R   + 
Sbjct: 240 NQFQNVANGNGNEIGGGKSLINPGNSPNQTVAARA----------------RNSRYYTRP 283

Query: 306 WKMVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGK 365
           WK++YRERF+VESNWR G C IQ FKGHMDGVL+L+FN+RLLFTGSYD+TVAIWD  +G 
Sbjct: 284 WKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGN 343

Query: 366 LIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK 425
           LIRRLTGH+DGVK +YFDDQK+IT SLDKTIRVWNYITG CISTYRGH DSV+SVDS+KK
Sbjct: 344 LIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK 403

Query: 426 IIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN 485
           IIVS SADKTVKVWHVESRTCYTL+GHTEWVNCVKLHPKSF+CYS SDD T+RMWDIRTN
Sbjct: 404 IIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTN 463

Query: 486 TCLRVFRGHVGQVQKVIPLTIIDAQNLVTHER-----KPGEEDDIASNGTGEDDPENGVN 540
           +C++VFRGHVGQVQKVIPLTI D +NLV  E+      P  E+D A + TG  DP     
Sbjct: 464 SCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPN---- 519

Query: 541 GQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSH 600
                   + YPTHLLSC+LDNTIKLWEV SGRCIRTQFGHVEGVWDIAADNFRI+SGSH
Sbjct: 520 --------LKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSH 571

Query: 601 DGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHDERTKSAPVACVCIGDSECFSGDE 660
           D SIK+WDLQ+GKC+ TF G K                    AP+ CV IGDS   SGDE
Sbjct: 572 DKSIKVWDLQNGKCIQTFTGHK--------------------APIVCVGIGDSSFVSGDE 611

Query: 661 FG 662
            G
Sbjct: 612 LG 613

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 63/116 (54%), Gaps = 1/116 (0%)

Query: 328 QEFKGHMDGVLTLQFNYRL-LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK 386
           ++F     G+      Y   L + S D T+ +W++ +G+ IR   GH +GV  +  D+ +
Sbjct: 506 EDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR 565

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVE 442
           +++GS DK+I+VW+   G+CI T+ GH   ++ V       VSG     VK+WH +
Sbjct: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSGDELGEVKMWHFD 621

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/600 (59%), Positives = 420/600 (70%), Gaps = 80/600 (13%)

Query: 63  PRDNFQRYCYRHNPEIQTSNTHELCYKQDMQRIKMINNKISQLACPKEQADIHHIISKYT 122
           P+ NF RYCYRHNP+IQ + T   C +Q+ QR +    ++ +L+   E+  +   +  + 
Sbjct: 40  PQYNFVRYCYRHNPDIQAAPTQVRCVRQEQQRREEWQARVGELSSEGERQVVQEAVRLFD 99

Query: 123 NSNDKVRKLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQSLC 182
           +SNDK+RKL+L+G+L  SCFPQLS+I+  +  +IKIDFIS LP+E++LKILGYLDCQSLC
Sbjct: 100 SSNDKLRKLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLC 159

Query: 183 NASMVCKNWHLLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARVCYIKAKNPNTTV 242
           +A+ VC+ W  LADDD VWYHMCEQHIDRKCP CGWGLPLLHMKRAR  YIK+   + + 
Sbjct: 160 SAAAVCRRWQELADDDTVWYHMCEQHIDRKCPKCGWGLPLLHMKRAR--YIKSDKASAS- 216

Query: 243 NDRKMIQDNDNRISPLTDRTQGNESPGATFSTNVCTTASNNTVXXXXXXXXXXXENGRCR 302
                             + +G ++P                               + R
Sbjct: 217 ------------------KGEGEDAP-------------------------------QSR 227

Query: 303 QKSWKMVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLF 362
            + WK+VYRERFKVESNWRKG+  IQEFKGHMDGVL+LQ   +LL TGSYD+TVAIWDL 
Sbjct: 228 MRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVLSLQLTNKLLLTGSYDSTVAIWDLA 287

Query: 363 TGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDS 422
           TGKLIRRL+GH+DGVK L FDDQKLITGSLDKTIRVWNY+TG C+STYRGH DSV+SVDS
Sbjct: 288 TGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDS 347

Query: 423 HKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
            +K+IVSGSADKTVKVWHVESRTCYTL+GHT WVNCVKLHPKSF+C+S SDD TIRMWDI
Sbjct: 348 FRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407

Query: 483 RTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQ 542
           RTNTC+RVF GHVGQVQKVIPLT+    +L+   +      D  +     D      N  
Sbjct: 408 RTNTCVRVFHGHVGQVQKVIPLTL--GSDLIEDPKDAVVPPD--ATAPAHDPSVQAAN-- 461

Query: 543 RELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDG 602
              D  +PYPTHLLSC+LDNTIKLW V++G CIRTQFGHVEGVWDIAADNFRI+SGSHD 
Sbjct: 462 --FDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDR 519

Query: 603 SIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHDERTKSAPVACVCIGDSECFSGDEFG 662
           S K+WDLQ+GKCMHTF G                      APVACV IGDSE  SGDE G
Sbjct: 520 SCKVWDLQTGKCMHTFVG--------------------IHAPVACVGIGDSEFVSGDELG 559

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 61/117 (52%), Gaps = 5/117 (4%)

Query: 332 GHMDGVLTLQFNYRL-----LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK 386
            H   V    F++ L     L + S D T+ +W++ TG  IR   GH +GV  +  D+ +
Sbjct: 452 AHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR 511

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVES 443
           +++GS D++ +VW+  TG+C+ T+ G    V  V       VSG     VK+++ ++
Sbjct: 512 IVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSEFVSGDELGCVKLYNFDT 568

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 319 NWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVK 378
           N + G C   +F GH++GV  +  +   + +GS+D +  +WDL TGK +    G    V 
Sbjct: 485 NVKTGACIRTQF-GHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVA 543

Query: 379 TLYFDDQKLITGSLDKTIRVWNYIT 403
            +   D + ++G     ++++N+ T
Sbjct: 544 CVGIGDSEFVSGDELGCVKLYNFDT 568

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score =  119 bits (299), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 107/370 (28%), Positives = 168/370 (45%), Gaps = 65/370 (17%)

Query: 311 RERFKVESNWRKGLCTIQEFKGHMDGVLTLQF---NYRLLFTGSYDTTVAIWDLFTGKLI 367
           R  FKV+   R          GH   +L   F       + TG+ D T  IWD  T   +
Sbjct: 124 RAVFKVKPVTRSS----SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPM 179

Query: 368 RRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECIS-TYRGHTDSVMSVD--- 421
             L GH + V  + +  D + + TGS+D TIR+W+  +G+C+    RGH+  + S+    
Sbjct: 180 HTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEP 239

Query: 422 ------SHKKIIVSGSADKTVKVWHVESRTC-YTLKGHTEWVNCVKLHPKSFSCYSCSDD 474
                   K  + S S D T+K+W   SR C YT+ GHT  V+CVK   +    YS S D
Sbjct: 240 IHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGL-LYSGSHD 298

Query: 475 TTIRMWDIRTNT-CLRVFRGHVGQVQKVI------------------PLTIIDAQN--LV 513
            T+R+WDI +   C+ + + H   V  +                   P T  +AQ   L 
Sbjct: 299 RTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALE 358

Query: 514 THER---KPGEEDDIASNGTGEDD-------------PENGVNGQRELDKKMPYPT---H 554
            +E+   K G  +++    T  DD             P   + G ++L   + +     +
Sbjct: 359 NYEKICKKNGNSEEMMV--TASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRY 416

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSG 612
           ++S + DN+IKLW+ R G+ I T  GHV  V+ +A  +D   ++S S D ++K+WD+++ 
Sbjct: 417 IVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR 476

Query: 613 KCMHTFHGRK 622
           K      G K
Sbjct: 477 KLSVDLPGHK 486

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/343 (22%), Positives = 137/343 (39%), Gaps = 101/343 (29%)

Query: 321 RKGLCTIQEFKGHMDGVLTLQF---------NYRLLFTGSYDTTVAIWDLFTGKLIRRLT 371
           + G C     +GH   + +L +         +   L + S D T+ IWD  +      ++
Sbjct: 216 KSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMS 275

Query: 372 GHSDGVKTLYFDDQKLI-TGSLDKTIRVWNYIT-GECISTYRGH----------TDSVM- 418
           GH++ V  + +  Q L+ +GS D+T+RVW+  + G CI+  + H          TD  + 
Sbjct: 276 GHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALR 335

Query: 419 --------------------SVDSHKKI----------IVSGSADKTVKVWHV--ESRTC 446
                               ++++++KI          +V+ S D T+ +W+    ++  
Sbjct: 336 IGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPI 395

Query: 447 YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTI 506
             + GH + VN V   P      S S D +I++WD R    +  FRGHV  V +V   + 
Sbjct: 396 ARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSS- 454

Query: 507 IDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKL 566
            D + LV                                           SC+ D T+K+
Sbjct: 455 -DCRLLV-------------------------------------------SCSKDTTLKV 470

Query: 567 WEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIW 607
           W+VR+ +      GH + V+  D + D  R+ SG  D  +++W
Sbjct: 471 WDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           I  F+GH+  V  + ++   RLL + S DTT+ +WD+ T KL   L GH D V T+ +  
Sbjct: 437 ISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSV 496

Query: 383 DDQKLITGSLDKTIRVWNY 401
           D +++ +G  DK +R+W +
Sbjct: 497 DGKRVCSGGKDKMVRLWTH 515

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score =  115 bits (287), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 96/322 (29%), Positives = 152/322 (47%), Gaps = 58/322 (18%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITG 404
           + TG+ D T  IWD  T   +  L GHS+ V  + +  D + + TGS+D TIR+W+   G
Sbjct: 157 MVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKG 216

Query: 405 ECIS-TYRGHTDSVMSVD---------SHKKIIVSGSADKTVKVWHVESRTC-YTLKGHT 453
           + +    RGHT  + S+            K  + S S D T+K+W    R C YTL GHT
Sbjct: 217 QSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSGHT 276

Query: 454 EWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN-TCLRVFRGHVGQVQKVI---------- 502
             V+C+K   ++   YS S D T+R WD+     C+ + + H   V  +           
Sbjct: 277 SSVSCIKWGGRNV-LYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSLSTDYALRMG 335

Query: 503 --------PLTIIDAQ-----NLVTHERKPGEEDDIASNGTGEDD-------PENG---- 538
                   P +  DAQ     N     +K G  +++    TG DD       P  G    
Sbjct: 336 PFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMV--TGSDDFTMYLWNPLKGSKPI 393

Query: 539 --VNGQRELDKKMPYPT---HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--AD 591
             + G ++L   + +     +++S + DN+IKLW+ R G+ I T  GHV  V+ +A  +D
Sbjct: 394 LRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSD 453

Query: 592 NFRIISGSHDGSIKIWDLQSGK 613
              ++S S D ++K+WD+++ K
Sbjct: 454 CRLLVSCSKDTTLKVWDVKTRK 475

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 117/286 (40%), Gaps = 52/286 (18%)

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVES 443
           +++TG+ D T R+W+  T   + T +GH++ V+ V   +  ++I +GS D T+++W  E 
Sbjct: 156 RMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEK 215

Query: 444 RTCY--TLKGHTEWVNCVKLHP-------KSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
                  L+GHT+W+  +   P       +     S S D TI++WD     C+    GH
Sbjct: 216 GQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSGH 275

Query: 495 VGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASN-------------------------- 528
              V   I     +     +H+R     D  A                            
Sbjct: 276 TSSVS-CIKWGGRNVLYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSLSTDYALRM 334

Query: 529 ------GTGEDDPENGV-----NGQRELDKKMPYPTHLLSCALDNTIKLW-EVRSGRCIR 576
                 GT    PE+       N ++   K       +++ + D T+ LW  ++  + I 
Sbjct: 335 GPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLKGSKPIL 394

Query: 577 TQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
              GH + V  +A   D   I+S S D SIK+WD + GK + TF G
Sbjct: 395 RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRG 440

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 115/288 (39%), Gaps = 52/288 (18%)

Query: 327 IQEFKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTG-KLIRRLTGHSDGVKTLYFD- 383
           I    GH   V  +++  R +L++ S+D TV  WD+  G K I  L  H+  V  L    
Sbjct: 269 IYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSLST 328

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHV-- 441
           D  L  G  D T               R +        + ++++V+GS D T+ +W+   
Sbjct: 329 DYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLK 388

Query: 442 ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
            S+    + GH + VN V   P      S S D +I++WD R    +  FRGHV  V +V
Sbjct: 389 GSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQV 448

Query: 502 IPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALD 561
              +  D + LV                                           SC+ D
Sbjct: 449 AWSS--DCRLLV-------------------------------------------SCSKD 463

Query: 562 NTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIW 607
            T+K+W+V++ +      GH + V+  D + D  R+ SG  D  +++W
Sbjct: 464 TTLKVWDVKTRKLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 60/124 (48%), Gaps = 6/124 (4%)

Query: 322 KGLCTIQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKT 379
           KG   I    GH   V  + F  + R + + S+D ++ +WD   GK I    GH   V  
Sbjct: 388 KGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQ 447

Query: 380 LYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKT 435
           + +  D + L++ S D T++VW+  T +      GH D V +VD     K + SG  DK 
Sbjct: 448 VAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKM 507

Query: 436 VKVW 439
           V++W
Sbjct: 508 VRLW 511

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 4/79 (5%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           I  F+GH+  V  + ++   RLL + S DTT+ +WD+ T KL   L GH+D V T+ +  
Sbjct: 435 IATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWSV 494

Query: 383 DDQKLITGSLDKTIRVWNY 401
           D +++ +G  DK +R+W +
Sbjct: 495 DGKRVCSGGKDKMVRLWTH 513

 Score = 35.8 bits (81), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQ 610
           + +++ A DNT ++W+  +   + T  GH   V  +A  AD   I +GS D +I++WD +
Sbjct: 155 SRMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSE 214

Query: 611 SGKCMHTFHGRKLKG 625
            G+ +    G  L+G
Sbjct: 215 KGQSL----GDALRG 225

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score =  112 bits (279), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 106/375 (28%), Positives = 161/375 (42%), Gaps = 67/375 (17%)

Query: 308 MVYRER--FKVESNWRKGLCTIQEFKGHMDGVLTLQF---NYRLLFTGSYDTTVAIWDLF 362
           +VY  R  FKV+   R          GH   +L   F       + TG+ D T  IWD  
Sbjct: 119 LVYTPRAVFKVKPVTRSS----SAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCN 174

Query: 363 TGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECIS-TYRGHTDSVMS 419
           T   +  L GH + V  + +  D + + TGS+D TIR+W    G+ +    RGH   + S
Sbjct: 175 TQTPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITS 234

Query: 420 VD---------SHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCY 469
           +            K  + S S D T+K+W    R C  TL GHT  V+C+K   +    Y
Sbjct: 235 LSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGV-LY 293

Query: 470 SCSDDTTIRMWDIRTN-TCLRVFRGHVGQVQKVI------------------PLTIIDAQ 510
           S S D TIR WD+     C+ + + H   V  +                   P T  +AQ
Sbjct: 294 SGSHDKTIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQ 353

Query: 511 -----NLVTHERKPGEEDDIASNGTGEDD-------------PENGVNGQRELDKKMPYP 552
                N     ++ GE +++    T  DD             P   + G ++L   + + 
Sbjct: 354 KRALKNYEKIAKRNGEVEELMV--TASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFS 411

Query: 553 T---HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIW 607
               H++S + DN+IKLW  R G+ I T  GHV  V+ +A  +D   ++S S D ++K+W
Sbjct: 412 PDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW 471

Query: 608 DLQSGKCMHTFHGRK 622
           D+++ K      G K
Sbjct: 472 DVKTKKLAVDLPGHK 486

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/308 (22%), Positives = 117/308 (37%), Gaps = 92/308 (29%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK-LITGSLDKTIRVWNY-ITG 404
           L + S D T+ IWD      +  L+GH+  V  + +  Q  L +GS DKTIR W+  + G
Sbjct: 251 LASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNLGG 310

Query: 405 ECISTYRGH----------TDSVMSVDSH------------------------------- 423
           +CI+  + H          TD  + + +                                
Sbjct: 311 KCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEV 370

Query: 424 KKIIVSGSADKTVKVWHV--ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWD 481
           ++++V+ S D T+ +W+    ++    + GH + VN V   P      S S D +I++W+
Sbjct: 371 EELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWN 430

Query: 482 IRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNG 541
            R    +  FR   G V  V  +       L                             
Sbjct: 431 GRDGKFISTFR---GHVASVYQVAWSSDCRL----------------------------- 458

Query: 542 QRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGS 599
                        L+SC+ D T+K+W+V++ +      GH + V+  D + D  R+ SG 
Sbjct: 459 -------------LVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGG 505

Query: 600 HDGSIKIW 607
            D  +++W
Sbjct: 506 KDKMVRLW 513

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 94/225 (41%), Gaps = 48/225 (21%)

Query: 324 LCTIQEFKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDL-FTGKLIRRLTGHSDGVKTL- 380
           +C I    GH   V  +++  + +L++GS+D T+  WD+   GK I  L  H+  V  L 
Sbjct: 269 VCLIT-LSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNLGGKCINILKSHAHWVNHLS 327

Query: 381 ----------YFD------------------------------DQKLITGSLDKTIRVWN 400
                      FD                              ++ ++T S D T+ +WN
Sbjct: 328 LSTDYALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLWN 387

Query: 401 YI-TGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWH-VESRTCYTLKGHTEWV 456
            + + + I+   GH   V  ++     + IVS S D ++K+W+  + +   T +GH   V
Sbjct: 388 PLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASV 447

Query: 457 NCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
             V          SCS DTT+++WD++T        GH  +V  V
Sbjct: 448 YQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTV 492

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           I  F+GH+  V  + ++   RLL + S DTT+ +WD+ T KL   L GH D V T+ +  
Sbjct: 437 ISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSV 496

Query: 383 DDQKLITGSLDKTIRVWNY 401
           D +++ +G  DK +R+W +
Sbjct: 497 DGKRVCSGGKDKMVRLWTH 515

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 58/119 (48%), Gaps = 6/119 (5%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           I    GH   V  + F  + R + + S+D ++ +W+   GK I    GH   V  + +  
Sbjct: 395 ITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWSS 454

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVW 439
           D + L++ S D T++VW+  T +      GH D V +VD     K + SG  DK V++W
Sbjct: 455 DCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

>Scas_720.95
          Length = 515

 Score =  111 bits (278), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 99/373 (26%), Positives = 169/373 (45%), Gaps = 63/373 (16%)

Query: 308 MVYRER--FKVESNWRKGLCTIQEFKGHMDGVLTLQF---NYRLLFTGSYDTTVAIWDLF 362
           ++Y  R  FKV+   R          GH   +L   F       + TG+ D T  IWD  
Sbjct: 119 LIYTPRAVFKVKPVTRSS----SAIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCD 174

Query: 363 TGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECIS-TYRGHTDSVMS 419
           T      LTGH + V  + +  + + + TGS+D TIR+W+   G+ +    RGH   + S
Sbjct: 175 TQTPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITS 234

Query: 420 V---------DSHKKIIVSGSADKTVKVWHVESRTC-YTLKGHTEWVNCVKLHPKSFSCY 469
           +               + S S D T+++W +  R C YT+ GHT  V+C+K   +    Y
Sbjct: 235 LAWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSGQGI-IY 293

Query: 470 SCSDDTTIRMWDIRTN-TCLRVFRGHVGQVQKVI------------------PLTIIDAQ 510
           S S D T+R+WD+  +  C+ + + H   V  +                   P +  DA+
Sbjct: 294 SGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDAR 353

Query: 511 N--LVTHE---RKPGEEDDIASNGTGE-----------DDPENGVNGQRELDKKMPYPT- 553
           +  L  +E   +K G+ +++    + +           + P   + G ++L   + +   
Sbjct: 354 DKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSPD 413

Query: 554 --HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDL 609
             +++S + DN+IKLW+ R G+ I T  GHV  V+ +A  AD   ++S S D ++K+WD+
Sbjct: 414 GRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDV 473

Query: 610 QSGKCMHTFHGRK 622
           ++ K      G K
Sbjct: 474 RTRKLSVDLPGHK 486

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 124/308 (40%), Gaps = 92/308 (29%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLI-TGSLDKTIRVWNY-ITG 404
           L + S D T+ IWD+     +  ++GH++ V  + +  Q +I +GS DKT+RVW+    G
Sbjct: 251 LASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSGQGIIYSGSHDKTVRVWDMNADG 310

Query: 405 ECISTYRGH----------TDSVMSVDSH------------------------------- 423
           +CI+  + H          TD  + V +                                
Sbjct: 311 KCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKALANYEKVVKKNGKL 370

Query: 424 KKIIVSGSADKTVKVWHV--ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWD 481
           ++++V+ S D T+ +W+    ++    + GH + VN V   P      S S D +I++WD
Sbjct: 371 EELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 430

Query: 482 IRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNG 541
            R    +  FRGHV  V +V                                        
Sbjct: 431 GRDGKFISTFRGHVASVYQV---------------------------------------- 450

Query: 542 QRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGS 599
               D ++     L+SC+ D T+K+W+VR+ +      GH + V+  D + D  R+ SG 
Sbjct: 451 AWSADCRL-----LVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGG 505

Query: 600 HDGSIKIW 607
            D  ++IW
Sbjct: 506 KDKMVRIW 513

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 94/222 (42%), Gaps = 47/222 (21%)

Query: 327 IQEFKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFT-GKLIRRLTGHSDGVKTL---- 380
           +    GH + V  ++++ + ++++GS+D TV +WD+   GK I  L  H+  V  L    
Sbjct: 271 LYTMSGHTNSVSCIKWSGQGIIYSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLST 330

Query: 381 -------YFD------------------------------DQKLITGSLDKTIRVWNYI- 402
                   FD                              ++ ++T S D T+ +WN + 
Sbjct: 331 DYALRVGAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLK 390

Query: 403 TGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWH-VESRTCYTLKGHTEWVNCV 459
           + + I+   GH   V  ++     + IVS S D ++K+W   + +   T +GH   V  V
Sbjct: 391 SNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQV 450

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
                     SCS DTT+++WD+RT        GH  +V  V
Sbjct: 451 AWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTV 492

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (48%), Gaps = 6/119 (5%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           I    GH   V  + F+   R + + S+D ++ +WD   GK I    GH   V  + +  
Sbjct: 395 IARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSA 454

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVW 439
           D + L++ S D T++VW+  T +      GH D V +VD     K + SG  DK V++W
Sbjct: 455 DCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           I  F+GH+  V  + ++   RLL + S DTT+ +WD+ T KL   L GH D V T+ +  
Sbjct: 437 ISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSV 496

Query: 383 DDQKLITGSLDKTIRVWNY 401
           D +++ +G  DK +R+W +
Sbjct: 497 DGKRVCSGGKDKMVRIWTH 515

>Kwal_23.6324
          Length = 514

 Score =  105 bits (263), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 103/366 (28%), Positives = 161/366 (43%), Gaps = 67/366 (18%)

Query: 308 MVYRER--FKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRL---LFTGSYDTTVAIWDLF 362
           +VY  R  FKV    R          GH   +L   F       + TGS D T  IWD  
Sbjct: 118 IVYTPRAVFKVRPVTRSS----SAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCN 173

Query: 363 TGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECIS-TYRGHTDSVMS 419
           T   +  L GH + V  + +  D + + TGS+D TIR+W+   GE      RGH   + S
Sbjct: 174 TNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITS 233

Query: 420 VD---------SHKKIIVSGSADKTVKVWHVESRTC-YTLKGHTEWVNCVKLHPKSFSCY 469
           +            +  + S S D T+K+W    R C  TL GHT  V+CVK   +    Y
Sbjct: 234 LTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGI-LY 292

Query: 470 SCSDDTTIRMWDIRTN-TCLRVFRGHVGQVQKV-------IPLTIID------------- 508
           S S D TIR WD+     C+ + + H   +  +       + +   D             
Sbjct: 293 SGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEAR 352

Query: 509 AQNLVTHER---KPGEEDDIASNGTGEDD-------------PENGVNGQRELDKKMPYP 552
           A+ L  +E+   K G+ +++    T  DD             P   + G ++L   + + 
Sbjct: 353 AKALKNYEKIAKKNGQLEELMV--TASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFS 410

Query: 553 T---HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIW 607
               +++S + DN+IKLW+ R+G  I T  GHV  V+ +A  +D   ++S S D ++K+W
Sbjct: 411 PDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW 470

Query: 608 DLQSGK 613
           D+++ K
Sbjct: 471 DVRTKK 476

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 79/342 (23%), Positives = 132/342 (38%), Gaps = 101/342 (29%)

Query: 322 KGLCTIQEFKGHMDGVLTLQF---------NYRLLFTGSYDTTVAIWDLFTGKLIRRLTG 372
           KG    +  +GH   + +L +         +   L + S D T+ IWD      +  L+G
Sbjct: 216 KGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSG 275

Query: 373 HSDGVKTLYFDDQKLI-TGSLDKTIRVWNYITG-ECISTYRGH----------TDSVMSV 420
           H++ V  + +  + ++ +GS DKTIR W+   G +CI+  + H          TD  + V
Sbjct: 276 HTNSVSCVKWGGRGILYSGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNTDYALRV 335

Query: 421 DSH-------------------------------KKIIVSGSADKTVKVWHV--ESRTCY 447
            +                                ++++V+ S D T+ +W     S+   
Sbjct: 336 GAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPIT 395

Query: 448 TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTII 507
            + GH + VN V   P      S S D +I++WD R  T +  FRGHV  V +V   +  
Sbjct: 396 RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSS-- 453

Query: 508 DAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLW 567
           D + LV                                           SC+ D T+K+W
Sbjct: 454 DCRLLV-------------------------------------------SCSKDTTLKVW 470

Query: 568 EVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIW 607
           +VR+ +      GH + V+  D + D  R+ S   D  ++IW
Sbjct: 471 DVRTKKLSVDLPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           I  F+GH+  V  + ++   RLL + S DTT+ +WD+ T KL   L GH+D V T+ +  
Sbjct: 436 IATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTVDWSV 495

Query: 383 DDQKLITGSLDKTIRVWNY 401
           D +++ +   DK +R+W +
Sbjct: 496 DGKRVCSAGKDKMVRIWTH 514

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 10/76 (13%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQF-GHVEGV----WDI-----AADNFRIISGSHDGSI 604
           + + ++DNTI+LW+   G        GH + +    W+      A D  R+ S S DG+I
Sbjct: 200 IATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTI 259

Query: 605 KIWDLQSGKCMHTFHG 620
           KIWD     C+ T  G
Sbjct: 260 KIWDTTRRVCVLTLSG 275

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score =  105 bits (263), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 101/361 (27%), Positives = 159/361 (44%), Gaps = 65/361 (18%)

Query: 311 RERFKVESNWRKGLCTIQEFKGHMDGVLTLQF---NYRLLFTGSYDTTVAIWDLFTGKLI 367
           R  FKV+   R          GH   +L   F       + TG  D T  IWD  T    
Sbjct: 126 RAVFKVKPITRSS----SAIAGHGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPK 181

Query: 368 RRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECIS-TYRGHTDSVMSV---- 420
             L GH + V  + +  D + + TGS+D TIR+W+  +G+ +    RGH+  + S+    
Sbjct: 182 VTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEP 241

Query: 421 -----DSHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDD 474
                   K  + S S D T+++W    R C  TL GHT  V+CVK   +    YS S D
Sbjct: 242 IHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWGGEGI-LYSGSHD 300

Query: 475 TTIRMWDIRTN-TCLRVFRGHVGQVQK------------------VIPLTIIDA-----Q 510
            T+R WD++ N  C+ + + H   V                    V P    +A     Q
Sbjct: 301 KTVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQ 360

Query: 511 NLVTHERKPGEEDDIASNGTGEDD-------------PENGVNGQRELDKKM---PYPTH 554
           N     RK G+ +++    T  DD             P + + G ++L   +   P   +
Sbjct: 361 NYEKVARKNGKHEELMV--TASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKY 418

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSG 612
           ++S + DN+IKLW+ + G  + T  GHV  V+ +A  +D   ++S S D ++K+WD+++ 
Sbjct: 419 IVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTR 478

Query: 613 K 613
           K
Sbjct: 479 K 479

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 119/308 (38%), Gaps = 92/308 (29%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLI-TGSLDKTIRVWNYI-TG 404
           L + S D T+ IWD      +  L GH++ V  + +  + ++ +GS DKT+R W+    G
Sbjct: 253 LASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWGGEGILYSGSHDKTVRAWDMKQNG 312

Query: 405 ECISTYRGH----------TDSVMSVDS-------------------------------H 423
           +CI+  + H          TD  + V +                               H
Sbjct: 313 KCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNGKH 372

Query: 424 KKIIVSGSADKTVKVWHV--ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWD 481
           ++++V+ S D T+ +W+    ++    + GH + VN V   P      S S D +I++WD
Sbjct: 373 EELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWD 432

Query: 482 IRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNG 541
            +  T L  FR   G V  V  +       L                             
Sbjct: 433 GKEGTFLSTFR---GHVASVYQVAWSSDCRL----------------------------- 460

Query: 542 QRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGS 599
                        L+SC+ D T+K+W+V++ +      GH + V+  D + D  R+ SG 
Sbjct: 461 -------------LVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGG 507

Query: 600 HDGSIKIW 607
            D  +++W
Sbjct: 508 KDKMMRLW 515

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 91/222 (40%), Gaps = 47/222 (21%)

Query: 327 IQEFKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLF-TGKLIRRLTGHSDGVKTL---- 380
           +    GH + V  +++    +L++GS+D TV  WD+   GK I  L  H+  V  L    
Sbjct: 273 LMTLGGHTNSVSCVKWGGEGILYSGSHDKTVRAWDMKQNGKCINILKSHAHWVNHLSLST 332

Query: 381 -------YFD------------------------------DQKLITGSLDKTIRVWNYIT 403
                   FD                              ++ ++T S D T+ +WN + 
Sbjct: 333 DYALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLK 392

Query: 404 G-ECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCV 459
           G + IS   GH   V  ++     K IVS S D ++K+W  +  T   T +GH   V  V
Sbjct: 393 GTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQV 452

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
                     SCS DTT+++WD++T        GH  +V  V
Sbjct: 453 AWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTV 494

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 59/124 (47%), Gaps = 6/124 (4%)

Query: 322 KGLCTIQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKT 379
           KG   I    GH   V  + F  + + + + S+D ++ +WD   G  +    GH   V  
Sbjct: 392 KGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQ 451

Query: 380 LYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKT 435
           + +  D + L++ S D T++VW+  T +      GH D V +VD     K + SG  DK 
Sbjct: 452 VAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKM 511

Query: 436 VKVW 439
           +++W
Sbjct: 512 MRLW 515

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           +  F+GH+  V  + ++   RLL + S DTT+ +WD+ T KL   L GH D V T+ +  
Sbjct: 439 LSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSV 498

Query: 383 DDQKLITGSLDKTIRVWNY 401
           D +++ +G  DK +R+W +
Sbjct: 499 DGKRVCSGGKDKMMRLWTH 517

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 10/76 (13%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQF-GHVEGVWDIAADNF---------RIISGSHDGSI 604
           + + ++DNTI+LW+  SG+ +     GH + +  +  +           R+ S S DG+I
Sbjct: 203 IATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTI 262

Query: 605 KIWDLQSGKCMHTFHG 620
           +IWD     C+ T  G
Sbjct: 263 RIWDSSRRVCLMTLGG 278

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score =  105 bits (262), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 103/364 (28%), Positives = 159/364 (43%), Gaps = 63/364 (17%)

Query: 308 MVYRER--FKVESNWRKGLCTIQEFKGHMDGVLTLQF---NYRLLFTGSYDTTVAIWDLF 362
           +VY  R  FKV+   R          GH   +L   F       + TG+ D T  IWD  
Sbjct: 119 LVYTPRAIFKVKPVTRSS----SAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCD 174

Query: 363 TGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECIS-TYRGHTDSVMS 419
           T   +  L GH + V    +  D + + TGS+D TIR+W    G+      RGH+  + S
Sbjct: 175 TQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITS 234

Query: 420 VD---------SHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCY 469
           +            K  + + S D T+K+W    R C  TL GHT  V+CVK   K+   Y
Sbjct: 235 LSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNV-LY 293

Query: 470 SCSDDTTIRMWDIRTN-TCLRVFRGHVGQVQKV------------------IPLTIIDAQ 510
           S S D TIR WD+  N  C+ + + H   V  +                   P +  +AQ
Sbjct: 294 SGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQ 353

Query: 511 N--LVTHERKPGEEDDIAS-NGTGEDD-------------PENGVNGQRELDKKMPYPT- 553
              L  +E+    + D      T  DD             P   + G ++L   + +   
Sbjct: 354 QKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPD 413

Query: 554 --HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDL 609
             +++S + DN+IKLW+ R G+ + T  GHV  V+ +A  +D   ++S S D ++K+WD+
Sbjct: 414 GRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV 473

Query: 610 QSGK 613
           ++ K
Sbjct: 474 KTRK 477

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 121/308 (39%), Gaps = 92/308 (29%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK-LITGSLDKTIRVWNY-ITG 404
           L T S D T+ IWD      +  L GH+  V  + +  +  L +GS DKTIR W+  + G
Sbjct: 251 LATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNVLYSGSHDKTIRCWDMNLNG 310

Query: 405 ECISTYRGH----------TDSVMSVDS--HK---------------------------- 424
           +CI+  + H          TD  + + +  HK                            
Sbjct: 311 KCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDF 370

Query: 425 -KIIVSGSADKTVKVWHV--ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWD 481
            +++V+ S D T+ +W+    ++    + GH + VN V   P      S S D +I++WD
Sbjct: 371 EELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 430

Query: 482 IRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNG 541
            R    L  FRGHV  V +V   +  D + LV                            
Sbjct: 431 GRDGKFLSTFRGHVASVYQVAWSS--DCRLLV---------------------------- 460

Query: 542 QRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGS 599
                          SC+ D T+K+W+V++ +      GH + V+  D + D  R+ SG 
Sbjct: 461 ---------------SCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGG 505

Query: 600 HDGSIKIW 607
            D  ++IW
Sbjct: 506 KDKMVRIW 513

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 58/119 (48%), Gaps = 6/119 (5%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           I    GH   V  + F  + R + + S+D ++ +WD   GK +    GH   V  + +  
Sbjct: 395 ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSS 454

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVW 439
           D + L++ S D T++VW+  T +      GH D V +VD     K + SG  DK V++W
Sbjct: 455 DCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           +  F+GH+  V  + ++   RLL + S DTT+ +WD+ T KL   L GH D V T+ +  
Sbjct: 437 LSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSV 496

Query: 383 DDQKLITGSLDKTIRVWNY 401
           D +++ +G  DK +R+W +
Sbjct: 497 DGKRVCSGGKDKMVRIWTH 515

>Scas_721.115*
          Length = 318

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 100/210 (47%), Gaps = 17/210 (8%)

Query: 326 TIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFT-----GKLIRRLTGHSDGVK-- 378
           T++   G +  + T      LL +GS D T+  W L       G  +R   GHS  V+  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 379 TLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTV 436
           TL  D    ++ S DKT+R+W+  TGE    + GH   VMSV  D    +I+SGS DKT+
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 437 KVWHVESRTCYTLKGHTEWVNCVKLHPK-----SFSCYSCSDDTTIRMWDIRTNTCLRVF 491
           KVW ++ +   TL GH +WV+ V++ P      S +  S  +D  ++ W++        F
Sbjct: 132 KVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADF 191

Query: 492 RGHVGQVQKVIPLTIIDAQNLVTHERKPGE 521
            GH G V  V   T      L+    K GE
Sbjct: 192 VGHNGNVNTV---TASPDGTLIASAGKDGE 218

 Score = 79.7 bits (195), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 83/170 (48%), Gaps = 17/170 (10%)

Query: 327 IQEFKGH----MDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF 382
           ++ FKGH     D  LT    Y L  + S+D T+ +WD+ TG+  +R  GH   V ++  
Sbjct: 58  VRSFKGHSHIVQDCTLTQDGAYAL--SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAI 115

Query: 383 DDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSV-------DSHKKIIVSGSAD 433
           D +   +I+GS DKTI+VW  I G+C++T  GH D V  V       +     ++S   D
Sbjct: 116 DRKASMIISGSRDKTIKVWT-IKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGND 174

Query: 434 KTVKVWHV-ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
           K VK W++ + +      GH   VN V   P      S   D  I +W++
Sbjct: 175 KMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNL 224

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 104/266 (39%), Gaps = 56/266 (21%)

Query: 370 LTGHSDGVKTLYFDDQK---LITGSLDKTIRVWNYITGE------CISTYRGHTDSVM-- 418
           L GH+  V +L     +   L++GS DKT+  W  +TG+       + +++GH+  V   
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 419 SVDSHKKIIVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTI 477
           ++       +S S DKT+++W V +   Y    GH   V  V +  K+    S S D TI
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 478 RMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPEN 537
           ++W I+   CL    GH   V +V                 P +++D +           
Sbjct: 132 KVWTIK-GQCLATLLGHNDWVSQV--------------RIAPTDQNDDS----------- 165

Query: 538 GVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA--DNFRI 595
                            ++S   D  +K W +   +      GH   V  + A  D   I
Sbjct: 166 ---------------VTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLI 210

Query: 596 ISGSHDGSIKIWDLQSGKCMHTFHGR 621
            S   DG I +W+L   K M+T   +
Sbjct: 211 ASAGKDGEIMLWNLAEKKAMYTLSAQ 236

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 94/244 (38%), Gaps = 66/244 (27%)

Query: 409 TYRGHTDSVMSVDS---HKKIIVSGSADKTVKVWHVESR------TCYTLKGHTEWVNCV 459
           T  GH   V S+ +      +++SGS DKT+  W +            + KGH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKP 519
            L        S S D T+R+WD+ T    + F GH   V  V                  
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV------------------ 113

Query: 520 GEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQF 579
                                    +D+K    + ++S + D TIK+W ++ G+C+ T  
Sbjct: 114 ------------------------AIDRK---ASMIISGSRDKTIKVWTIK-GQCLATLL 145

Query: 580 GHVEGVWDIAA-------DNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNT-S 631
           GH + V  +         D+  +IS  +D  +K W+L   +    F G      +VNT +
Sbjct: 146 GHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHN---GNVNTVT 202

Query: 632 SNPD 635
           ++PD
Sbjct: 203 ASPD 206

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score =  102 bits (254), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 118/430 (27%), Positives = 179/430 (41%), Gaps = 84/430 (19%)

Query: 102 ISQLACP-----KEQADIHHII-------SKYTNSNDKVRKLILDGILTSSCFPQLSYIA 149
           IS +A P      E+  I  +I       S  T+  + +  LI  G++++    QLS + 
Sbjct: 82  ISPIASPCHTPEVEEPSIDEVIGTTVARLSSTTSHPNALTSLIF-GLVSNMDRTQLSDLV 140

Query: 150 QHINTMIKIDFISVLPQELSLKILGYLDCQSLCNASMVCKNWHLLADDDRV---WYHMCE 206
             I   +K D    LP E+++KIL  L  + +    +V +NW+ L ++  V   W  + E
Sbjct: 141 SIITDNLKRDLFQSLPNEITVKILLNLSSEDIFACLLVNRNWNRLIEEAPVVWKWLMLNE 200

Query: 207 QHI-DRKCPNCGWGLPLLHMKRARVCYIKAKNPNTTVNDRKMIQDNDNRISPLTDRTQGN 265
             + + + P+    LP          Y    NP+    DR  +   +N    L +    N
Sbjct: 201 GFVTEDQFPSYCNSLP--------SKYKHLINPD----DRFRLDFLENNWC-LQNWYDPN 247

Query: 266 ESPGAT----FSTNV--CTTASNNTVXXXXXXXXXXXENGRCRQKSWKMVYRERFKVESN 319
             PG T     STNV  C    NN +            +             + F +E N
Sbjct: 248 YKPGRTCLDGHSTNVVTCLQFENNYIITGADDKKINVYDAE----------NDLFLLELN 297

Query: 320 WRKGLCTIQEFKGHMDGVLTLQF-NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVK 378
                       GH  GV  L+F + ++L +GS D +V IW++ TGK      GH+  V+
Sbjct: 298 ------------GHEGGVWALKFVDGKILVSGSTDRSVRIWNIETGKCTHVFKGHTSTVR 345

Query: 379 TL----YFDDQKLITGSLDKTIRVWN----------------YITGE----CISTYRGHT 414
            L    Y D + ++TGS D T+ VW                 Y T E     +   RGH 
Sbjct: 346 CLEVVEYGDSKYIVTGSRDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHM 405

Query: 415 DSVMSVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSD 473
            SV +V  H +I++SGS D  + VW + S +  Y L GHT+ V       K   C S S 
Sbjct: 406 SSVRTVSGHGRIVISGSYDHNLMVWDIISMKLLYILTGHTDRVYSTIYDYKRNRCISASM 465

Query: 474 DTTIRMWDIR 483
           DTT+ +WD+ 
Sbjct: 466 DTTVMIWDLE 475

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 87/323 (26%), Positives = 133/323 (41%), Gaps = 56/323 (17%)

Query: 330 FKGHMDGVLT-LQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK-L 387
             GH   V+T LQF    + TG+ D  + ++D      +  L GH  GV  L F D K L
Sbjct: 255 LDGHSTNVVTCLQFENNYIITGADDKKINVYDAENDLFLLELNGHEGGVWALKFVDGKIL 314

Query: 388 ITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD----SHKKIIVSGSADKTVKVWHVES 443
           ++GS D+++R+WN  TG+C   ++GHT +V  ++       K IV+GS D T+ VW +  
Sbjct: 315 VSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPP 374

Query: 444 --------------RT-------CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
                         RT          L+GH   V  V  H +     S S D  + +WDI
Sbjct: 375 MKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSGHGR--IVISGSYDHNLMVWDI 432

Query: 483 RTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQ 542
            +   L +  GH  +V      TI D +      R      D        ++ EN  NG 
Sbjct: 433 ISMKLLYILTGHTDRVYS----TIYDYK----RNRCISASMDTTVMIWDLENIEN--NGT 482

Query: 543 RELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDG 602
                         +  +++   +  V S +C+   +GH   V  +   N  ++S + DG
Sbjct: 483 --------------TTTINDGASIKVVGSMKCL---YGHTALVGLLCLSNKFLVSAAADG 525

Query: 603 SIKIWDLQSGKCMHTFHGRKLKG 625
           SI+ WD        +FH   L  
Sbjct: 526 SIRGWDPNDYSRKFSFHHTNLAA 548

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 53/123 (43%), Gaps = 21/123 (17%)

Query: 330 FKGHMDGVLTLQFNYRL--LFTGSYDTTVAIWDLFT------------GKLIRR------ 369
             GH D V +  ++Y+     + S DTTV IWDL              G  I+       
Sbjct: 441 LTGHTDRVYSTIYDYKRNRCISASMDTTVMIWDLENIENNGTTTTINDGASIKVVGSMKC 500

Query: 370 LTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYI-TGECISTYRGHTDSVMSVDSHKKIIV 428
           L GH+  V  L   ++ L++ + D +IR W+        S +  +  ++ S   +  I+V
Sbjct: 501 LYGHTALVGLLCLSNKFLVSAAADGSIRGWDPNDYSRKFSFHHTNLAAITSFSMNDNILV 560

Query: 429 SGS 431
           SGS
Sbjct: 561 SGS 563

>Scas_592.4*
          Length = 318

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 137/314 (43%), Gaps = 35/314 (11%)

Query: 326 TIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFT-----GKLIRRLTGHSDGVK-- 378
           T++   G +  + T      LL +GS D T+  W L       G  +R   GHS  V+  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 379 TLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTV 436
           TL  D    ++ S DKT+R+W+  TGE    + GH   VMSV  D    +I+SGS DKT+
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 437 KVWHVESRTCYTLKGHTEWVNCVKLHPK-----SFSCYSCSDDTTIRMWDIRTNTCLRVF 491
           KVW ++ +   TL GH +WV+ V++ P      + +  S  +D  ++ W++        F
Sbjct: 132 KVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADF 191

Query: 492 RGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPY 551
            GH G V  V   T      L+    K GE   I      E      ++ Q E+      
Sbjct: 192 VGHNGNVNAV---TASPDGTLIASAGKDGE---IMLWNLAEKKAMYTLSAQDEVFSLAFS 245

Query: 552 PT-HLLSCALDNTIKLWEVRSGRCI---RTQFG---------HVEGVWDIAADNFRIISG 598
           P  + L+ A  + IK++ +     I   R +F           V   W  +AD   + +G
Sbjct: 246 PNRYWLAAATASGIKIFCLDPQSLIDDLRPEFAGYNKSAEPHAVSLAW--SADGQTLFAG 303

Query: 599 SHDGSIKIWDLQSG 612
             D  I++W + + 
Sbjct: 304 YTDSVIRVWQVMTA 317

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 104/266 (39%), Gaps = 56/266 (21%)

Query: 370 LTGHSDGVKTLYFDDQK---LITGSLDKTIRVWNYITGE------CISTYRGHTDSVM-- 418
           L GH+  V +L     +   L++GS DKT+  W  +TG+       + +++GH+  V   
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 419 SVDSHKKIIVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTI 477
           ++       +S S DKT+++W V +   Y    GH   V  V +  K+    S S D TI
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 478 RMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPEN 537
           ++W I+   CL    GH   V +V                 P +++D A           
Sbjct: 132 KVWTIK-GQCLATLLGHNDWVSQV--------------RIAPTDQNDDA----------- 165

Query: 538 GVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA--DNFRI 595
                            ++S   D  +K W +   +      GH   V  + A  D   I
Sbjct: 166 ---------------VTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLI 210

Query: 596 ISGSHDGSIKIWDLQSGKCMHTFHGR 621
            S   DG I +W+L   K M+T   +
Sbjct: 211 ASAGKDGEIMLWNLAEKKAMYTLSAQ 236

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 91/243 (37%), Gaps = 64/243 (26%)

Query: 409 TYRGHTDSVMSVDS---HKKIIVSGSADKTVKVWHVESR------TCYTLKGHTEWVNCV 459
           T  GH   V S+ +      +++SGS DKT+  W +            + KGH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKP 519
            L        S S D T+R+WD+ T    + F GH   V  V                  
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV------------------ 113

Query: 520 GEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQF 579
                                    +D+K    + ++S + D TIK+W ++ G+C+ T  
Sbjct: 114 ------------------------AIDRK---ASMIISGSRDKTIKVWTIK-GQCLATLL 145

Query: 580 GHVEGVWDIAA-------DNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSS 632
           GH + V  +         D   +IS  +D  +K W+L   +    F G    G+    ++
Sbjct: 146 GHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGH--NGNVNAVTA 203

Query: 633 NPD 635
           +PD
Sbjct: 204 SPD 206

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 96/192 (50%), Gaps = 14/192 (7%)

Query: 326 TIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFT-----GKLIRRLTGHSDGVK-- 378
           T++   G +  + T      +L +GS D T+  W L       G  +R   GHS  V+  
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDC 87

Query: 379 TLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTV 436
           T+  D +  ++ S DKT+R+W+  +G+CI  + GH   VMSV  D     IVS S DKTV
Sbjct: 88  TVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTV 147

Query: 437 KVWHVESRTCYTLKGHTEWVNCVKLHPK-----SFSCYSCSDDTTIRMWDIRTNTCLRVF 491
           KVW+       TL GH +WV+ V++ P      + +  S   D  +++WD+++ T    F
Sbjct: 148 KVWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADF 207

Query: 492 RGHVGQVQKVIP 503
            GH   V  V P
Sbjct: 208 IGHNNYVTTVTP 219

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/174 (32%), Positives = 89/174 (51%), Gaps = 13/174 (7%)

Query: 327 IQEFKGHMDGVL--TLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384
           ++ FKGH   V   T+  + +   + S+D T+ +WDL +GK I+R  GH   V ++  D 
Sbjct: 74  VRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDP 133

Query: 385 Q--KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV---DSHKK----IIVSGSADKT 435
           +  ++++ S DKT++VWN + G+C+ T  GH D V +V    S K      ++S   DK 
Sbjct: 134 RATQIVSASRDKTVKVWNTV-GDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKV 192

Query: 436 VKVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCL 488
           VKVW ++S T      GH  +V  V   P      S   D  I +W++   T L
Sbjct: 193 VKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTAL 246

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 106/266 (39%), Gaps = 56/266 (21%)

Query: 370 LTGHSDGVKTLYFDDQK---LITGSLDKTIRVWNYITGE------CISTYRGHTDSVM-- 418
           L GH+  V +L     +   L++GS DKT+  W  +TGE       + +++GH+  V   
Sbjct: 29  LEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWK-LTGEDQQYGVPVRSFKGHSHIVQDC 87

Query: 419 SVDSHKKIIVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTI 477
           +V    K  +S S DKT+++W ++S  C     GH   V  V + P++    S S D T+
Sbjct: 88  TVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTV 147

Query: 478 RMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPEN 537
           ++W+     C+    GH   V  V                 P E+ D A           
Sbjct: 148 KVWN-TVGDCVVTLLGHNDWVSNV--------------RIAPSEKSDDAVT--------- 183

Query: 538 GVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI--AADNFRI 595
                            ++S  +D  +K+W+++S        GH   V  +  + D    
Sbjct: 184 -----------------VISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIF 226

Query: 596 ISGSHDGSIKIWDLQSGKCMHTFHGR 621
            S   DG I +W+L     ++T   +
Sbjct: 227 ASAGKDGQIILWNLNEKTALYTLDAK 252

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 88/197 (44%), Gaps = 25/197 (12%)

Query: 313 RFKVESNWRK---------GLCTIQEFKGHMDGVLTLQFNYRL--LFTGSYDTTVAIWDL 361
           ++ + ++W K         G C I+ F GH   V+++  + R   + + S D TV +W+ 
Sbjct: 94  KYALSASWDKTLRLWDLQSGKC-IKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNT 152

Query: 362 FTGKLIRRLTGHSDGVKTLYF-------DDQKLITGSLDKTIRVWNYITGECISTYRGHT 414
             G  +  L GH+D V  +         D   +I+  +DK ++VW+  +    + + GH 
Sbjct: 153 -VGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHN 211

Query: 415 DSVMSVDSHK--KIIVSGSADKTVKVWHVESRTC-YTLKGHTEWVNCVKLHPKSFSCYSC 471
           + V +V       I  S   D  + +W++  +T  YTL    E V  V   P  +   + 
Sbjct: 212 NYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTLDAKDE-VFAVAFSPNRY-WLTA 269

Query: 472 SDDTTIRMWDIRTNTCL 488
           +  + I+++D+   T +
Sbjct: 270 ATASGIKIFDLEERTIV 286

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 80/199 (40%), Gaps = 54/199 (27%)

Query: 448 TLKGHTEWVNCVKLHPKSFS-CYSCSDDTTIRMW-----DIRTNTCLRVFRGHVGQVQKV 501
           TL+GH  WV  +   P   +   S S D T+  W     D +    +R F+GH   VQ  
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDC 87

Query: 502 IPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALD 561
                      VTH+ K                                   + LS + D
Sbjct: 88  T----------VTHDGK-----------------------------------YALSASWD 102

Query: 562 NTIKLWEVRSGRCIRTQFGHVEGVWDIAAD--NFRIISGSHDGSIKIWDLQSGKCMHTFH 619
            T++LW+++SG+CI+   GH   V  ++ D    +I+S S D ++K+W+   G C+ T  
Sbjct: 103 KTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWN-TVGDCVVTLL 161

Query: 620 GRKLKGSDVNTSSNPDHDE 638
           G     S+V  + +   D+
Sbjct: 162 GHNDWVSNVRIAPSEKSDD 180

>Kwal_26.8776
          Length = 433

 Score = 98.6 bits (244), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 95/200 (47%), Gaps = 8/200 (4%)

Query: 310 YRERFKVESNWRKGLCTIQEFKGHMDGVLTL---QFNYRLLFTGSYDTTVAIWDLFTGKL 366
           ++++ +++  W      ++   GH   V  +     +     TGS DTT+ +WD+ +GKL
Sbjct: 97  HKQQLELQPEWHAPWKLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKL 156

Query: 367 IRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK 424
              LTGH   V+++    +   + + S DK ++ W+      I  Y GH   V +VD H 
Sbjct: 157 KLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHP 216

Query: 425 KI--IVSGSADKTVKVWHVESR-TCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWD 481
            +  I S   D  V++W + +R    TL GH   +N VK  P      SCS D T+R+WD
Sbjct: 217 TLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKCFPVDPQIMSCSSDATVRLWD 276

Query: 482 IRTNTCLRVFRGHVGQVQKV 501
           IR     ++   H   V+ +
Sbjct: 277 IRAGKATKILTHHSKSVRAI 296

 Score = 86.7 bits (213), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 107/262 (40%), Gaps = 52/262 (19%)

Query: 365 KLIRRLTGHSDGVKTL---YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD 421
           KL+R + GH+  V+ +     D+    TGS D TI+VW+  +G+   T  GH  +V SV 
Sbjct: 112 KLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVA 171

Query: 422 SHKK--IIVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIR 478
             ++  ++ S S DK VK W +E         GH   VN V +HP      S   D  +R
Sbjct: 172 VSQRHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVR 231

Query: 479 MWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENG 538
           +WDIRT   +    GH   + +V                                     
Sbjct: 232 LWDIRTRLPVMTLAGHKSPINQV------------------------------------- 254

Query: 539 VNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFR-IIS 597
                   K  P    ++SC+ D T++LW++R+G+  +    H + V  IAA      ++
Sbjct: 255 --------KCFPVDPQIMSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAAHPAESSVA 306

Query: 598 GSHDGSIKIWDLQSGKCMHTFH 619
            +    ++ W    G+ +  +H
Sbjct: 307 TASTSDVRSWRHSDGQLLTNYH 328

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 67/187 (35%), Gaps = 48/187 (25%)

Query: 439 WHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIRTNTCLRVFRGHVGQ 497
           WH   +    + GH  WV CV   P   + ++  S+DTTI++WD+ +        GHV  
Sbjct: 107 WHAPWKLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMT 166

Query: 498 VQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLS 557
           V+ V              +R P                                   + S
Sbjct: 167 VRSV-----------AVSQRHP----------------------------------LMFS 181

Query: 558 CALDNTIKLWEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGKCM 615
            + D  +K W++     IR   GH  GV   D+      I S   D  +++WD+++   +
Sbjct: 182 ASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPV 241

Query: 616 HTFHGRK 622
            T  G K
Sbjct: 242 MTLAGHK 248

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 59/120 (49%), Gaps = 5/120 (4%)

Query: 325 CTIQEFKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-- 380
             I+++ GH  GV T+  +    L+ +   D  V +WD+ T   +  L GH   +  +  
Sbjct: 197 AAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKC 256

Query: 381 YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH-KKIIVSGSADKTVKVW 439
           +  D ++++ S D T+R+W+   G+       H+ SV ++ +H  +  V+ ++   V+ W
Sbjct: 257 FPVDPQIMSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAAHPAESSVATASTSDVRSW 316

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 27/59 (45%)

Query: 573 RCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTS 631
           R I    G V  V     DN    +GS+D +IK+WD+ SGK   T  G  +    V  S
Sbjct: 115 RVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVS 173

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 100/211 (47%), Gaps = 18/211 (8%)

Query: 326 TIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFT-----GKLIRRLTGHSDGVK-- 378
           T++   G +  + T      LL + S D T+  W L       G  +R   GHS  V+  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 379 TLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTV 436
           TL  D    ++ S DKT+R+W+  TGE    + GH   VMSVD  KK  +I+SGS DKT+
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 437 KVWHVESRTCYTLKGHTEWVNCVKLHPK------SFSCYSCSDDTTIRMWDIRTNTCLRV 490
           KVW ++ +   TL GH +WV+ V++ P       S +  S  +D  ++ W++        
Sbjct: 132 KVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEAD 191

Query: 491 FRGHVGQVQKVIPLTIIDAQNLVTHERKPGE 521
           F GH   +     LT      L+    K GE
Sbjct: 192 FIGHNSNINT---LTASPDGTLIASAGKDGE 219

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 107/269 (39%), Gaps = 61/269 (22%)

Query: 370 LTGHSDGVKTLYFDDQK---LITGSLDKTIRVWNYITGE------CISTYRGHTDSVM-- 418
           L GH+  V +L     +   L++ S DKT+  W  +TG+       + +++GH+  V   
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 419 SVDSHKKIIVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTI 477
           ++ +     +S S DKT+++W V +   Y    GH   V  V +  K+    S S D TI
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 478 RMWDIRTNTCLRVFRGH---VGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDD 534
           ++W I+   CL    GH   V QV +V+P                        N   +DD
Sbjct: 132 KVWTIK-GQCLATLLGHNDWVSQV-RVVP------------------------NEKADDD 165

Query: 535 PENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA--DN 592
                               ++S   D  +K W +   +      GH   +  + A  D 
Sbjct: 166 S-----------------VTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDG 208

Query: 593 FRIISGSHDGSIKIWDLQSGKCMHTFHGR 621
             I S   DG I +W+L + K M+T   +
Sbjct: 209 TLIASAGKDGEIMLWNLAAKKAMYTLSAQ 237

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 95/245 (38%), Gaps = 67/245 (27%)

Query: 409 TYRGHTDSVMSVDS---HKKIIVSGSADKTVKVWHVESR------TCYTLKGHTEWVNCV 459
           T  GH   V S+ +      +++S S DKT+  W +            + KGH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKP 519
            L        S S D T+R+WD+ T    + F GH   V  V                  
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV------------------ 113

Query: 520 GEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQF 579
                                   ++DKK    + ++S + D TIK+W ++ G+C+ T  
Sbjct: 114 ------------------------DIDKK---ASMIISGSRDKTIKVWTIK-GQCLATLL 145

Query: 580 GHVEGVWDIAA--------DNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNT- 630
           GH + V  +          D+  IIS  +D  +K W+L   +    F G     S++NT 
Sbjct: 146 GHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHN---SNINTL 202

Query: 631 SSNPD 635
           +++PD
Sbjct: 203 TASPD 207

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 44/88 (50%), Gaps = 3/88 (3%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQ 610
            + LS + D T++LW+V +G   +   GH   V   DI      IISGS D +IK+W ++
Sbjct: 78  AYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK 137

Query: 611 SGKCMHTFHGRKLKGSDVNTSSNPDHDE 638
            G+C+ T  G     S V    N   D+
Sbjct: 138 -GQCLATLLGHNDWVSQVRVVPNEKADD 164

>Kwal_23.5035
          Length = 744

 Score = 99.0 bits (245), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 92/336 (27%), Positives = 148/336 (44%), Gaps = 54/336 (16%)

Query: 330 FKGHMDGVLT-LQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFDDQKL 387
            +GH   ++T LQF    + TG+ D  + ++D  T K I +L+GH  GV  L Y  D  L
Sbjct: 365 LRGHTMKIVTCLQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGHDGIL 424

Query: 388 ITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD----SHKKIIVSGSADKTVKVWHVES 443
           ++GS D+++RVWN  +G+C   ++GHT +V  +D    + KK IV+GS D T+ VW + +
Sbjct: 425 VSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPN 484

Query: 444 --------RTCYT-------------LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
                     C               L+GH   V  V  H       S S D  + +WDI
Sbjct: 485 CNAEDYNPEVCEVFNTTDANPYFVGVLRGHMAAVRTVSGHGNI--VVSGSYDFNLMVWDI 542

Query: 483 RTNTCLRVFRGHVGQVQKVIPLTIIDAQN------LVTHERKPGEEDDIASNG-----TG 531
               CL V  GH  ++      TI D Q        +    K  +  D++ NG     T 
Sbjct: 543 AQMKCLYVLTGHTDRIYS----TIYDYQRNRCISAGMDSTVKVWDLADVSKNGPCTTITS 598

Query: 532 EDDPENGVNGQRELDKKMPYPTHLL--------SCALDNTIKLWEVRS-GRCIRTQFGHV 582
            ++P   V G     +       LL        S   D  ++ W+  +  R        +
Sbjct: 599 SNNPCTKVTGSSITLQGHTALVGLLGLSDKFLVSAGADGILRGWDSENYTRQFAYHHKDL 658

Query: 583 EGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTF 618
             +     ++  ++SGS +G+  I++L+SGK +H++
Sbjct: 659 SAITTFYVNDNILVSGS-EGNFNIYNLRSGKLIHSY 693

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 101/254 (39%), Gaps = 68/254 (26%)

Query: 370 LTGHSDGVKT-LYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-SHKKII 427
           L GH+  + T L F+D  +ITG+ DK IRV++  T + I+   GH   V ++   H  I+
Sbjct: 365 LRGHTMKIVTCLQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGHDGIL 424

Query: 428 VSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTC 487
           VSGS D++V                                         R+W+I++  C
Sbjct: 425 VSGSTDRSV-----------------------------------------RVWNIKSGKC 443

Query: 488 LRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGED-DPENGVNGQRELD 546
             VF+GH   V+ +  +     + +VT  R          N   ED +PE          
Sbjct: 444 THVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPE---------- 493

Query: 547 KKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKI 606
                      C + NT        G  +R   GH+  V  ++     ++SGS+D ++ +
Sbjct: 494 ----------VCEVFNTTDANPYFVG-VLR---GHMAAVRTVSGHGNIVVSGSYDFNLMV 539

Query: 607 WDLQSGKCMHTFHG 620
           WD+   KC++   G
Sbjct: 540 WDIAQMKCLYVLTG 553

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 124 SNDKVRKLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQSLCN 183
           S+   R L+   +++     +LS +   +   +K DFI+ LP E+S+ IL  L  + +  
Sbjct: 227 SDSAYRNLVFQ-LISKLSRSELSDLGTLVKDNLKRDFITSLPLEVSMNILTNLGFEDISR 285

Query: 184 ASMVCKNWH-LLADDDRVW 201
              V K W+ L+ D   +W
Sbjct: 286 CLSVSKAWNSLIRDTSYLW 304

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 94.0 bits (232), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 130/298 (43%), Gaps = 34/298 (11%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-DDQKLITGSLDKTIRVWNYITG 404
           LL +  YD T+  W+  TG  +R +      V  L   +D+KL+  +  + IR+++  T 
Sbjct: 4   LLVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDIKTS 63

Query: 405 EC--ISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVK 460
               ++++ GH  +V SV   +  K +V+ S D T+KVW + S +      H   VN V 
Sbjct: 64  NSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVV 123

Query: 461 LHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTII----DAQNLVTHE 516
           +HP      SC  D  IR+WD+  N C      H    +  +PL  +    D   LV   
Sbjct: 124 IHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDDVPLQSLSVASDGSMLVAAN 178

Query: 517 RK--------PGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPT---HLLSCALDNTIK 565
            K        P   D  ASN      P            ++   +   H+ +C+ D+T +
Sbjct: 179 NKGNCYVWEMPNHTD--ASNLK----PATKFKAHPSYITRVLLSSDVKHMATCSADHTAR 232

Query: 566 LWEVRSGRCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
           +W V     + +   GH   VWD A  AD+  +++ S D  +++WDL +   +  + G
Sbjct: 233 IWSVEDNFNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGG 290

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 83/224 (37%), Gaps = 56/224 (25%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384
           +  F+GH   V ++ F  + + + T S D T+ +WD+ +  + R    ++   + +   +
Sbjct: 68  VASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIHPN 127

Query: 385 Q-KLITGSLDKTIRVWNYITGECI------------------------------------ 407
           Q +LI+   D  IR+W+    +C                                     
Sbjct: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYVWE 187

Query: 408 -------------STYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVESRTCY--TLK 450
                        + ++ H   +  V   S  K + + SAD T ++W VE       TL 
Sbjct: 188 MPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDNFNLESTLD 247

Query: 451 GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
           GH  WV        S    + S D  +R+WD+ T   +R + GH
Sbjct: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGH 291

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 2/57 (3%)

Query: 330 FKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384
             GH   V    F  +   L T S D  V +WDL T  +IR+  GH  G   +  +D
Sbjct: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGAVCVALND 302

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 94.7 bits (234), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 113/267 (42%), Gaps = 54/267 (20%)

Query: 365 KLIRRLTGHSDGVKTL---YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MS 419
           KL R + GH+  V+ +     D+    TGS D TIRVW+  TG+   T +GH  +V  + 
Sbjct: 104 KLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDIC 163

Query: 420 VDSHKKIIVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIR 478
           + +    + S S DK VK W +E  T      G    V+ V LHP      S   D+ +R
Sbjct: 164 ISARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVR 223

Query: 479 MWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENG 538
           +WDIR+ +C+    GH G + KV                                     
Sbjct: 224 VWDIRSRSCVLTLAGHRGPINKV------------------------------------- 246

Query: 539 VNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAAD--NFRII 596
                   + +P    ++SC+ D T+KLW++ +G+ ++T   H   V D+A +   F   
Sbjct: 247 --------RCLPVDPQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFSFA 298

Query: 597 SGSHDGSIKIWDLQSGKCMHTFHGRKL 623
           S   D  I+ W L  G+ +  F+   L
Sbjct: 299 SACTD-DIRSWKLVDGQLLTNFNSEAL 324

 Score = 86.7 bits (213), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 76/151 (50%), Gaps = 5/151 (3%)

Query: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGEC 406
           TGS D+T+ +WDL TGKL   L GH   V+ +    +   + + S DK ++ W+      
Sbjct: 131 TGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISARHPYMFSASQDKLVKCWDLERNTV 190

Query: 407 ISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVESRTC-YTLKGHTEWVNCVKLHP 463
           +  + G    V SVD H    +IVS   D  V+VW + SR+C  TL GH   +N V+  P
Sbjct: 191 VRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLP 250

Query: 464 KSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
                 SCS D T+++WD+     ++    H
Sbjct: 251 VDPQIVSCSTDATVKLWDLVAGKPMKTLTHH 281

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 97/199 (48%), Gaps = 10/199 (5%)

Query: 439 WHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIRTNTCLRVFRGHVGQ 497
           WH   +    + GHT WV CV + P   + ++  S+D+TIR+WD+ T       +GH+  
Sbjct: 99  WHAPWKLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMT 158

Query: 498 VQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLS 557
           V+ +  ++          + K  +  D+  N T   D    ++G   +D   P    ++S
Sbjct: 159 VRDIC-ISARHPYMFSASQDKLVKCWDLERN-TVVRDFHGTLSGVHSVDLH-PSLDLIVS 215

Query: 558 CALDNTIKLWEVRSGRCIRTQFGH---VEGVWDIAADNFRIISGSHDGSIKIWDLQSGKC 614
              D+ +++W++RS  C+ T  GH   +  V  +  D  +I+S S D ++K+WDL +GK 
Sbjct: 216 AGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDP-QIVSCSTDATVKLWDLVAGKP 274

Query: 615 MHTF--HGRKLKGSDVNTS 631
           M T   H R ++    N +
Sbjct: 275 MKTLTHHKRNVRDLAFNPT 293

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 51/97 (52%), Gaps = 6/97 (6%)

Query: 326 TIQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHS---DGVKTL 380
            +++F G + GV  + L  +  L+ +   D+ V +WD+ +   +  L GH    + V+ L
Sbjct: 190 VVRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCL 249

Query: 381 YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV 417
             D Q +++ S D T+++W+ + G+ + T   H  +V
Sbjct: 250 PVDPQ-IVSCSTDATVKLWDLVAGKPMKTLTHHKRNV 285

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 321 RKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL 380
           R  + T+   +G ++ V  L  + +++ + S D TV +WDL  GK ++ LT H   V+ L
Sbjct: 230 RSCVLTLAGHRGPINKVRCLPVDPQIV-SCSTDATVKLWDLVAGKPMKTLTHHKRNVRDL 288

Query: 381 YFDDQKL-ITGSLDKTIRVWNYITGECISTY 410
            F+  +     +    IR W  + G+ ++ +
Sbjct: 289 AFNPTEFSFASACTDDIRSWKLVDGQLLTNF 319

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%)

Query: 573 RCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSS 632
           R I    G V  V     DN    +GS+D +I++WDL +GK   T  G  +   D+  S+
Sbjct: 107 RVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISA 166

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 96.7 bits (239), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 93/377 (24%), Positives = 144/377 (38%), Gaps = 99/377 (26%)

Query: 301 CRQKSWKMVYRERFKVESNWRKGLCTIQE--FKGHMDGVLT-LQFNYRLLFTGSYDTTVA 357
            +Q   ++ + E   +  NW       Q    +GHM  V+T LQF    + TG+ D  + 
Sbjct: 346 SQQDRLRLSFLENIFILKNWYNPKFVPQRTTLRGHMTSVITCLQFEDNYVITGADDKMIR 405

Query: 358 IWDLFTGKLIRRLTGHSDGVKTL-YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDS 416
           ++D    K + +L+GH  GV  L Y     L++GS D+T+RVW+   G C   ++GH  +
Sbjct: 406 VYDSINKKFLLQLSGHDGGVWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNST 465

Query: 417 VMSVD----SHKKIIVSGSADKTVKVW---------------------HVESRTCY---T 448
           V  +D     + K IV+GS D T+ VW                     H      Y    
Sbjct: 466 VRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGV 525

Query: 449 LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIID 508
           L+GH   V  V  H       S S D T+ +WD+    CL +  GH  ++      TI D
Sbjct: 526 LRGHMASVRTVSGHGN--IVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYS----TIYD 579

Query: 509 AQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWE 568
                 HERK                                     +S ++D TI++W+
Sbjct: 580 ------HERK-----------------------------------RCISASMDTTIRIWD 598

Query: 569 VR----SGRC----------------IRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWD 608
           +     +G C                + T  GH   V  +   +  ++S + DGSI+ WD
Sbjct: 599 LENIWNNGECSYATNSASPCAKILGAMYTLQGHTALVGLLRLSDKFLVSAAADGSIRGWD 658

Query: 609 LQSGKCMHTFHGRKLKG 625
                   ++H   L  
Sbjct: 659 ANDYSRKFSYHHTNLSA 675

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 94/238 (39%), Gaps = 55/238 (23%)

Query: 321 RKGLCTIQEFKGHMDGVLTLQF----NYRLLFTGSYDTTVAIWDLFTGK----------- 365
           +KG CT   FKGH   V  L      N + + TGS D T+ +W L               
Sbjct: 451 KKGCCT-HVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDY 509

Query: 366 ------------LIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGH 413
                        +  L GH   V+T+      +++GS D T+ VW+    +C+    GH
Sbjct: 510 PLVFHTPEENPYFVGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGH 569

Query: 414 TDSVMSV--DSHKKIIVSGSADKTVKVWHVES---------------------RTCYTLK 450
           TD + S   D  +K  +S S D T+++W +E+                        YTL+
Sbjct: 570 TDRIYSTIYDHERKRCISASMDTTIRIWDLENIWNNGECSYATNSASPCAKILGAMYTLQ 629

Query: 451 GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIID 508
           GHT  V  ++L  K     S + D +IR WD   N   R F  H   +  +    + D
Sbjct: 630 GHTALVGLLRLSDKFL--VSAAADGSIRGWD--ANDYSRKFSYHHTNLSAITTFYVSD 683

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%)

Query: 144 QLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQSLCNASMVCKNWH 192
           +LS +   I   +K D I+ LP E+SLKI  YL  + + N+  V +NW+
Sbjct: 258 ELSDLGTLIKDNLKRDLITSLPFEISLKIFNYLQFEDIINSLGVSQNWN 306

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 95.5 bits (236), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 98/374 (26%), Positives = 154/374 (41%), Gaps = 78/374 (20%)

Query: 310 YRERF----KVESNWRKGLCTIQE--FKGHMDGVLT-LQFNYRLLFTGSYDTTVAIWDLF 362
           YR+ F     +  NW       Q    KGHM  V+T LQF    + TG+ D  + I+D  
Sbjct: 338 YRQDFLMNCSILQNWYNPDFIPQRTTLKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSI 397

Query: 363 TGKLIRRLTGHSDGVKTL-YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD 421
           T K +  L+GH  GV  L Y  +  L++GS D+++R+WN   G+C   ++GHT +V  +D
Sbjct: 398 TKKFLIELSGHDGGVWALKYAGNGILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLD 457

Query: 422 --SHK--KIIVSGSADKTVKVW--------------------------HVESRTCY---T 448
              H+  K IV+GS D T+ +W                          H      Y    
Sbjct: 458 IVEHEGVKYIVTGSRDNTLHIWKLPQMSDSNIDEGMPNVYSNNGPLFFHSPEENPYFVGV 517

Query: 449 LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVI------ 502
           L+GH   V  V  H +     S S D  + +WDI    CL +  GH  ++   I      
Sbjct: 518 LRGHIASVRTVSGHGR--IVISGSYDNNLIVWDIIQMKCLYILMGHTDRIYSTIYDYKRN 575

Query: 503 ---------PLTIIDAQNL--------VTHERKPGEEDDIASNGTGEDDPENGVNGQREL 545
                     + I D QN+        VT+   P       +  TG   P   + G   L
Sbjct: 576 RCISASMDSTIKIWDLQNIWNNGECVNVTNATVP------CTKITG---PMMTLQGHTAL 626

Query: 546 DKKMPYP-THLLSCALDNTIKLWEVRS-GRCIRTQFGHVEGVWDIAADNFRIISGSHDGS 603
              +      L+S A D +++ W+     R       ++  +      +  ++SGS +G 
Sbjct: 627 VGLLKLSDKFLVSAAADGSLRGWDSSDYSRKFAYHHNNLSAITTFYMTDNILVSGS-EGQ 685

Query: 604 IKIWDLQSGKCMHT 617
             I++L++GK +H+
Sbjct: 686 FNIYNLRTGKLIHS 699

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 96/261 (36%), Gaps = 74/261 (28%)

Query: 370 LTGHSDGVKT-LYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-SHKKII 427
           L GH   V T L F+D  +ITG+ DK IR+++ IT + +    GH   V ++  +   I+
Sbjct: 364 LKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSITKKFLIELSGHDGGVWALKYAGNGIL 423

Query: 428 VSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTC 487
           VSGS D++V                                         R+W+I    C
Sbjct: 424 VSGSTDRSV-----------------------------------------RIWNIHLGKC 442

Query: 488 LRVFRGHVGQVQKVIPLTIIDAQNLVTHERK--------PGEEDDIASNGTGEDDPENGV 539
             VF+GH   V+ +  +     + +VT  R         P   D     G       NG 
Sbjct: 443 THVFKGHTSTVRCLDIVEHEGVKYIVTGSRDNTLHIWKLPQMSDSNIDEGMPNVYSNNGP 502

Query: 540 NGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGS 599
                 ++  PY   +L                       GH+  V  ++     +ISGS
Sbjct: 503 LFFHSPEEN-PYFVGVLR----------------------GHIASVRTVSGHGRIVISGS 539

Query: 600 HDGSIKIWDLQSGKCMHTFHG 620
           +D ++ +WD+   KC++   G
Sbjct: 540 YDNNLIVWDIIQMKCLYILMG 560

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 57/115 (49%), Gaps = 9/115 (7%)

Query: 109 KEQADIHHIISKYTNSNDKVR-KLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQE 167
           KE+A+   +++    S   V    ++  +L+     +LS I+  +   +K DF++ LP E
Sbjct: 208 KERAETERLLATIKASLGAVNMNHLIYSLLSGMHRSELSDISTLLRDNLKRDFVTSLPLE 267

Query: 168 LSLKILGYLDCQSLCNASMVCKNWH-LLADDDRVWYHMC-------EQHIDRKCP 214
           ++LKIL  L  +S+ N   V K+W+ L+     +W H+        +   D+K P
Sbjct: 268 ITLKILNKLPFESISNCLQVSKSWNRLINGTPALWKHLLLSESFVSKDSFDKKYP 322

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 93.6 bits (231), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 123/284 (43%), Gaps = 35/284 (12%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITG 404
             TGS DTT+ +WDL TGKL   L GH   V+ +   D+   L + S DKT++ W+    
Sbjct: 155 FITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKN 214

Query: 405 ECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVESRT-CYTLKGHTEWVNCVKL 461
           + I  Y GH   V +V  H    +I +   D  +K+W + +R    TL GH   +N V+ 
Sbjct: 215 QIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQC 274

Query: 462 HPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGE 521
            P      S S D T+R+WD+     ++V   H    ++ +  T +  +           
Sbjct: 275 TPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHH----KRSVRATALHPKEFSV---ASAC 327

Query: 522 EDDIASNGTGE-------DDPENGVNGQRELDKKMPYPTHLLSCALDN-TIKLWEVRSGR 573
            DDI S G  E       +  + G+     +++       +L    DN  +  ++ +SG 
Sbjct: 328 TDDIRSWGLAEGSLLTNFESEKTGIINTLSINQD-----DVLFAGGDNGVLSFYDYKSGH 382

Query: 574 -----CIRTQFGHVEGVWDIAADNF-----RIISGSHDGSIKIW 607
                  R   G +EG   +    F     R+I+G  D SIKIW
Sbjct: 383 KYQSLATREMVGSLEGERSVLCSTFDKTGLRLITGEADKSIKIW 426

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 109/266 (40%), Gaps = 54/266 (20%)

Query: 365 KLIRRLTGHSDGVKTLYFD---DQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MS 419
           KL R + GH   V+ +  D   ++  ITGS D T++VW+  TG+  +T  GH  +V  ++
Sbjct: 130 KLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVA 189

Query: 420 VDSHKKIIVSGSADKTVKVWHVE-SRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIR 478
           V      + S S DKTVK W +E ++      GH   V  V +HP      +   D+ I+
Sbjct: 190 VSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIK 249

Query: 479 MWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENG 538
           +WD+RT   +    GH G + +V   T +D Q                            
Sbjct: 250 LWDMRTRIPVITLVGHKGPINQV-QCTPVDPQ---------------------------- 280

Query: 539 VNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRII 596
                           ++S + D T++LW+V +G+ ++    H   V   A     F + 
Sbjct: 281 ----------------VVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFSVA 324

Query: 597 SGSHDGSIKIWDLQSGKCMHTFHGRK 622
           S   D  I+ W L  G  +  F   K
Sbjct: 325 SACTD-DIRSWGLAEGSLLTNFESEK 349

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 98/221 (44%), Gaps = 22/221 (9%)

Query: 439 WHVESRTCYTLKGHTEWVNCVKLHPKSFSCY-SCSDDTTIRMWDIRTNTCLRVFRGHVGQ 497
           WH   +    + GH  WV CV + P     + + S+DTT+++WD+ T        GHV  
Sbjct: 125 WHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMT 184

Query: 498 VQKVIPLTIIDAQNLV--THERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHL 555
           V+ V    + D    +    E K  +  D+  N     D    ++G R +    P    +
Sbjct: 185 VRDV---AVSDRHPYLFSVSEDKTVKCWDLEKNQIIR-DYYGHLSGVRTVSIH-PTLDLI 239

Query: 556 LSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGK 613
            +   D+ IKLW++R+   + T  GH   +  +     + +++S S D ++++WD+ +GK
Sbjct: 240 ATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGK 299

Query: 614 CMH--TFHGRKLKGSDVNTSSNPDHDERTKSAPVACVCIGD 652
            M   T H R ++     T+ +P      K   VA  C  D
Sbjct: 300 TMKVLTHHKRSVRA----TALHP------KEFSVASACTDD 330

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 94.7 bits (234), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 124/289 (42%), Gaps = 70/289 (24%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLT-------------GHSDGVKTLYF--DDQKLIT 389
           RL+  G  D+ + +W L    L  +L              GHS  V ++ F  D++ L++
Sbjct: 500 RLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVS 559

Query: 390 GSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVESRTCY 447
            S DKT+R+W+  T  C+ +Y+GH   V  V          +GS D+T ++W  +    Y
Sbjct: 560 ASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDH--IY 617

Query: 448 TLK---GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPL 504
            L+   GH   V+CV  HP      + S D T RMWDI+T   +R+F GH   V  V   
Sbjct: 618 PLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVA-- 675

Query: 505 TIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTI 564
              D + L T     G ED +                                      I
Sbjct: 676 VSPDGRWLTT-----GSEDGV--------------------------------------I 692

Query: 565 KLWEVRSGRCIRTQFGHVE-GVWDIA--ADNFRIISGSHDGSIKIWDLQ 610
            +W++ +G+ I+   GH +  V+ ++   +   ++SG  D S+++WDL+
Sbjct: 693 IVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 78.6 bits (192), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 106/260 (40%), Gaps = 66/260 (25%)

Query: 381 YFDDQKLIT-GSLDKTIRVWNYITGECIS--------------TYRGHTDSVMSVD--SH 423
           + DD +L+  G  D  I++W+ + G  +               T  GH+  V SV     
Sbjct: 495 FSDDSRLVAAGFQDSYIKLWS-LDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPD 553

Query: 424 KKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
            + +VS S DKTV++W +++ TC  + KGH   V  VK  P      + S D T R+W  
Sbjct: 554 NRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSC 613

Query: 483 RTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQ 542
                LR+F GH+  V  V                          NGT            
Sbjct: 614 DHIYPLRIFAGHLNDVDCVT----------------------FHPNGT------------ 639

Query: 543 RELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSH 600
                      ++L+ + D T ++W++++G  +R   GH   V  +A   D   + +GS 
Sbjct: 640 -----------YVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSE 688

Query: 601 DGSIKIWDLQSGKCMHTFHG 620
           DG I +WD+ +GK +    G
Sbjct: 689 DGVIIVWDIGTGKRIKQMRG 708

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 67/123 (54%), Gaps = 7/123 (5%)

Query: 330 FKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQ 385
           F GH++ V  +T   N   + TGS D T  +WD+ TG  +R   GH+  V ++    D +
Sbjct: 622 FAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGR 681

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSV---MSVDSHKKIIVSGSADKTVKVWHVE 442
            L TGS D  I VW+  TG+ I   RGH  S    +S +    I+VSG AD++V+VW ++
Sbjct: 682 WLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

Query: 443 SRT 445
             T
Sbjct: 742 KFT 744

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 81/170 (47%), Gaps = 7/170 (4%)

Query: 332 GHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD--QKL 387
           GH   V ++ F  + R L + S D TV +W L T   +    GH+  V  + F       
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYF 599

Query: 388 ITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVESRT 445
            TGS D+T R+W+      +  + GH + V  V  H     +++GS+DKT ++W +++  
Sbjct: 600 ATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGD 659

Query: 446 CYTL-KGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
              L  GHT  V  V + P      + S+D  I +WDI T   ++  RGH
Sbjct: 660 SVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGH 709

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 49/80 (61%), Gaps = 5/80 (6%)

Query: 326 TIQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHS-DGVKTLYF 382
           +++ F GH   V+++  +   R L TGS D  + +WD+ TGK I+++ GH    V +L F
Sbjct: 660 SVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSF 719

Query: 383 DDQK--LITGSLDKTIRVWN 400
           + +   L++G  D+++RVW+
Sbjct: 720 NKEGNILVSGGADQSVRVWD 739

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 7/74 (9%)

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWDLQS 611
           +L+S + D T++LW + +  C+ +  GH   VWD+          +GSHD + ++W    
Sbjct: 556 YLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLW---- 611

Query: 612 GKCMHTFHGRKLKG 625
             C H +  R   G
Sbjct: 612 -SCDHIYPLRIFAG 624

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 93.2 bits (230), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 83/295 (28%), Positives = 127/295 (43%), Gaps = 35/295 (11%)

Query: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGEC 406
           TGS DTT+ IWDL  GKL   L GH   V+ +    +   + + S DK ++ W+      
Sbjct: 140 TGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTA 199

Query: 407 ISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVESRT-CYTLKGHTEWVNCVKLHP 463
           I  + GH   V +VD H    II +   D  V++W + SR+    L GH   +N VK  P
Sbjct: 200 IRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLP 259

Query: 464 KSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQ--------NLVTH 515
                 SCS D T+R+WDI      +V   H   ++    LT+  A+        N V  
Sbjct: 260 VDPQIISCSGDATVRLWDIIAGKASKVLTHHSRNIRD---LTLHPAEFSFASVSTNDVRS 316

Query: 516 ERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCI 575
            + P  E  + +N   ++    G+     ++    +   LL+   D T+  ++ ++G   
Sbjct: 317 WKLP--EGQLLTNFQSQN---TGILNTVSIN----HDNVLLAGGDDGTLCFYDYKTGHKY 367

Query: 576 RTQF-----GHVEGVWDIAADNF-----RIISGSHDGSIKIWDLQSGKCMHTFHG 620
           ++       G +E    I    F     R+I+G  D SIKIW         TF G
Sbjct: 368 QSMMTTEVAGSLESERSILCSTFDVTGTRLITGEGDKSIKIWKQVPDATEDTFPG 422

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 107/265 (40%), Gaps = 54/265 (20%)

Query: 365 KLIRRLTGHSDGVKTL---YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MS 419
           KL + + GH+  V+ +     D++   TGS D TI++W+   G+   T  GH  SV  ++
Sbjct: 113 KLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIA 172

Query: 420 VDSHKKIIVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIR 478
           +      + S S DK VK W +E  T      GH   V+ V +HP      +   D  +R
Sbjct: 173 ISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVR 232

Query: 479 MWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENG 538
           +WDIR+ + + V  GH   + KV                                     
Sbjct: 233 LWDIRSRSEIMVLPGHKSPINKV------------------------------------- 255

Query: 539 VNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRII 596
                   K +P    ++SC+ D T++LW++ +G+  +    H   + D+      F   
Sbjct: 256 --------KCLPVDPQIISCSGDATVRLWDIIAGKASKVLTHHSRNIRDLTLHPAEFSFA 307

Query: 597 SGSHDGSIKIWDLQSGKCMHTFHGR 621
           S S +  ++ W L  G+ +  F  +
Sbjct: 308 SVSTN-DVRSWKLPEGQLLTNFQSQ 331

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 87/191 (45%), Gaps = 8/191 (4%)

Query: 439 WHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIRTNTCLRVFRGHVGQ 497
           WH   +    + GHT WV CV + P     ++  S+DTTI++WD+          GHV  
Sbjct: 108 WHAPWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMS 167

Query: 498 VQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLS 557
           V+  I ++          E K  +  D+  N T   D    ++G   +D   P    + +
Sbjct: 168 VRD-IAISKRHPYMFSASEDKLVKCWDLERN-TAIRDFHGHLSGVHTVDVH-PSLDIIAT 224

Query: 558 CALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKC- 614
              D  ++LW++RS   I    GH   +  +     + +IIS S D ++++WD+ +GK  
Sbjct: 225 AGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDPQIISCSGDATVRLWDIIAGKAS 284

Query: 615 -MHTFHGRKLK 624
            + T H R ++
Sbjct: 285 KVLTHHSRNIR 295

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 73/173 (42%), Gaps = 14/173 (8%)

Query: 332 GHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKT--LYFDDQKL 387
           GH+  V  +  + R   +F+ S D  V  WDL     IR   GH  GV T  ++     +
Sbjct: 163 GHVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDII 222

Query: 388 ITGSLDKTIRVWNYITGECISTYRGHTDSV-----MSVDSHKKIIVSGSADKTVKVWH-V 441
            T   D  +R+W+  +   I    GH   +     + VD     I+S S D TV++W  +
Sbjct: 223 ATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDPQ---IISCSGDATVRLWDII 279

Query: 442 ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
             +    L  H+  +  + LHP  FS  S S +  +R W +     L  F+  
Sbjct: 280 AGKASKVLTHHSRNIRDLTLHPAEFSFASVSTN-DVRSWKLPEGQLLTNFQSQ 331

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 590 ADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTS 631
            DN    +GS+D +IKIWDL +GK   T  G  +   D+  S
Sbjct: 133 VDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAIS 174

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 45/98 (45%), Gaps = 12/98 (12%)

Query: 327 IQEFKGHMDGVL-TLQFNY-RLLFTGSYDTTVAIWDLFTGK-----LIRRLTGHSDGVKT 379
           +  F+    G+L T+  N+  +L  G  D T+  +D  TG      +   + G  +  ++
Sbjct: 325 LTNFQSQNTGILNTVSINHDNVLLAGGDDGTLCFYDYKTGHKYQSMMTTEVAGSLESERS 384

Query: 380 LY---FD--DQKLITGSLDKTIRVWNYITGECISTYRG 412
           +    FD    +LITG  DK+I++W  +      T+ G
Sbjct: 385 ILCSTFDVTGTRLITGEGDKSIKIWKQVPDATEDTFPG 422

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 92.8 bits (229), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 79/158 (50%), Gaps = 5/158 (3%)

Query: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGEC 406
           TGS DTT+ IWDL TGKL   L+GH   VK +    +   + + S DK ++ W+      
Sbjct: 147 TGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISKRHPYMFSASEDKLVKCWDLEKNRV 206

Query: 407 ISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVESR-TCYTLKGHTEWVNCVKLHP 463
           I  Y GH   V +VD H    +I +   D  V++W + ++    T+ GH   +N VK  P
Sbjct: 207 IRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTMAGHKSPINRVKCLP 266

Query: 464 KSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
                 SCS D T+R+WDI     L+V   H   V+ +
Sbjct: 267 VDPQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDI 304

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 110/266 (41%), Gaps = 54/266 (20%)

Query: 365 KLIRRLTGHSDGVKTLY---FDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MS 419
           KL+R + GH+  V+T+     D++   TGS D TI++W+  TG+   T  GH  +V  + 
Sbjct: 120 KLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDIC 179

Query: 420 VDSHKKIIVSGSADKTVKVWHVE-SRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIR 478
           +      + S S DK VK W +E +R      GH   V+ V +HP      +   D+ +R
Sbjct: 180 ISKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVR 239

Query: 479 MWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENG 538
           +WDIRT   +    GH   + +V                                     
Sbjct: 240 LWDIRTKLPVMTMAGHKSPINRV------------------------------------- 262

Query: 539 VNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRII 596
                   K +P    ++SC+ D T++LW++ +G+ ++    H   V DI      F I 
Sbjct: 263 --------KCLPVDPQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHPGEFSIS 314

Query: 597 SGSHDGSIKIWDLQSGKCMHTFHGRK 622
           S   D  I+ W L  G+ +  F   K
Sbjct: 315 SACTD-DIRSWKLPEGQLLTNFQSEK 339

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 113/283 (39%), Gaps = 49/283 (17%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKT--LYFDDQKLITGSLDKTIRVWNYITG 404
           +F+ S D  V  WDL   ++IR   GH  GV T  ++     + T   D  +R+W+  T 
Sbjct: 187 MFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTK 246

Query: 405 ECISTYRGHTDSV-----MSVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNC 458
             + T  GH   +     + VD     +VS SAD TV++W + + +T   L  H   V  
Sbjct: 247 LPVMTMAGHKSPINRVKCLPVDPQ---VVSCSADATVRLWDITAGKTLKVLTHHKRSVRD 303

Query: 459 VKLHPKSFSCYS-CSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHER 517
           + +HP  FS  S C+DD  IR W +     L  F+     +   + +             
Sbjct: 304 IGIHPGEFSISSACTDD--IRSWKLPEGQLLTNFQSEKTGIINTLSI------------- 348

Query: 518 KPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRT 577
               +DD+   G+     +NGV    +      Y T      LD T     + S R I T
Sbjct: 349 ---NQDDVLFAGS-----DNGVLSFYD------YKTGHKYQQLDTTEIPGSLESERGILT 394

Query: 578 QFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
                 G+        R+I+G  D SIKIW         T+ G
Sbjct: 395 STFDQTGL--------RLITGESDKSIKIWKQDQDATPETYTG 429

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 87/191 (45%), Gaps = 8/191 (4%)

Query: 439 WHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIRTNTCLRVFRGHVGQ 497
           WH   +    + GH  WV  V + P     ++  S+DTTI++WD+ T        GH+  
Sbjct: 115 WHAPWKLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMT 174

Query: 498 VQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLS 557
           V K I ++          E K  +  D+  N    D     ++G   +D   P    + +
Sbjct: 175 V-KDICISKRHPYMFSASEDKLVKCWDLEKNRVIRD-YHGHLSGVHTVDIH-PTLNLIAT 231

Query: 558 CALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCM 615
              D+ ++LW++R+   + T  GH   +  +     + +++S S D ++++WD+ +GK +
Sbjct: 232 AGRDSVVRLWDIRTKLPVMTMAGHKSPINRVKCLPVDPQVVSCSADATVRLWDITAGKTL 291

Query: 616 H--TFHGRKLK 624
              T H R ++
Sbjct: 292 KVLTHHKRSVR 302

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 27/56 (48%)

Query: 573 RCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDV 628
           R I    G V  V     DN    +GS+D +IKIWDL +GK   T  G  +   D+
Sbjct: 123 RVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDI 178

 Score = 33.1 bits (74), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 12/98 (12%)

Query: 327 IQEFKGHMDGVL-TLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRL--------TGHSDG 376
           +  F+    G++ TL  N   +LF GS +  ++ +D  TG   ++L             G
Sbjct: 332 LTNFQSEKTGIINTLSINQDDVLFAGSDNGVLSFYDYKTGHKYQQLDTTEIPGSLESERG 391

Query: 377 VKTLYFDDQ--KLITGSLDKTIRVWNYITGECISTYRG 412
           + T  FD    +LITG  DK+I++W         TY G
Sbjct: 392 ILTSTFDQTGLRLITGESDKSIKIWKQDQDATPETYTG 429

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 94.0 bits (232), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 109/253 (43%), Gaps = 48/253 (18%)

Query: 390 GSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVW-------- 439
           G LD T+++W+      I    GH  ++  M ++     +V+G  D  +K+W        
Sbjct: 417 GYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGGRDAALKLWNLNLAQQL 476

Query: 440 ------------HVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTC 487
                       H++S   +T + HT+ V  + L P SF   S S D TIR WD+R+  C
Sbjct: 477 YQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDP-SF-LVSGSQDRTIRQWDLRSGKC 534

Query: 488 LRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDK 547
           L+        V        +    L+T                         N +  +  
Sbjct: 535 LQTIDLSFANVLTTSTNVDLSKSTLLTQR-----------------------NERPSIGA 571

Query: 548 KMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIW 607
              +   L +   D  ++LW++RSG+ IRT  GH + +  +  D+  +++GS+D +++IW
Sbjct: 572 LQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIW 631

Query: 608 DLQSGKCMHTFHG 620
           DL++G  ++ FH 
Sbjct: 632 DLRTG-LLNKFHA 643

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 92/218 (42%), Gaps = 49/218 (22%)

Query: 327 IQEFKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKLIRRLT------------- 371
           I E  GH+  +  +Q N  Y  L TG  D  + +W+L   + + + T             
Sbjct: 434 IGELAGHLATINCMQINRDYGTLVTGGRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSP 493

Query: 372 ------GHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTY--------------- 410
                  H+D V  L  D   L++GS D+TIR W+  +G+C+ T                
Sbjct: 494 CVHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVD 553

Query: 411 ---------RGHTDSVMSVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVK 460
                    R    S+ ++ S    + +G+ D  V++W + S +   TLKGHT+ +  +K
Sbjct: 554 LSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLK 613

Query: 461 LHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQV 498
               S    + S D T+R+WD+RT   L  F  +   V
Sbjct: 614 FD--SACLVTGSYDRTVRIWDLRTG-LLNKFHAYSAPV 648

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 62/97 (63%), Gaps = 2/97 (2%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGEC 406
           L TG+ D  V +WDL +GK+IR L GH+D + +L FD   L+TGS D+T+R+W+  TG  
Sbjct: 579 LATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG-L 637

Query: 407 ISTYRGHTDSVMSVDSHKKIIVSGSADK-TVKVWHVE 442
           ++ +  ++  V+S+D  ++      AD+ +V+++  E
Sbjct: 638 LNKFHAYSAPVLSLDLFQENAAVVVADEPSVQIYDSE 674

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 85/179 (47%), Gaps = 25/179 (13%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRR----------------- 369
           +  F+ H D V  L  +   L +GS D T+  WDL +GK ++                  
Sbjct: 495 VHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDL 554

Query: 370 -----LTGHSD--GVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDS 422
                LT  ++   +  L   D  L TG+ D  +R+W+  +G+ I T +GHTD++ S+  
Sbjct: 555 SKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKF 614

Query: 423 HKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWD 481
               +V+GS D+TV++W + +        ++  V  + L  ++ +    +D+ +++++D
Sbjct: 615 DSACLVTGSYDRTVRIWDLRTGLLNKFHAYSAPVLSLDLFQEN-AAVVVADEPSVQIYD 672

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 73/193 (37%), Gaps = 44/193 (22%)

Query: 350 GSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWN------- 400
           G  D TV IWDL     I  L GH   +  +    D   L+TG  D  +++WN       
Sbjct: 417 GYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGGRDAALKLWNLNLAQQL 476

Query: 401 ------------YITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYT 448
                       +I   C+ T+  HTD V ++      +VSGS D+T++ W + S  C  
Sbjct: 477 YQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQ 536

Query: 449 -----------------------LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN 485
                                  L    E  +   L     +  + + D  +R+WD+R+ 
Sbjct: 537 TIDLSFANVLTTSTNVDLSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSG 596

Query: 486 TCLRVFRGHVGQV 498
             +R  +GH   +
Sbjct: 597 KVIRTLKGHTDAI 609

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 545 LDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDG 602
           LD   P+ T   +  LD+T+K+W++     I    GH+  +    I  D   +++G  D 
Sbjct: 404 LDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGGRDA 463

Query: 603 SIKIWDLQSGKCMH 616
           ++K+W+L   + ++
Sbjct: 464 ALKLWNLNLAQQLY 477

>Scas_695.15
          Length = 327

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 130/298 (43%), Gaps = 30/298 (10%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDG-VKTLYF-DDQKLITGSLDKTIRVWNYIT 403
           +L +  YD T+  W+  TG +  R   HSD  V  L   +D+KL+  +  + +R+++  T
Sbjct: 24  ILVSAGYDHTIRFWEALTG-VCSRTIQHSDSQVNRLEITNDKKLLAAAGYQNVRLYDIRT 82

Query: 404 GE--CISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCV 459
                ++T+ GH  +V SV   +  K +V+ S D T+KVW V S +      H   VN V
Sbjct: 83  TNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV 142

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERK- 518
            +HP      SC  D TI++WD+  N C                    D   LV    K 
Sbjct: 143 VIHPNQGELISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKG 202

Query: 519 -------PGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPT---HLLSCALDNTIKLWE 568
                  P   D  ASN      P N  +  ++   ++   +   H+ +C+ D T K+W 
Sbjct: 203 DCYVWEMPNHTD--ASNLK----PINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWS 256

Query: 569 VRSGR----CIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
           V           T  GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 257 VGETEDDFNLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 314

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 88/229 (38%), Gaps = 60/229 (26%)

Query: 326 TIQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD 383
            +  F+GH   V ++ F  + + + T S D T+ +WD+ +  + R    ++   + +   
Sbjct: 87  AVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHP 146

Query: 384 DQ-KLITGSLDKTIRVWNYITGEC------------------------------------ 406
           +Q +LI+   D TI++W+    +C                                    
Sbjct: 147 NQGELISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKGDCYV 206

Query: 407 --------------ISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHV-ESRTCY-- 447
                         I+ +  H D +  V   S  K + + SAD+T K+W V E+   +  
Sbjct: 207 WEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFNL 266

Query: 448 --TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
             TL GH  WV        S    + S D  +R+WD+ T   +R + GH
Sbjct: 267 ETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 315

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 324 LCTIQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLFTGK----LIRRLTGHSDGV 377
           L  I +F  H D +  + L  + + + T S D T  IW +   +    L   L GH   V
Sbjct: 218 LKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFNLETTLDGHQRWV 277

Query: 378 KTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGH 413
               F  D   L+T S D  +R+W+  T E +  Y GH
Sbjct: 278 WDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 315

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 330 FKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384
             GH   V    F  +   L T S D  V +WDL T +++R+  GH  G   +  +D
Sbjct: 270 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 326

>Scas_624.11
          Length = 1205

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 133/276 (48%), Gaps = 32/276 (11%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITG 404
           +    + +T+ +WD   G L+ R   H   V+++ F   +   ++G  D TI+VW+  T 
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVWSLETN 85

Query: 405 ECISTYRGHTDSVMSVDSHKKI--IVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKL 461
           +C+ T  GH D + +V  HK++  I+S S D+T+++W+ ++R     L GH  +V C + 
Sbjct: 86  KCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQF 145

Query: 462 HPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGE 521
           HP      S S D TIR+WDI   + LR  + H              A    T + +   
Sbjct: 146 HPTDDLVVSASLDETIRVWDI---SGLR--KKH-------------SAPGTSTFDDQMAA 187

Query: 522 EDDIASNGTGEDDPENGVNGQ-RELDKKMPYPT--HLLSCALDNTIKLWEVRSGRC--IR 576
           + ++   G G+   +  + G  R ++    +PT   ++S + D  +KLW+  S +   + 
Sbjct: 188 QQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVD 247

Query: 577 TQFGH---VEGVWDIAADNFRIISGSHDGSIKIWDL 609
           T  GH   V+ V       F I+S   D +++IWDL
Sbjct: 248 TCRGHTNNVDCVIFHPTQKF-ILSVGEDKTLRIWDL 282

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 96/223 (43%), Gaps = 40/223 (17%)

Query: 319 NWRKGLCTIQEFKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDG 376
           ++R G   +  F+ H   V ++ F+    +  +G  D T+ +W L T K +  L GH D 
Sbjct: 39  DYRMG-TLLHRFEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVWSLETNKCLYTLNGHLDY 97

Query: 377 VKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSA 432
           ++T++F  +   +I+ S D+TIR+WN+   + I+   GH   VM    H    ++VS S 
Sbjct: 98  IRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLVVSASL 157

Query: 433 DKTVKVWHVESR-------------------------------TCYTLKGHTEWVNCVKL 461
           D+T++VW +                                    + L+GHT  VN    
Sbjct: 158 DETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVNWASF 217

Query: 462 HPKSFSCYSCSDDTTIRMWDIRTNTCLRV--FRGHVGQVQKVI 502
           HP      S SDD  +++W   +     V   RGH   V  VI
Sbjct: 218 HPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVI 260

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 91/200 (45%), Gaps = 39/200 (19%)

Query: 332 GHMDGVLTLQFNYRL--LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKL 387
           GH+D + T+ F+  L  + + S D T+ IW+    K I  LTGH+  V    F   D  +
Sbjct: 93  GHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLV 152

Query: 388 ITGSLDKTIRVWNYI----------------------------TGECISTY--RGHTDSV 417
           ++ SLD+TIRVW+                               G+C+  +   GHT  V
Sbjct: 153 VSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGV 212

Query: 418 MSVDSHKKI--IVSGSADKTVKVWHVESRTCY---TLKGHTEWVNCVKLHPKSFSCYSCS 472
                H  +  IVSGS D+ VK+W   S   +   T +GHT  V+CV  HP      S  
Sbjct: 213 NWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVIFHPTQKFILSVG 272

Query: 473 DDTTIRMWDIRTNTCLRVFR 492
           +D T+R+WD+     ++ F+
Sbjct: 273 EDKTLRIWDLDKRIPVKQFK 292

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 67/135 (49%), Gaps = 5/135 (3%)

Query: 365 KLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDS 422
           K++ +    S   K + F   +  ++      TI++W+Y  G  +  +  H   V SVD 
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDF 61

Query: 423 H--KKIIVSGSADKTVKVWHVESRTC-YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
           H  + I VSG  D T+KVW +E+  C YTL GH +++  V  H +     S SDD TIR+
Sbjct: 62  HPTQPIFVSGGDDYTIKVWSLETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRI 121

Query: 480 WDIRTNTCLRVFRGH 494
           W+ +    +    GH
Sbjct: 122 WNWQNRKEIACLTGH 136

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 71/189 (37%), Gaps = 48/189 (25%)

Query: 435 TVKVWHVESRTC-YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
           T+++W     T  +  + H   V  V  HP      S  DD TI++W + TN CL    G
Sbjct: 34  TIQLWDYRMGTLLHRFEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVWSLETNKCLYTLNG 93

Query: 494 HVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPT 553
           H+  ++ V                                             K++P+  
Sbjct: 94  HLDYIRTVF------------------------------------------FHKELPW-- 109

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQS 611
            ++S + D TI++W  ++ + I    GH   V        +  ++S S D +I++WD+  
Sbjct: 110 -IISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLVVSASLDETIRVWDISG 168

Query: 612 GKCMHTFHG 620
            +  H+  G
Sbjct: 169 LRKKHSAPG 177

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 4/69 (5%)

Query: 555 LLSCALDNTIKLWEVRSGRCI---RTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQS 611
           +L     +TI+LW+ R G  +       G V  V D        +SG  D +IK+W L++
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSV-DFHPTQPIFVSGGDDYTIKVWSLET 84

Query: 612 GKCMHTFHG 620
            KC++T +G
Sbjct: 85  NKCLYTLNG 93

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 61/133 (45%), Gaps = 9/133 (6%)

Query: 323 GLCTIQE-FKGHMDGVLTLQFNYRL--LFTGSYDTTVAIWDLFTGKL--IRRLTGHSDGV 377
           G C ++   +GH  GV    F+  L  + +GS D  V +W   + K   +    GH++ V
Sbjct: 197 GDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNV 256

Query: 378 KTLYF-DDQKLITG-SLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSA-DK 434
             + F   QK I     DKT+R+W+      +  ++   D    + SH  I + G+A D 
Sbjct: 257 DCVIFHPTQKFILSVGEDKTLRIWDLDKRIPVKQFKRENDRFWLIASHPNINLFGAAHDA 316

Query: 435 TVKVWHVE-SRTC 446
            + V+ ++  R C
Sbjct: 317 GIMVFKLDRERPC 329

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 131/284 (46%), Gaps = 30/284 (10%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITG 404
           +    + +T+ +WD   G L+ R   H   V+ + F   +   ++   D +I+VW+  T 
Sbjct: 26  VLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTH 85

Query: 405 ECISTYRGHTDSVMSVDSHKKI--IVSGSADKTVKVWHVESR-TCYTLKGHTEWVNCVKL 461
           +C+ T  GH D V +V  H ++  I+S S D+T+++W+ ++R     L GH  +V C + 
Sbjct: 86  KCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQF 145

Query: 462 HPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGE 521
           HP      S S D T+R+WDI   + LR  + H     +     +I  QNL         
Sbjct: 146 HPTEDLVVSASLDETVRIWDI---SGLR--KRHSAPGSQSFEEQMITQQNLF-------- 192

Query: 522 EDDIASNGTGEDDPENGVNGQ-RELDKKMPYPT--HLLSCALDNTIKLWEVRSGRC--IR 576
                  G G+   +  + G  R ++    +PT   ++S + D  +KLW + S +   + 
Sbjct: 193 -----DGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVD 247

Query: 577 TQFGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQSGKCMHTF 618
           T  GH   V  +    F+  IIS   D +I++WDL     +  F
Sbjct: 248 TCRGHTNNVDSVIFHPFQNLIISVGEDSTIRVWDLDKRTPVKQF 291

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/331 (22%), Positives = 125/331 (37%), Gaps = 86/331 (25%)

Query: 319 NWRKGLCTIQEFKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDG 376
           ++R G+  +  F+ H   V  + F+    L  +   D ++ +W L T K +  L GH D 
Sbjct: 39  DYRMGVL-LHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNGHLDY 97

Query: 377 VKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH--KKIIVSGSA 432
           V+T++F  +   +I+ S D+TIR+WN+     I+   GH   VM    H  + ++VS S 
Sbjct: 98  VRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASL 157

Query: 433 DKTVKVWHVESR-------------------------------TCYTLKGHTEWVNCVKL 461
           D+TV++W +                                    + L+GHT  VN    
Sbjct: 158 DETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKFILEGHTRGVNWASF 217

Query: 462 HPKSFSCYSCSDDTTIRMWDIRTNTCLRV--FRGHVGQVQKVIPLTIIDAQNLVTHERKP 519
           HP      S SDD  +++W + +     V   RGH   V  VI                 
Sbjct: 218 HPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVI----------------- 260

Query: 520 GEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQF 579
                                         P+   ++S   D+TI++W++     ++   
Sbjct: 261 ----------------------------FHPFQNLIISVGEDSTIRVWDLDKRTPVKQFK 292

Query: 580 GHVEGVWDIAA-DNFRIISGSHDGSIKIWDL 609
              +  W I A  N  +   +HD  I ++ L
Sbjct: 293 REQDRFWSIRAHPNVNLFGAAHDSGIMVFKL 323

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/191 (19%), Positives = 70/191 (36%), Gaps = 48/191 (25%)

Query: 435 TVKVW-HVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
           T+++W +      +  + H   V  V  HP      S  DD +I++W + T+ CL    G
Sbjct: 34  TIQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNG 93

Query: 494 HVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPT 553
           H+  V+ V                                              ++P+  
Sbjct: 94  HLDYVRTVF------------------------------------------FHTELPW-- 109

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQS 611
            ++S + D TI++W  ++ R I    GH   V           ++S S D +++IWD+  
Sbjct: 110 -IISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASLDETVRIWDISG 168

Query: 612 GKCMHTFHGRK 622
            +  H+  G +
Sbjct: 169 LRKRHSAPGSQ 179

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 555 LLSCALDNTIKLWEVRSGRCI---RTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQS 611
           +L     +TI+LW+ R G  +       G V GV D        +S   D SIK+W L +
Sbjct: 26  VLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGV-DFHPTQPLFVSAGDDYSIKVWSLST 84

Query: 612 GKCMHTFHG 620
            KC+ T +G
Sbjct: 85  HKCLFTLNG 93

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 62/128 (48%), Gaps = 8/128 (6%)

Query: 323 GLCTIQE-FKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKL--IRRLTGHSDGV 377
           G C ++   +GH  GV    F+    L+ +GS D  V +W + + K   +    GH++ V
Sbjct: 197 GDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNV 256

Query: 378 KTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSA-DK 434
            ++ F   +  +I+   D TIRVW+      +  ++   D   S+ +H  + + G+A D 
Sbjct: 257 DSVIFHPFQNLIISVGEDSTIRVWDLDKRTPVKQFKREQDRFWSIRAHPNVNLFGAAHDS 316

Query: 435 TVKVWHVE 442
            + V+ ++
Sbjct: 317 GIMVFKLD 324

>Scas_707.22
          Length = 730

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 95/379 (25%), Positives = 161/379 (42%), Gaps = 78/379 (20%)

Query: 298 NGRCRQKSWKMVYRERFKVESNWRKGLCTIQE--FKGHMDGVLT-LQFNYRLLFTGSYDT 354
           N   +   +K  + E  ++  NW       +     GH   V+T LQF    + TG+ D 
Sbjct: 317 NNNNKSSFFKEKFIESLRILQNWYNPSFKPERTTLTGHATSVVTCLQFEDDYVITGADDR 376

Query: 355 TVAIWDLFTGKLIRRLTGHSDGVKTLYFD-DQKLITGSLDKTIRVWNYITGECISTYRGH 413
            + I+D  + K ++ L+GH  GV  L +D D  +++GS D+++R+W+   G C   ++GH
Sbjct: 377 QLRIYDARSKKFLKELSGHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFKGH 436

Query: 414 TDSV--MSVDSHK--KIIVSGSADKTVKVWHV--------ESRTCY-----------TLK 450
           T +V  + + ++K  K IV+GS D T+ VW +        E    Y            L+
Sbjct: 437 TSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIKEEKFDGELPMVYNTPEENPYFVGVLR 496

Query: 451 GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQ 510
           GH   V  +  H       S S D  + +WDI    CL V  GH  ++      TI D  
Sbjct: 497 GHMASVRTISGHGN--IVISGSYDNNLMVWDIAQMKCLYVLIGHTDRIYS----TIYD-- 548

Query: 511 NLVTHER------------KPGEEDDIASNG-----TGEDDPENGVNGQ----------- 542
               H+R            K  + D+I +NG     T    P   + G            
Sbjct: 549 ----HKRQRCISASMDSTIKVWDLDNIWNNGNCTIITNSATPCTKITGSMLTLQGHTALV 604

Query: 543 ---RELDKKMPYPTHLLSCALDNTIKLWEVRS-GRCIRTQFGHVEGVWDIAADNFRIISG 598
              R  DK      +L+S A D +++ W+     R       ++  +     ++  ++SG
Sbjct: 605 GLLRLSDK------YLVSAAADGSLRGWDSNDYSRKFSYHHNNLSAITTFYMNDNILVSG 658

Query: 599 SHDGSIKIWDLQSGKCMHT 617
           S +G   +++L++GK +H+
Sbjct: 659 S-EGQFNVYNLRTGKLVHS 676

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 105/258 (40%), Gaps = 78/258 (30%)

Query: 370 LTGHSDGVKT-LYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-SHKKII 427
           LTGH+  V T L F+D  +ITG+ D+ +R+++  + + +    GH   V ++      II
Sbjct: 351 LTGHATSVVTCLQFEDDYVITGADDRQLRIYDARSKKFLKELSGHEGGVWALKYDADGII 410

Query: 428 VSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTC 487
           VSGS D++                                         +R+WDI+   C
Sbjct: 411 VSGSTDRS-----------------------------------------VRIWDIKRGCC 429

Query: 488 LRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVN-----GQ 542
             VF+GH   V+ +  +T  + + +VT  R                  +N ++      +
Sbjct: 430 THVFKGHTSTVRCLEIVTYKNMKYIVTGSR------------------DNTLHVWKLIKE 471

Query: 543 RELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDG 602
            + D ++P    + +   +N   +  +R         GH+  V  I+     +ISGS+D 
Sbjct: 472 EKFDGELPM---VYNTPEENPYFVGVLR---------GHMASVRTISGHGNIVISGSYDN 519

Query: 603 SIKIWDLQSGKCMHTFHG 620
           ++ +WD+   KC++   G
Sbjct: 520 NLMVWDIAQMKCLYVLIG 537

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%)

Query: 136 ILTSSCFPQLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQSLCNASMVCKNWHLL 194
           IL++     LS +   +N  +K D +S LP E++LKI  +L    + N   VC NW+ +
Sbjct: 234 ILSNLNRTALSDLNSVLNGNLKRDIVSSLPIEIALKIFQHLSYDDIFNCQSVCSNWNAI 292

>Kwal_27.12667
          Length = 721

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/275 (28%), Positives = 114/275 (41%), Gaps = 58/275 (21%)

Query: 372 GHSDGVKTLYFD---DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV---DSHKK 425
            H D +  L FD         G LD ++++WN      I    GH  SV  +   DSH  
Sbjct: 402 AHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQMEDSHS- 460

Query: 426 IIVSGSADKTVKVWHVESRTCYTLKGHTEWVN--CV-----------KLHPKSFSCYSCS 472
            +++G  D  +K+W +E        G TE     CV            LH +  S  S S
Sbjct: 461 -LITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEITALHFEGNSLVSGS 519

Query: 473 DDTTIRMWDIRTNTCLRVF------RGHVGQVQKVI---PLTIIDAQNLVTHERKPGEED 523
            D TIR WD+ T  CL+        RG  G   K+    P + I    L+TH   P    
Sbjct: 520 QDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKISSNNPRSSI----LLTHNDPP---- 571

Query: 524 DIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVE 583
                          V G  +      Y   + +   D  ++LW++RSG+ IRT  GH +
Sbjct: 572 ---------------VIGALQC-----YDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTD 611

Query: 584 GVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTF 618
            V  +  D+  +++GS D SI+IWDL++G     F
Sbjct: 612 AVTGLQFDSVNLVTGSLDRSIRIWDLRTGLLADAF 646

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 99/250 (39%), Gaps = 60/250 (24%)

Query: 321 RKGLCTIQEF-----------KGHMDGVLTLQFNY---RLLFTGSYDTTVAIWDLFTGKL 366
           RK   T+Q+F           K H D +  L F+     +   G  D +V IW+L     
Sbjct: 380 RKTYPTLQQFYEPGTQISSFPKAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQ 439

Query: 367 IRRLTGHSDGVKTLYFDD-QKLITGSLDKTIRVWNYITGE--------------CISTYR 411
           I  L GH   V  +  +D   LITG  D  +++W+    E              C+ T+ 
Sbjct: 440 IGALPGHLASVSCMQMEDSHSLITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFD 499

Query: 412 GHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTC-------YTLKGHTEWVNCVKL-HP 463
            H D + ++      +VSGS D+T++ W + +  C       +  +G +   + +   +P
Sbjct: 500 AHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKISSNNP 559

Query: 464 KS--------------FSCYSCS-----DDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPL 504
           +S                CY  +      D  +R+WD+R+   +R   GH   V  +   
Sbjct: 560 RSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGL--- 616

Query: 505 TIIDAQNLVT 514
              D+ NLVT
Sbjct: 617 -QFDSVNLVT 625

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 87/209 (41%), Gaps = 46/209 (22%)

Query: 327 IQEFKGHMDGVLTLQF-NYRLLFTGSYDTTVAIWDLFTGKL--------------IRRLT 371
           I    GH+  V  +Q  +   L TG  D  + +WD+   +               +    
Sbjct: 440 IGALPGHLASVSCMQMEDSHSLITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFD 499

Query: 372 GHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTY------RGHTDSVMSVDS--- 422
            H D +  L+F+   L++GS D+TIR W+  TG+C+ T       RG +     + S   
Sbjct: 500 AHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKISSNNP 559

Query: 423 -------------------HKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLH 462
                              +   + +G+ D  V++W + S +   TL+GHT+ V  ++  
Sbjct: 560 RSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQF- 618

Query: 463 PKSFSCYSCSDDTTIRMWDIRTNTCLRVF 491
             S +  + S D +IR+WD+RT      F
Sbjct: 619 -DSVNLVTGSLDRSIRIWDLRTGLLADAF 646

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 56/94 (59%), Gaps = 1/94 (1%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGEC 406
           + TG+ D  V +WDL +G++IR L GH+D V  L FD   L+TGSLD++IR+W+  TG  
Sbjct: 583 MATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQFDSVNLVTGSLDRSIRIWDLRTGLL 642

Query: 407 ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWH 440
              +  +   + S+    + I+  + +  V+V++
Sbjct: 643 ADAF-AYNSPISSLQFDLEHILVSNNESVVQVYN 675

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 67/146 (45%), Gaps = 29/146 (19%)

Query: 324 LCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLT------GHSDG- 376
           LC +  F  H+D +  L F    L +GS D T+  WDL TGK ++ +       G S G 
Sbjct: 493 LC-VHTFDAHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGF 551

Query: 377 ---------------------VKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTD 415
                                +  L   D  + TG+ D  +R+W+  +G+ I T  GHTD
Sbjct: 552 SKISSNNPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTD 611

Query: 416 SVMSVDSHKKIIVSGSADKTVKVWHV 441
           +V  +      +V+GS D+++++W +
Sbjct: 612 AVTGLQFDSVNLVTGSLDRSIRIWDL 637

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 100/253 (39%), Gaps = 67/253 (26%)

Query: 401 YITGECISTY-RGHTDSVMSVD---SHKKIIVSGSADKTVKVWHVESRT-CYTLKGHTEW 455
           Y  G  IS++ + H DS+  +D       +  +G  D +VK+W++  +T    L GH   
Sbjct: 390 YEPGTQISSFPKAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLAS 449

Query: 456 VNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTH 515
           V+C+++   S S  +   D  +++WDI                          A+ L   
Sbjct: 450 VSCMQME-DSHSLITGGRDALLKLWDIEK------------------------AEELYND 484

Query: 516 ERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCI 575
               GEE+          D         E+         L+S + D TI+ W++ +G+C+
Sbjct: 485 GATEGEEELCVHTFDAHVD---------EITALHFEGNSLVSGSQDRTIRQWDLTTGKCL 535

Query: 576 RT------QFGHVEGVWDIAADNFR----------------------IISGSHDGSIKIW 607
           +T        G   G   I+++N R                      + +G+ DG +++W
Sbjct: 536 QTIDINFANRGTSGGFSKISSNNPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLW 595

Query: 608 DLQSGKCMHTFHG 620
           DL+SG+ + T  G
Sbjct: 596 DLRSGQVIRTLEG 608

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 57/121 (47%), Gaps = 8/121 (6%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK 386
           I+  +GH D V  LQF+   L TGS D ++ IWDL TG L+     ++  + +L FD + 
Sbjct: 603 IRTLEGHTDAVTGLQFDSVNLVTGSLDRSIRIWDLRTG-LLADAFAYNSPISSLQFDLEH 661

Query: 387 LITGSLDKTIRVWN------YITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWH 440
           ++  + +  ++V+N      +  G+  S+     D V  +      +V G     V  W 
Sbjct: 662 ILVSNNESVVQVYNRKEDQHWTCGDA-SSASSENDLVEFIRYKNGYLVEGRTTGDVNAWA 720

Query: 441 V 441
           +
Sbjct: 721 I 721

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 72/203 (35%), Gaps = 65/203 (32%)

Query: 450 KGHTEWVNCVKLH-PKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIID 508
           K H + + C+    P    C +   D ++++W++   T +    GH+  V     + + D
Sbjct: 401 KAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVS---CMQMED 457

Query: 509 AQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWE 568
           + +L+T  R                                           D  +KLW+
Sbjct: 458 SHSLITGGR-------------------------------------------DALLKLWD 474

Query: 569 VRSGR--------------CIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKC 614
           +                  C+ T   HV+ +  +  +   ++SGS D +I+ WDL +GKC
Sbjct: 475 IEKAEELYNDGATEGEEELCVHTFDAHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKC 534

Query: 615 MHT----FHGRKLKGSDVNTSSN 633
           + T    F  R   G     SSN
Sbjct: 535 LQTIDINFANRGTSGGFSKISSN 557

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/256 (26%), Positives = 115/256 (44%), Gaps = 40/256 (15%)

Query: 372 GHSDGVKTLYFDDQ--KLIT-GSLDKTIRVWNYITGECISTYRGH--TDSVMSVDSHKKI 426
            H D +  L FD     L T G +D  +++W+Y     I    GH  T S M VD +  +
Sbjct: 402 AHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVATISCMQVDKNYNM 461

Query: 427 IVSGSADKTVKVWHV-----------ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDT 475
           + +GS D TVK+W+             S   +TL  H + V+   L+    +  + S D 
Sbjct: 462 VATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSS--LYIDGANLMTASQDK 519

Query: 476 TIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDP 535
           TIR WD+ +  C++VF               ++  +L  ++    + ++ +      + P
Sbjct: 520 TIRRWDLYSGKCIQVFD--------------VNFPSLSAYKSSFMKSNEDSMILKTVNTP 565

Query: 536 ENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRI 595
             G            +   L +   D  I+LW++R+G  +R   GH++ +  +  D   I
Sbjct: 566 IIG--------SIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATTI 617

Query: 596 ISGSHDGSIKIWDLQS 611
           ISGS DG+I++WDL+S
Sbjct: 618 ISGSLDGTIRLWDLRS 633

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 101/225 (44%), Gaps = 45/225 (20%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLF----------TGKLIRRLTGHS 374
           I   +GH+  +  +Q   NY ++ TGS D TV +W+              + +  L  H 
Sbjct: 440 IGAMEGHVATISCMQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHL 499

Query: 375 DGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTY---------------RGHTDSVM- 418
           D V +LY D   L+T S DKTIR W+  +G+CI  +               + + DS++ 
Sbjct: 500 DEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMIL 559

Query: 419 ---------SVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSC 468
                    S+ S    + +G+ D  +++W + +      L+GH + +  +K    + + 
Sbjct: 560 KTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFD--ATTI 617

Query: 469 YSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLV 513
            S S D TIR+WD+R+N    +        +K I     DA+++V
Sbjct: 618 ISGSLDGTIRLWDLRSNNLTDII-----SYEKPISSLDFDAKHIV 657

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 84/198 (42%), Gaps = 34/198 (17%)

Query: 317 ESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRL------ 370
           E N  + L T+     H+D V +L  +   L T S D T+  WDL++GK I+        
Sbjct: 485 EGNNSEALHTLD---AHLDEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPS 541

Query: 371 -------------------TGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYR 411
                              T ++  + ++   D  L TG+ D  IR+W+  TGE +    
Sbjct: 542 LSAYKSSFMKSNEDSMILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLE 601

Query: 412 GHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSC 471
           GH D++ S+      I+SGS D T+++W + S     +  + + ++ +    K     S 
Sbjct: 602 GHMDAITSLKFDATTIISGSLDGTIRLWDLRSNNLTDIISYEKPISSLDFDAKHIVVASN 661

Query: 472 SDDTTI------RMWDIR 483
             +T I        WD++
Sbjct: 662 EHNTHIYDRNDGNKWDLQ 679

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 86/228 (37%), Gaps = 59/228 (25%)

Query: 319 NWRKGLCTIQEFKGHMDGVLTLQFN--YRLLFTGSY-DTTVAIWDLFTGKLIRRLTGHSD 375
           N  K L TI   K H D +  L F+  +  L T  Y D  V +WD    + I  + GH  
Sbjct: 391 NSGKKLSTIP--KAHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVA 448

Query: 376 GVKTLYFDD--QKLITGSLDKTIRVWN-------YITG---ECISTYRGHTDSVMSVDSH 423
            +  +  D     + TGS D T+++WN       Y  G   E + T   H D V S+   
Sbjct: 449 TISCMQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSSLYID 508

Query: 424 KKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCS----------- 472
              +++ S DKT++ W + S  C         +    ++  S S Y  S           
Sbjct: 509 GANLMTASQDKTIRRWDLYSGKC---------IQVFDVNFPSLSAYKSSFMKSNEDSMIL 559

Query: 473 ----------------------DDTTIRMWDIRTNTCLRVFRGHVGQV 498
                                  D  IR+WD+RT   +RV  GH+  +
Sbjct: 560 KTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAI 607

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/235 (20%), Positives = 82/235 (34%), Gaps = 66/235 (28%)

Query: 405 ECISTYRGHTDSVMSVDSHKKI---------IVSGSADKTVKVWHVESRTCYTL-KGHTE 454
           E  +++ G   S+   D+H  +           S  A  TV+ ++   +   T+ K H +
Sbjct: 346 EIRTSFDGSKQSIEGKDNHNALNGFFEDASNKKSRKAQPTVQKYYNSGKKLSTIPKAHDD 405

Query: 455 WVNCVKLHPK-SFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLV 513
            + C+   P  S  C +   D  +++WD      +    GHV  +     + +    N+V
Sbjct: 406 AITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVATIS---CMQVDKNYNMV 462

Query: 514 THERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLW------ 567
                           TG  D                            T+KLW      
Sbjct: 463 ---------------ATGSKDA---------------------------TVKLWNANDVI 480

Query: 568 ----EVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTF 618
               E  +   + T   H++ V  +  D   +++ S D +I+ WDL SGKC+  F
Sbjct: 481 GRYEEGNNSEALHTLDAHLDEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVF 535

>Scas_721.32
          Length = 822

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 80/309 (25%), Positives = 125/309 (40%), Gaps = 83/309 (26%)

Query: 336 GVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIR--------------------RLTGH 373
           G+ +LQF  + RL+  G  D+ + +W L    L +                     L GH
Sbjct: 489 GMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGH 548

Query: 374 SDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK--KIIVS 429
           S  V +  F  D++ L++GS DKT+R+W+  T   + +Y+GH   V  V          +
Sbjct: 549 SGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFAT 608

Query: 430 GSADKTVKVWHVESRTCYTLK---GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
            S D+T ++W  +    Y L+   GH   V+CV  HP     ++ S D T RMWDI T  
Sbjct: 609 ASHDQTARLWSCDH--IYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGD 666

Query: 487 CLRVFRGHVGQV--QKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRE 544
            +R+F GH   V    V P    D + L T     G ED I                   
Sbjct: 667 SVRLFLGHTAPVLCTAVSP----DGRWLAT-----GSEDGI------------------- 698

Query: 545 LDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGV---WDIAADNFRIISGSHD 601
                              I LW++ + + ++   GH +          +   ++SG  D
Sbjct: 699 -------------------INLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGAD 739

Query: 602 GSIKIWDLQ 610
            S+++WDL+
Sbjct: 740 HSVRVWDLK 748

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 90/198 (45%), Gaps = 14/198 (7%)

Query: 325 CTIQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF 382
            ++  +KGH   V  +QF+       T S+D T  +W       +R   GH   V  + F
Sbjct: 582 TSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSF 641

Query: 383 DDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVM--SVDSHKKIIVSGSADKTVKV 438
                 + TGS DKT R+W+  TG+ +  + GHT  V+  +V    + + +GS D  + +
Sbjct: 642 HPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINL 701

Query: 439 WHV-ESRTCYTLKGHTE-WVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTC------LRV 490
           W +  ++    ++GH +  ++ +    +     S   D ++R+WD++ +T          
Sbjct: 702 WDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLKKSTAEPGPEPEEQ 761

Query: 491 FRGHVGQVQKVIPLTIID 508
           F G++G +   I   I D
Sbjct: 762 FVGYIGNLTASINQDIKD 779

 Score = 37.0 bits (84), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 9/80 (11%)

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWDLQS 611
           +LLS + D T++LW   +   + +  GH   VWD+          + SHD + ++W    
Sbjct: 563 YLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLW---- 618

Query: 612 GKCMHTFHGRKLKG--SDVN 629
             C H +  R   G  SDV+
Sbjct: 619 -SCDHIYPLRIFAGHLSDVD 637

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 89.7 bits (221), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 121/291 (41%), Gaps = 74/291 (25%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKL-------------IRRLTGHSDGVKTLYF--DDQKLIT 389
           RL   G  D+T+ +W L    L                L GHS  V ++ F  D++ L++
Sbjct: 511 RLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLS 570

Query: 390 GSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVESRTCY 447
            S DKT+R+W+  T  C+  Y+GH   V  V         ++ S D+T ++W  +    Y
Sbjct: 571 ASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDH--IY 628

Query: 448 TLK---GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPL 504
            L+   GH   V+C   HP     ++ S D T RMWDI+T   +R+F GH        P+
Sbjct: 629 PLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTS------PV 682

Query: 505 TIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTI 564
           T ++                                         P    L + + D TI
Sbjct: 683 TALEVS---------------------------------------PDGRWLTTGSEDGTI 703

Query: 565 KLWEVRSGRCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIWDLQ 610
            +W++ +G+ I+   GH  G   I +  F      +++G  D S+++WD++
Sbjct: 704 IVWDIGTGKRIKQMKGH--GKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 90.1 bits (222), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 129/279 (46%), Gaps = 30/279 (10%)

Query: 352 YDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECIST 409
           + +T+ +WD   G L+ R  GH   V+ + F   +   ++   D +I+VW+  T  C+ T
Sbjct: 31  FSSTIQLWDYRMGTLLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNRCLYT 90

Query: 410 YRGHTDSVMSVDSHKKI--IVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKLHPKSF 466
             GH D V +V  H ++  ++S S D+TV++W+ ++R     L GH  +V C + H    
Sbjct: 91  LTGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTED 150

Query: 467 SCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIA 526
              S S D T+R+WDI   + LR  + H              A  + ++E     + ++ 
Sbjct: 151 LVVSASLDETVRVWDI---SGLR--KKH-------------SAPGVTSYEDSLASQQNLL 192

Query: 527 SNGTGEDDPENGVNGQ-RELDKKMPYPT--HLLSCALDNTIKLWEVRSGRC--IRTQFGH 581
               G+   +  + G  R ++    +PT   +++   D  +KLW + S +   + T  GH
Sbjct: 193 DGAFGDCKVKFILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGH 252

Query: 582 VEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTF 618
              V  +    D   I+S + D +++IWDL     +  F
Sbjct: 253 TNNVDCVVFHPDQNLILSVAEDKTLRIWDLDKRTPVKQF 291

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/345 (22%), Positives = 134/345 (38%), Gaps = 86/345 (24%)

Query: 319 NWRKGLCTIQEFKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDG 376
           ++R G   +  F+GH   V  + F+    +  +   D ++ +W L T + +  LTGH D 
Sbjct: 39  DYRMG-TLLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNRCLYTLTGHLDY 97

Query: 377 VKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSA 432
           V+T++F  +   +I+ S D+T+R+WN+   + ++   GH   VM    H+   ++VS S 
Sbjct: 98  VRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDLVVSASL 157

Query: 433 DKTVKVWHVES-------------------------------RTCYTLKGHTEWVNCVKL 461
           D+TV+VW +                                 +  + L+GHT  VN    
Sbjct: 158 DETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWASF 217

Query: 462 HPKSFSCYSCSDDTTIRMWDIRTNTCLRVF--RGHVGQVQKVIPLTIIDAQNLVTHERKP 519
           HP      +  DD  +++W + +N    V   RGH   V  V+       QNL+      
Sbjct: 218 HPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVV---FHPDQNLI------ 268

Query: 520 GEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQF 579
                                               LS A D T+++W++     ++   
Sbjct: 269 ------------------------------------LSVAEDKTLRIWDLDKRTPVKQFK 292

Query: 580 GHVEGVWDIAA-DNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKL 623
              +  W I +  N  +   +HD  I I+ L   +   T +  +L
Sbjct: 293 RENDRFWLIRSHPNMSLFGAAHDSGIMIFKLDRERPAATTYQNQL 337

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 62/164 (37%), Gaps = 47/164 (28%)

Query: 459 VKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERK 518
           +  HP           +TI++WD R  T L  F GH G      P+  +D      H  +
Sbjct: 17  IAFHPSRPWALVALFSSTIQLWDYRMGTLLHRFEGHEG------PVRAVD-----FHPTQ 65

Query: 519 PGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQ 578
           P                                    +S   D +IK+W + + RC+ T 
Sbjct: 66  P----------------------------------IFVSAGDDASIKVWSLETNRCLYTL 91

Query: 579 FGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
            GH++ V  +   ++   +IS S D +++IW+ Q+ K +    G
Sbjct: 92  TGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTG 135

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 89.7 bits (221), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 128/285 (44%), Gaps = 57/285 (20%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITG 404
           + T  Y   V +W+  T   +R +      V+   F  +K  +I GS D  IRV+NY TG
Sbjct: 28  VLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTG 87

Query: 405 ECISTYRGHTDSVMSVDSH--KKIIVSGSADKTVKVWHVESRTCY--TLKGHTEWVNCVK 460
           E +  +  H D + S+  H  K  ++SGS D TVK+W+ E+      T +GH  +V CV 
Sbjct: 88  EKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVA 147

Query: 461 LHPKSFSCYSCS-DDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKP 519
            +PK  S ++    D T+++W +             GQ      LT              
Sbjct: 148 FNPKDPSTFASGCLDRTVKVWSL-------------GQSTPNFTLT-------------- 180

Query: 520 GEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQF 579
                     TG+   E GVN        +P   ++++ + D TIK+W+ ++  C+ T  
Sbjct: 181 ----------TGQ---ERGVNYVDYY--PLPDKPYMITASDDLTIKIWDYQTKSCVATLE 225

Query: 580 GHVEGVWDIAADNFR-----IISGSHDGSIKIWDLQSGKCMHTFH 619
           GH+    +++   F      IISGS DG++KIW+  + K   T +
Sbjct: 226 GHMS---NVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLN 267

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 76/165 (46%), Gaps = 11/165 (6%)

Query: 319 NWRKGLCTIQEFKGHMDGVLTLQFNYR---LLFTGSYDTTVAIWDLFTGKLIRRLT-GHS 374
           NW       Q F+GH   V+ + FN +      +G  D TV +W L        LT G  
Sbjct: 125 NWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQE 184

Query: 375 DGVKTL-YF---DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK--KIIV 428
            GV  + Y+   D   +IT S D TI++W+Y T  C++T  GH  +V     H    II+
Sbjct: 185 RGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIII 244

Query: 429 SGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCS 472
           SGS D T+K+W+  + +   TL    E   C+  HP     Y  S
Sbjct: 245 SGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIAS 289

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 103/264 (39%), Gaps = 55/264 (20%)

Query: 368 RRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMS--VDSH 423
           +  +  SD VK + F   +  ++T      + +WNY T   + + +     V +    + 
Sbjct: 7   KTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIAR 66

Query: 424 KKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
           K  I+ GS D  ++V++  +       + H +++  + +HP      S SDD T+++W+ 
Sbjct: 67  KNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNW 126

Query: 483 RTNTCL-RVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNG 541
             N  L + F GH   V  V                        A N      P++    
Sbjct: 127 ENNWALEQTFEGHEHFVMCV------------------------AFN------PKD---- 152

Query: 542 QRELDKKMPYPTHLLSCALDNTIKLWEV-RSGRCIRTQFGHVEGV----WDIAADNFRII 596
                     P+   S  LD T+K+W + +S        G   GV    +    D   +I
Sbjct: 153 ----------PSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMI 202

Query: 597 SGSHDGSIKIWDLQSGKCMHTFHG 620
           + S D +IKIWD Q+  C+ T  G
Sbjct: 203 TASDDLTIKIWDYQTKSCVATLEG 226

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 89.7 bits (221), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 131/284 (46%), Gaps = 30/284 (10%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITG 404
           +    + +T+ +WD   G L+ R   H   V+ L F   +   ++   D TI+VW+  T 
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTN 85

Query: 405 ECISTYRGHTDSVMSVDSHKKI--IVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKL 461
           +C+ T  GH D V +V  H+++  I+S S D+T+++W+ ++R     L GH  +V C + 
Sbjct: 86  KCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQF 145

Query: 462 HPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGE 521
           HP      S S D TIR+WDI   + LR  + H              A    + E +   
Sbjct: 146 HPTDDLIVSASLDETIRIWDI---SGLR--KRH-------------SAPGTSSFEEQMSA 187

Query: 522 EDDIASNGTGEDDPENGVNGQ-RELDKKMPYPT--HLLSCALDNTIKLWEVRSGRC--IR 576
           + ++     G+   +  + G  R ++    +PT   ++S + D  +KLW + + +   + 
Sbjct: 188 QQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVD 247

Query: 577 TQFGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQSGKCMHTF 618
           T  GH   V  +     +  IIS   D ++++WDL     +  F
Sbjct: 248 TCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQF 291

 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 92/200 (46%), Gaps = 39/200 (19%)

Query: 332 GHMDGVLTLQFNYRL--LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKL 387
           GH+D V T+ F+  L  + + S D T+ IW+    K I  LTGH+  V    F   D  +
Sbjct: 93  GHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLI 152

Query: 388 ITGSLDKTIRVWNY----------------------------ITGECISTY--RGHTDSV 417
           ++ SLD+TIR+W+                               G+C+  +   GHT  V
Sbjct: 153 VSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGV 212

Query: 418 MSVDSHK--KIIVSGSADKTVKVWHVESRTCY---TLKGHTEWVNCVKLHPKSFSCYSCS 472
                H    +IVSGS D+ VK+W + +   +   T +GHT  V+ V  HP      S  
Sbjct: 213 NWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVG 272

Query: 473 DDTTIRMWDIRTNTCLRVFR 492
           +D T+R+WD+   T ++ F+
Sbjct: 273 EDKTLRVWDLDKRTPVKQFK 292

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 65/135 (48%), Gaps = 5/135 (3%)

Query: 365 KLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDS 422
           K++ +    S   K + F   +  ++      TI++W+Y  G  +  +  H   V  +D 
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDF 61

Query: 423 H--KKIIVSGSADKTVKVWHVESRTC-YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
           H  + I VS   D T+KVW +++  C YTL GH ++V  V  H +     S SDD TIR+
Sbjct: 62  HPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRI 121

Query: 480 WDIRTNTCLRVFRGH 494
           W+ +    +    GH
Sbjct: 122 WNWQNRKEIACLTGH 136

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 57/164 (34%), Gaps = 47/164 (28%)

Query: 459 VKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERK 518
           +  HP           +TI++WD R  T L  F  H G V                    
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPV-------------------- 56

Query: 519 PGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQ 578
                                   R LD     P   +S   D TIK+W + + +C+ T 
Sbjct: 57  ------------------------RGLDFHPTQPI-FVSAGDDYTIKVWSLDTNKCLYTL 91

Query: 579 FGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQSGKCMHTFHG 620
            GH++ V  +        IIS S D +I+IW+ Q+ K +    G
Sbjct: 92  TGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTG 135

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 63/133 (47%), Gaps = 9/133 (6%)

Query: 323 GLCTIQE-FKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKL--IRRLTGHSDGV 377
           G C ++   +GH  GV    F+    L+ +GS D  V +W +   K   +    GH++ V
Sbjct: 197 GDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNV 256

Query: 378 KTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSA-DK 434
            ++ F   +  +I+   DKT+RVW+      +  ++   D    + +H  I + G+A D 
Sbjct: 257 DSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDS 316

Query: 435 TVKVWHVE-SRTC 446
            + V+ ++  R C
Sbjct: 317 GIMVFKLDRERPC 329

>Kwal_26.7570
          Length = 218

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 76/147 (51%), Gaps = 9/147 (6%)

Query: 326 TIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFT-----GKLIRRLTGHSDGVK-- 378
           T++   G +  + T      LL +GS D ++  W L       G  +R   GHS  V+  
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDC 71

Query: 379 TLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTV 436
           T+  D +  ++ S DKT+R+W   TG+CI  + GH   V+SV  D     IVS S DKTV
Sbjct: 72  TVTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTV 131

Query: 437 KVWHVESRTCYTLKGHTEWVNCVKLHP 463
           KVW+       TL GH +WV+ V++ P
Sbjct: 132 KVWNTLGECMVTLLGHNDWVSQVRVAP 158

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 3/93 (3%)

Query: 550 PYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKIW 607
           P   + LS + D T++LWE+ +G+CI+   GH   V  +  D    +I+S S D ++K+W
Sbjct: 75  PDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVW 134

Query: 608 DLQSGKCMHTFHGRKLKGSDVNTSSNPDHDERT 640
           +   G+CM T  G     S V  + N   ++ T
Sbjct: 135 NTL-GECMVTLLGHNDWVSQVRVAPNESPEDET 166

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 66/143 (46%), Gaps = 12/143 (8%)

Query: 370 LTGHSDGVKTLYFDDQK---LITGSLDKTIRVWNYIT-----GECISTYRGHTDSVM--S 419
           L GH+  V +L     +   L++GS DK++  W         G  + ++RGH+  V   +
Sbjct: 13  LEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCT 72

Query: 420 VDSHKKIIVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIR 478
           V    +  +S S DKTV++W + +  C     GH   V  V +  ++    S S D T++
Sbjct: 73  VTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVK 132

Query: 479 MWDIRTNTCLRVFRGHVGQVQKV 501
           +W+     C+    GH   V +V
Sbjct: 133 VWNT-LGECMVTLLGHNDWVSQV 154

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 7/78 (8%)

Query: 552 PTHLLSCALDNTIKLWEV-----RSGRCIRTQFGHVEGVWD--IAADNFRIISGSHDGSI 604
           P  LLS + D ++  W++     + G  +R+  GH   V D  +  D    +S S D ++
Sbjct: 30  PNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTV 89

Query: 605 KIWDLQSGKCMHTFHGRK 622
           ++W+L +GKC+  F G K
Sbjct: 90  RLWELATGKCIQRFVGHK 107

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 119/293 (40%), Gaps = 74/293 (25%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLI-----------------RRLTGHSDGVKTLYF--DDQ 385
           R+   G  D+ + IW L    L                  + L GHS  V +  F  D++
Sbjct: 479 RIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNK 538

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVES 443
            L++GS DKT+R+W+  T   + +Y+GH   V  +S         + S D+T ++W  + 
Sbjct: 539 YLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDH 598

Query: 444 RTCYTLK---GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQK 500
              Y L+   GH   V+CV  HP     ++ S D T RMWD+ T   +R+F GH   V  
Sbjct: 599 --IYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVIS 656

Query: 501 VIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCAL 560
           +      D + L T     G ED I                                   
Sbjct: 657 IA--VCPDGRWLST-----GSEDGI----------------------------------- 674

Query: 561 DNTIKLWEVRSGRCIRTQFGHVEGV---WDIAADNFRIISGSHDGSIKIWDLQ 610
              I +W++ +G+ ++   GH +        + +   +ISG  D ++++WDL+
Sbjct: 675 ---INVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 68/124 (54%), Gaps = 7/124 (5%)

Query: 330 FKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQ 385
           F GH++ V  + F  N   +FTGS D T  +WD+ TG  +R   GH+  V ++    D +
Sbjct: 605 FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGR 664

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK---IIVSGSADKTVKVWHVE 442
            L TGS D  I VW+  TG+ +   RGH  + +   S+ K   +++SG AD TV+VW ++
Sbjct: 665 WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

Query: 443 SRTC 446
             T 
Sbjct: 725 KATT 728

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 86/217 (39%), Gaps = 50/217 (23%)

Query: 409 TYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKS 465
           T  GH+ +V S       K ++SGS DKTV++W +++ T   + KGH   V  V   P  
Sbjct: 520 TLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLG 579

Query: 466 FSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDI 525
               + S D T R+W       LR+F GH+  V  V                        
Sbjct: 580 HYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCV----------------------SF 617

Query: 526 ASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGV 585
             NG                        ++ + + D T ++W+V +G  +R   GH   V
Sbjct: 618 HPNGC-----------------------YVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV 654

Query: 586 WDIAA--DNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
             IA   D   + +GS DG I +WD+ +GK +    G
Sbjct: 655 ISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRG 691

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 84/187 (44%), Gaps = 14/187 (7%)

Query: 330 FKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK- 386
           +KGH   V  + F+       T S+D T  +W       +R   GH + V  + F     
Sbjct: 563 YKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGC 622

Query: 387 -LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWHVES 443
            + TGS DKT R+W+  TG+ +  + GHT  V+S+      + + +GS D  + VW + +
Sbjct: 623 YVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGT 682

Query: 444 -RTCYTLKGHTE-WVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCL------RVFRGHV 495
            +    ++GH +  +  +    +     S   D T+R+WD++  T          F G++
Sbjct: 683 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTEPSAEPDEPFIGYL 742

Query: 496 GQVQKVI 502
           G V   I
Sbjct: 743 GDVTASI 749

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 7/74 (9%)

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWDLQS 611
           +LLS + D T++LW + +   + +  GH   VWD++         + SHD + ++W    
Sbjct: 539 YLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLW---- 594

Query: 612 GKCMHTFHGRKLKG 625
             C H +  R   G
Sbjct: 595 -SCDHIYPLRIFAG 607

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 95/200 (47%), Gaps = 23/200 (11%)

Query: 326 TIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFT-----GKLIRRLTGHSDGVKTL 380
           T++   G +  + T      LL +GS D T+  W L       G  +R   GHS  V+ +
Sbjct: 13  TLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDV 72

Query: 381 YF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTV 436
               D    ++ S DKT+R+WN  TG   + + GHT  V+SV  D++   I+S S DKT+
Sbjct: 73  VVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTI 132

Query: 437 KVWHVESRTCYTLKGHTEWVNCVKLHPKSF----------SCYSCSDDTTIRMWDIRTNT 486
           +VW+      Y L GHT+WV  V++ PK+           +  S   D  +R W +  ++
Sbjct: 133 RVWNTVGDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDS 192

Query: 487 CLRV---FRGHVGQVQKVIP 503
             R+   F GH   +  V P
Sbjct: 193 -YRIEADFIGHNNYINVVQP 211

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 85/186 (45%), Gaps = 24/186 (12%)

Query: 327 IQEFKGH----MDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF 382
           ++ +KGH     D V++   NY +  + S+D T+ +W+L TG    R  GH+  V ++  
Sbjct: 59  VRSYKGHSHIVQDVVVSADGNYAV--SASWDKTLRLWNLATGNSEARFVGHTGDVLSVAI 116

Query: 383 D--DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVM------------SVDSHKKIIV 428
           D    K+I+ S DKTIRVWN + G+C     GHTD V              VD  +   V
Sbjct: 117 DANSSKIISASRDKTIRVWNTV-GDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFV 175

Query: 429 SGSADKTVKVWHVES---RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN 485
           S   DK V+ W +     R      GH  ++N V+  P      S   D  I +W+++  
Sbjct: 176 SAGMDKIVRSWSLNEDSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHK 235

Query: 486 TCLRVF 491
           +    F
Sbjct: 236 SAFMNF 241

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 69/181 (38%), Gaps = 54/181 (29%)

Query: 448 TLKGHTEWVNCVKLHPKSFSCY-SCSDDTTIRMWDIRTN-----TCLRVFRGHVGQVQKV 501
           TL+GH  WV  +       +   S S D T+  W +  N       +R ++GH   VQ V
Sbjct: 13  TLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDV 72

Query: 502 IPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALD 561
           +                      ++++G                        + +S + D
Sbjct: 73  V----------------------VSADGN-----------------------YAVSASWD 87

Query: 562 NTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFH 619
            T++LW + +G       GH   V  +A  A++ +IIS S D +I++W+   G C +   
Sbjct: 88  KTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWN-TVGDCAYVLL 146

Query: 620 G 620
           G
Sbjct: 147 G 147

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 103/242 (42%), Gaps = 41/242 (16%)

Query: 390 GSLDKTIRVWNYITGECISTYRGH--TDSVMSVDSHKKIIVSGSADKTVKVWHVESRT-- 445
           G LD TI+VWN    + +++  GH  T S M +D +  +I +G  D  +K+W ++     
Sbjct: 430 GKLDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNTLI-TGGRDALLKMWDIQKAIDN 488

Query: 446 ---------CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVG 496
                     YT   H + +  +     +    S S D TIR WD+    C+        
Sbjct: 489 DSIPSDEVCIYTFDSHIDEITALSFEANNL--VSGSQDRTIRQWDLNNGKCV-------- 538

Query: 497 QVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLL 556
              + + +      NL       G  +      T  D P  G            Y   L 
Sbjct: 539 ---QTLDINFATGGNLSRSMIGSGFLN------TNNDHPIIGA--------IQCYDAALA 581

Query: 557 SCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMH 616
           +   D  ++LW++RSGR +RT  GH + V  +  D+  +++GS D SI+IWDL++G    
Sbjct: 582 TGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVTGSLDNSIRIWDLRTGTLAD 641

Query: 617 TF 618
           TF
Sbjct: 642 TF 643

 Score = 84.7 bits (208), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 93/436 (21%), Positives = 165/436 (37%), Gaps = 102/436 (23%)

Query: 227 RARVCYIKAKNPNTTVNDRKMIQDNDNRISPLTDRTQGNESPGATFSTN---VCTTASNN 283
           R R+  I+  N +   +  K  ++  +  +P   + Q +E P A  + +   V      N
Sbjct: 295 RERIDMIEEYNLDNDTDAEKAYEEATS--APEDTKDQYSELPDANTAESGETVVQEPQVN 352

Query: 284 TVXXXXXXXXXXXENGRCRQKSWKMVYRERFKVESNWRKGLCTIQEF-----------KG 332
                        + G   +   K V +  F+   + RK   T+Q++             
Sbjct: 353 LASAQKSLKKRSKQTGYSHKNHEKKVQQHEFR---HLRKTYPTLQQYYEPGANILSFDSA 409

Query: 333 HMDGVLTLQFNY---RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD-QKLI 388
           H D V  L FN     L   G  D T+ +W+L   K +  +TGH   V  +  D    LI
Sbjct: 410 HEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNTLI 469

Query: 389 TGSLDKTIRVWNYITG----------ECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKV 438
           TG  D  +++W+               CI T+  H D + ++      +VSGS D+T++ 
Sbjct: 470 TGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEANNLVSGSQDRTIRQ 529

Query: 439 WHVESRTC-------YTLKGH-------TEWVNCVKLHP--KSFSCYSCS-----DDTTI 477
           W + +  C       +   G+       + ++N    HP   +  CY  +      D  +
Sbjct: 530 WDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCYDAALATGTKDGIV 589

Query: 478 RMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPEN 537
           R+WD+R+   +R   GH   V  +      D+ NLVT                       
Sbjct: 590 RLWDLRSGRVVRTLEGHSDAVTSL----QFDSLNLVT----------------------- 622

Query: 538 GVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIIS 597
                                +LDN+I++W++R+G    T F +   V  +  D  +I+ 
Sbjct: 623 --------------------GSLDNSIRIWDLRTGTLADT-FSYEHPVTCLQFDLNKIVV 661

Query: 598 GSHDGSIKIWDLQSGK 613
            + +G++K+++ Q  K
Sbjct: 662 ANQEGTVKVYNRQEKK 677

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 66/115 (57%), Gaps = 3/115 (2%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGEC 406
           L TG+ D  V +WDL +G+++R L GHSD V +L FD   L+TGSLD +IR+W+  TG  
Sbjct: 580 LATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVTGSLDNSIRIWDLRTGTL 639

Query: 407 ISTYR-GHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVK 460
             T+   H  + +  D +K  IV  + + TVKV++ + +  +   G     N V+
Sbjct: 640 ADTFSYEHPVTCLQFDLNK--IVVANQEGTVKVYNRQEKKHWFCGGDEHSENAVE 692

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/257 (19%), Positives = 98/257 (38%), Gaps = 85/257 (33%)

Query: 401 YITGECISTY-RGHTDSVMSVD---SHKKIIVSGSADKTVKVWHV-ESRTCYTLKGHTEW 455
           Y  G  I ++   H D+V  +D       +  +G  D T+KVW++ +++   ++ GH   
Sbjct: 397 YEPGANILSFDSAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLAT 456

Query: 456 VNCVKLHPKSFSCYSCSDDTTIRMWDIRT----------NTCLRVFRGHVGQVQKVIPLT 505
           V+C+++   + +  +   D  ++MWDI+             C+  F  H+ ++  +    
Sbjct: 457 VSCMQMDQYN-TLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALS--- 512

Query: 506 IIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIK 565
             +A NLV                                           S + D TI+
Sbjct: 513 -FEANNLV-------------------------------------------SGSQDRTIR 528

Query: 566 LWEVRSGRCIRT-QFGHVEG---------------------VWDIAADNFRIISGSHDGS 603
            W++ +G+C++T       G                     +  I   +  + +G+ DG 
Sbjct: 529 QWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCYDAALATGTKDGI 588

Query: 604 IKIWDLQSGKCMHTFHG 620
           +++WDL+SG+ + T  G
Sbjct: 589 VRLWDLRSGRVVRTLEG 605

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 88.6 bits (218), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 127/333 (38%), Gaps = 92/333 (27%)

Query: 332 GHMDGVLT-LQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFDDQKLIT 389
           GH   V+T  QF    + TG+ D  + ++D    +    L GH  GV  L Y  D+ L++
Sbjct: 364 GHRTKVVTCFQFEGNYIITGADDKRINVYDADREQFKLELVGHEGGVWALKYAGDEILVS 423

Query: 390 GSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK----KIIVSGSADKTVKVWH----- 440
           GS D+T+R+WN   G+C   +RGHT +V  +D  +    K +V+GS D T+ VW      
Sbjct: 424 GSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDPN 483

Query: 441 --------------VESRTCY--TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
                         +E    +   L+GH   V  V  H       S S D  + +WDI  
Sbjct: 484 SPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVRTVSGHGN--IVVSGSYDHNLMVWDIAK 541

Query: 485 NTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRE 544
              L V  GH  ++             L  H+RK                          
Sbjct: 542 MKLLYVLTGHTDRIYST----------LYDHKRK-------------------------- 565

Query: 545 LDKKMPYPTHLLSCALDNTIKLWE------------------VRSGRCIRTQFGHVEGVW 586
                      +S ++D T+K+W+                  ++    +RT  GH   V 
Sbjct: 566 ---------RCISASMDTTVKVWDLSDINNNGPVSQINSTSALKVSGSVRTLCGHTALVG 616

Query: 587 DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFH 619
            +   +  ++S + DGS++ WD        +FH
Sbjct: 617 LLGLSDKYLVSAAADGSLRGWDASDYSKRFSFH 649

 Score = 84.7 bits (208), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 88/335 (26%), Positives = 137/335 (40%), Gaps = 73/335 (21%)

Query: 311 RERFKVESNWRKGLCTIQEFKGHMDGVLTLQF-NYRLLFTGSYDTTVAIWDLFTGKLIRR 369
           RE+FK+E              GH  GV  L++    +L +GS D TV IW++  GK    
Sbjct: 396 REQFKLE------------LVGHEGGVWALKYAGDEILVSGSTDRTVRIWNVKAGKCTHV 443

Query: 370 LTGHSDGVKTL----YFDDQKLITGSLDKTIRVW------------------NYITGE-- 405
             GH+  V+ L    +   + ++TGS D T+ VW                  N I     
Sbjct: 444 FRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNPF 503

Query: 406 CISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHV-ESRTCYTLKGHTEWVNCVKLHPK 464
            +   RGH  SV +V  H  I+VSGS D  + VW + + +  Y L GHT+ +       K
Sbjct: 504 FVGVLRGHMASVRTVSGHGNIVVSGSYDHNLMVWDIAKMKLLYVLTGHTDRIYSTLYDHK 563

Query: 465 SFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDA-QNLVTHERKPGEED 523
              C S S DTT+++WD+          G V Q+     L +  + + L  H        
Sbjct: 564 RKRCISASMDTTVKVWDLSDINN----NGPVSQINSTSALKVSGSVRTLCGH-------- 611

Query: 524 DIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHV- 582
                          + G   L  K     +L+S A D +++ W+  S    R  F H  
Sbjct: 612 -------------TALVGLLGLSDK-----YLVSAAADGSLRGWDA-SDYSKRFSFHHTN 652

Query: 583 -EGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMH 616
              +      +  ++SGS +    I+DL++G+ +H
Sbjct: 653 QSAITTFFVSDNILVSGS-EHQFNIYDLRTGRLVH 686

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 83/198 (41%), Gaps = 31/198 (15%)

Query: 427 IVSGSADKTVKVWHVESRTCYTLK--GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
           I++G+ DK + V+  + R  + L+  GH   V  +K         S S D T+R+W+++ 
Sbjct: 380 IITGADDKRINVYDAD-REQFKLELVGHEGGVWALKYAGDEI-LVSGSTDRTVRIWNVKA 437

Query: 485 NTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGED--DPENGVNGQ 542
             C  VFRGH   V+ +  +     + +VT     G  D+        D   P+   N  
Sbjct: 438 GKCTHVFRGHTSTVRCLDVVEHGGIKYVVT-----GSRDNTLHVWKLPDPNSPDYNPNAM 492

Query: 543 RELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDG 602
           R+ +              DN   +  +R         GH+  V  ++     ++SGS+D 
Sbjct: 493 RQFNS-----------IEDNPFFVGVLR---------GHMASVRTVSGHGNIVVSGSYDH 532

Query: 603 SIKIWDLQSGKCMHTFHG 620
           ++ +WD+   K ++   G
Sbjct: 533 NLMVWDIAKMKLLYVLTG 550

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQS 611
           ++++ A D  I +++    +      GH  GVW +  A D   ++SGS D +++IW++++
Sbjct: 379 YIITGADDKRINVYDADREQFKLELVGHEGGVWALKYAGDEI-LVSGSTDRTVRIWNVKA 437

Query: 612 GKCMHTFHG 620
           GKC H F G
Sbjct: 438 GKCTHVFRG 446

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 144 QLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQSLCNASMVCKNW-HLLADDDRVWY 202
           +LS ++ ++   +K DF+  LP E+S+ IL  LD + +C+  +V + W +L+ +   +W 
Sbjct: 242 ELSDLSTYLKDHLKRDFLQYLPMEVSMNILNNLDFEDICSCLLVNRTWNNLIRNSPYLWK 301

Query: 203 HM 204
           HM
Sbjct: 302 HM 303

>Scas_711.11
          Length = 695

 Score = 88.2 bits (217), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 86/341 (25%), Positives = 142/341 (41%), Gaps = 63/341 (18%)

Query: 319 NWRKGLCTIQEF-----------KGHMDGVLTLQFNY---RLLFTGSYDTTVAIWDLFTG 364
           N RK   T+Q++           K H D +  L F+     L   G  D  + IWDL   
Sbjct: 346 NSRKITPTLQQYFEKGSMINTIQKAHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRS 405

Query: 365 KLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK 424
           K I R+TGH   V  +   +  L++G  D  +++WN   G  + ++R    +V+  ++  
Sbjct: 406 KQIGRMTGHVATVNCMQITNNMLVSGGKDALLKLWNLNVG--VQSFR----NVLPTNNSN 459

Query: 425 KIIVSGSADKTVKVWHVESRTC-YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIR 483
              +S SA            +C +T   H + +  V +  ++    S S D TIR WDI 
Sbjct: 460 LEPISSSA------------SCIHTFDSHVDEITSVTVAGENL--ISGSQDRTIRQWDIP 505

Query: 484 TNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQR 543
           +  CL+        +    P+ + D+  L T +                      + G  
Sbjct: 506 SGKCLQTIDLSFVAIASP-PIQVTDSPFLTTTK-------------------ATAIIGAL 545

Query: 544 ELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGS 603
           +      +   L +   D  ++LW++R+G+ +R   GH   +  +  DN  I++GS D +
Sbjct: 546 QC-----FDAALATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKFDNKNIVTGSIDKT 600

Query: 604 IKIWDLQSGKC--MHTFHGRKLKGS-DVNTSSNPDHDERTK 641
           ++IWDL+SG    M TF    L    D N  +   HDE  K
Sbjct: 601 VRIWDLRSGILSDMLTFEKPVLSVDFDKNKIAIATHDEACK 641

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 56/93 (60%), Gaps = 1/93 (1%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGEC 406
           L TG+ D  V +WDL  GK++R L GHS  +  L FD++ ++TGS+DKT+R+W+  +G  
Sbjct: 552 LATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSG-I 610

Query: 407 ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVW 439
           +S        V+SVD  K  I   + D+  KV+
Sbjct: 611 LSDMLTFEKPVLSVDFDKNKIAIATHDEACKVY 643

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 11/125 (8%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK 386
           ++  +GH   +  L+F+ + + TGS D TV IWDL +G L   LT     V ++ FD  K
Sbjct: 572 VRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSGILSDMLT-FEKPVLSVDFDKNK 630

Query: 387 LITGSLDKTIRVWNYITGE---CISTYRGHT-------DSVMSVDSHKKIIVSGSADKTV 436
           +   + D+  +V++        C ST    T        +V ++      +V G +D T+
Sbjct: 631 IAIATHDEACKVYDRQLNNLQTCTSTDEASTSDPTIPVSTVETMSYQNGYLVEGRSDGTI 690

Query: 437 KVWHV 441
             W V
Sbjct: 691 NSWAV 695

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 87.8 bits (216), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 119/298 (39%), Gaps = 79/298 (26%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIR------------------RLTGHSDGVKTLYF--DD 384
           RL   G  D+ + IW L    LI                    L GHS  V +  F  D+
Sbjct: 486 RLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDN 545

Query: 385 QKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVE 442
             L++GS DKT+++W+  T   +  Y+GH   V  V          S S D+T ++W  +
Sbjct: 546 MYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACD 605

Query: 443 SRTCYTLK---GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQV- 498
               Y L+   GHT  V+ V  HP     ++ S D T RMWD+ T   +R+F GH   V 
Sbjct: 606 H--IYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVL 663

Query: 499 -QKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLS 557
             +V P    D + L T     G ED +                                
Sbjct: 664 STQVSP----DGRWLAT-----GSEDGV-------------------------------- 682

Query: 558 CALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFR---IISGSHDGSIKIWDLQSG 612
                 I LW++ +G+ I+   GH +      + N     +ISG  D S+++WD++ G
Sbjct: 683 ------ICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHG 734

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 66/124 (53%), Gaps = 7/124 (5%)

Query: 330 FKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQ 385
           F GH + V T+ F  N   +FTGS D T  +WD+ TG  +R   GH+  V +     D +
Sbjct: 613 FAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGR 672

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSV---MSVDSHKKIIVSGSADKTVKVWHVE 442
            L TGS D  I +W+  TG+ I   RGH  +    +S +    +++SG AD +V+VW V+
Sbjct: 673 WLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVK 732

Query: 443 SRTC 446
             T 
Sbjct: 733 HGTT 736

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 9/87 (10%)

Query: 550 PYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIW 607
           P   +L+S + D T+KLW + +   +    GH   VWD+          S SHD + ++W
Sbjct: 543 PDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLW 602

Query: 608 DLQSGKCMHTFHGRKLKG--SDVNTSS 632
                 C H +  R   G  +DV+T S
Sbjct: 603 -----ACDHIYPLRIFAGHTNDVDTVS 624

>Kwal_56.24526
          Length = 1210

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 131/284 (46%), Gaps = 30/284 (10%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITG 404
           +    + +++ +WD   G L+ +   H   V+ + F   +   ++   D TI+VW+  T 
Sbjct: 26  VLVALFSSSIQLWDYRMGTLLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTK 85

Query: 405 ECISTYRGHTDSVMSVDSHKKI--IVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKL 461
           +C+ T  GH D V +V  H+++  I+S S D+T+++W+ ++R     L GH  +V C   
Sbjct: 86  KCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADF 145

Query: 462 HPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGE 521
           HP      S S D T+R+WDI   + LR  + H              A +  T E +   
Sbjct: 146 HPTEDLVVSASLDETVRVWDI---SGLR--KRH-------------SAPSTYTLEDQIAA 187

Query: 522 EDDIASNGTGEDDPENGVNGQ-RELDKKMPYPT--HLLSCALDNTIKLWEVRSGRC--IR 576
           + ++   G G+   +  + G  R ++    +PT   ++S   D  +KLW + S +   + 
Sbjct: 188 QQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVD 247

Query: 577 TQFGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQSGKCMHTF 618
           T  GH   V  +     +  IIS   D ++++WDL     +  F
Sbjct: 248 TCRGHTNNVDSVIFHPHQNLIISVGEDKTVRVWDLDKRTPVKQF 291

 Score = 82.0 bits (201), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 100/223 (44%), Gaps = 40/223 (17%)

Query: 319 NWRKGLCTIQEFKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDG 376
           ++R G   + +F+ H   V  + F+    L  +   D T+ +W L T K +  L GH D 
Sbjct: 39  DYRMG-TLLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDY 97

Query: 377 VKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH--KKIIVSGSA 432
           V+T++F  +   +I+ S D+TIR+WN+   + I+   GH   VM  D H  + ++VS S 
Sbjct: 98  VRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLVVSASL 157

Query: 433 DKTVKVWHV-------ESRTCYT------------------------LKGHTEWVNCVKL 461
           D+TV+VW +        + + YT                        L+GH+  VN    
Sbjct: 158 DETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSRGVNWASF 217

Query: 462 HPKSFSCYSCSDDTTIRMWDIRTNTCLRV--FRGHVGQVQKVI 502
           HP      S  DD  +++W + +     V   RGH   V  VI
Sbjct: 218 HPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVI 260

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 91/202 (45%), Gaps = 39/202 (19%)

Query: 330 FKGHMDGVLTLQFNYRL--LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQ 385
             GH+D V T+ F+  L  + + S D T+ IW+    K I  LTGH+  V    F   + 
Sbjct: 91  LNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTED 150

Query: 386 KLITGSLDKTIRVWNYI----------------------------TGECISTY--RGHTD 415
            +++ SLD+T+RVW+                               G+C+  +   GH+ 
Sbjct: 151 LVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSR 210

Query: 416 SVMSVDSHK--KIIVSGSADKTVKVWHVESRTCY---TLKGHTEWVNCVKLHPKSFSCYS 470
            V     H    +IVSG  D+ VK+W + S   +   T +GHT  V+ V  HP      S
Sbjct: 211 GVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIIS 270

Query: 471 CSDDTTIRMWDIRTNTCLRVFR 492
             +D T+R+WD+   T ++ F+
Sbjct: 271 VGEDKTVRVWDLDKRTPVKQFK 292

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 66/135 (48%), Gaps = 5/135 (3%)

Query: 365 KLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDS 422
           K++ +    S   K L F   +  ++      +I++W+Y  G  +  +  H   V  +D 
Sbjct: 2   KMLTKFESKSTRAKGLAFHPSRPWVLVALFSSSIQLWDYRMGTLLHKFEDHEGPVRGIDF 61

Query: 423 H--KKIIVSGSADKTVKVWHVESRTC-YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
           H  + + VS   D T+KVW ++++ C +TL GH ++V  V  H +     S SDD TIR+
Sbjct: 62  HPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRI 121

Query: 480 WDIRTNTCLRVFRGH 494
           W+ +    +    GH
Sbjct: 122 WNWQNRKEIACLTGH 136

 Score = 37.0 bits (84), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 63/133 (47%), Gaps = 9/133 (6%)

Query: 323 GLCTIQE-FKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKL--IRRLTGHSDGV 377
           G C ++   +GH  GV    F+    L+ +G  D  V +W + + K   +    GH++ V
Sbjct: 197 GDCVVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNV 256

Query: 378 KTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSA-DK 434
            ++ F   +  +I+   DKT+RVW+      +  ++   D    V +H  I + G+A D 
Sbjct: 257 DSVIFHPHQNLIISVGEDKTVRVWDLDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHDS 316

Query: 435 TVKVWHVE-SRTC 446
            + V+ ++  R C
Sbjct: 317 GIMVFKLDRERPC 329

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 555 LLSCALDNTIKLWEVRSGRCI---RTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQS 611
           +L     ++I+LW+ R G  +       G V G+ D        +S   D +IK+W L +
Sbjct: 26  VLVALFSSSIQLWDYRMGTLLHKFEDHEGPVRGI-DFHPTQPLFVSAGDDYTIKVWSLDT 84

Query: 612 GKCMHTFHG 620
            KC+ T +G
Sbjct: 85  KKCLFTLNG 93

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 123/311 (39%), Gaps = 60/311 (19%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-DDQKLITGSLDKTIRVWNYITG 404
           +L +  YD T+  W+  TG   R +      V  L    D+K +  +    +R+++  + 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKKYLAAAGHLHVRLYDIRSN 63

Query: 405 EC--ISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVK 460
               +S++ GH  +V S+      + +VS S D T+KVW V S +      H   VN V 
Sbjct: 64  NPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVA 123

Query: 461 LHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPG 520
           +HP      SC  D  IR+WD+  N C                        L   +  P 
Sbjct: 124 IHPNQGELISCDQDGNIRIWDLGENQC---------------------TNQLTPEDNTPL 162

Query: 521 EEDDIASNGTGEDDPENGVNGQRELDKKMPYPT--------------------------- 553
           +   +AS+G+       G N       KMP+ T                           
Sbjct: 163 QSLSVASDGSM---LVAGNNKGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADV 219

Query: 554 -HLLSCALDNTIKLWEVRSGRCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDL 609
            HL +C+ D+T ++W +     + T   GH   VWD A  AD+  +++   D  +++WDL
Sbjct: 220 KHLATCSADHTARVWNIEDNFELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279

Query: 610 QSGKCMHTFHG 620
            + + +  + G
Sbjct: 280 STSEIVRQYGG 290

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 91/226 (40%), Gaps = 60/226 (26%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVK--TLYF 382
           +  F+GH   V ++ F    R + + S D T+ +WD+ +   ++R   H+  V    ++ 
Sbjct: 68  VSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPS-VQRNYKHNAPVNEVAIHP 126

Query: 383 DDQKLITGSLDKTIRVWNYITGEC------------------------------------ 406
           +  +LI+   D  IR+W+    +C                                    
Sbjct: 127 NQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNCYVW 186

Query: 407 -------------ISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVES--RTCYTL 449
                        ++ ++ HT  +  V   +  K + + SAD T +VW++E       TL
Sbjct: 187 KMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTL 246

Query: 450 KGHTEWV-NCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
            GH  WV +C      ++   +CSD   +R+WD+ T+  +R + GH
Sbjct: 247 DGHQRWVWDCAFSADSAYLVTACSDHY-VRLWDLSTSEIVRQYGGH 291

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 324 LCTIQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLFTG-KLIRRLTGHSDGVKTL 380
           L  + +FK H   +  + L  + + L T S D T  +W++    +L   L GH   V   
Sbjct: 197 LEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTLDGHQRWVWDC 256

Query: 381 YF--DDQKLITGSLDKTIRVWNYITGECISTYRGH 413
            F  D   L+T   D  +R+W+  T E +  Y GH
Sbjct: 257 AFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGH 291

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 2/57 (3%)

Query: 330 FKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384
             GH   V    F  +   L T   D  V +WDL T +++R+  GH  G   +  +D
Sbjct: 246 LDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGHHKGAVCVALND 302

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 127/282 (45%), Gaps = 51/282 (18%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITG 404
           + T  Y   V IW+  T + +R +      V+   F  +K  ++ GS D  +RV+NY TG
Sbjct: 28  VLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRKNWIVVGSDDNKVRVFNYNTG 87

Query: 405 ECISTYRGHTDSVMSVDSH--KKIIVSGSADKTVKVWHVESRTCY--TLKGHTEWVNCVK 460
           E ++ +  H D + S+  H  K  I++GS D TVK+W+ E+      T KGH  +V CV 
Sbjct: 88  EKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVA 147

Query: 461 LHPKSFSCYSCS-DDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKP 519
            +PK  + ++    D  +++W +  +T    F  H GQ                      
Sbjct: 148 FNPKDPNVFASGCLDHKVKVWSLGQSTP--NFTLHTGQ---------------------- 183

Query: 520 GEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQF 579
                           E GVN        +P   ++++ + D T+K+++ ++  C+ T  
Sbjct: 184 ----------------EKGVNYVDYY--PLPDKPYMITSSDDTTVKIFDYQTKSCVATLE 225

Query: 580 GHVEGV-WDIAADNFR-IISGSHDGSIKIWDLQSGKCMHTFH 619
           GH+  V + +       IISGS DG++K+W+  + K   T +
Sbjct: 226 GHMSNVSFAVFHPTLPIIISGSEDGTVKLWNSSTYKLEKTLN 267

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 73/156 (46%), Gaps = 11/156 (7%)

Query: 319 NWRKGLCTIQEFKGHMDGVLTLQFNYR---LLFTGSYDTTVAIWDLFTGKLIRRL-TGHS 374
           NW       Q FKGH   V+ + FN +   +  +G  D  V +W L        L TG  
Sbjct: 125 NWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLHTGQE 184

Query: 375 DGVKTLYF----DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK--KIIV 428
            GV  + +    D   +IT S D T+++++Y T  C++T  GH  +V     H    II+
Sbjct: 185 KGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSNVSFAVFHPTLPIII 244

Query: 429 SGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHP 463
           SGS D TVK+W+  + +   TL    E   C+  HP
Sbjct: 245 SGSEDGTVKLWNSSTYKLEKTLNLGLERSWCIATHP 280

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 93/197 (47%), Gaps = 18/197 (9%)

Query: 303 QKSWKMVYRERFKVES-NWRKGLCTIQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIW 359
           +K+W +V  +  KV   N+  G   + +F  H D +  + +  +   + TGS D TV +W
Sbjct: 66  RKNWIVVGSDDNKVRVFNYNTG-EKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLW 124

Query: 360 DLFTG-KLIRRLTGHSDGVKTLYF---DDQKLITGSLDKTIRVWNYITGECISTYRGHT- 414
           +      L +   GH   V  + F   D     +G LD  ++VW+   G+    +  HT 
Sbjct: 125 NWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWS--LGQSTPNFTLHTG 182

Query: 415 --DSVMSVDSH----KKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFS 467
               V  VD +    K  +++ S D TVK++  ++++C  TL+GH   V+    HP    
Sbjct: 183 QEKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSNVSFAVFHPTLPI 242

Query: 468 CYSCSDDTTIRMWDIRT 484
             S S+D T+++W+  T
Sbjct: 243 IISGSEDGTVKLWNSST 259

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 46/113 (40%), Gaps = 5/113 (4%)

Query: 550 PYPTHLLSCALDNTIKLWEVRSGRCIRTQF-GHVEGVWDIA---ADNFRIISGSHDGSIK 605
           P   ++L+ + D T+KLW   +   +   F GH   V  +A    D     SG  D  +K
Sbjct: 107 PSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVK 166

Query: 606 IWDLQSGKCMHTFHGRKLKGSD-VNTSSNPDHDERTKSAPVACVCIGDSECFS 657
           +W L       T H  + KG + V+    PD      S+    V I D +  S
Sbjct: 167 VWSLGQSTPNFTLHTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKS 219

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 83.6 bits (205), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 131/301 (43%), Gaps = 40/301 (13%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDG-VKTLYF-DDQKLITGSLDKTIRVWNYIT 403
           +L +  YD T+  W+  TG +  R   HSD  V  L   +D+KL+  +  + +R+++  T
Sbjct: 4   ILVSAGYDHTIRFWEALTG-VCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRT 62

Query: 404 GEC--ISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCV 459
                ++++ GH  +V SV   +  + +V+ S D T+KVW V S +      H   VN V
Sbjct: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKP 519
            +HP      SC  D  IR+WD+  N C                LT  D  +L +     
Sbjct: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTH-------------QLTPEDDTSLQSLSMAS 169

Query: 520 GEEDDIASNGTG-----EDDPENGVNGQRELDKKMPYPT------------HLLSCALDN 562
                 A+N  G     E       +  + + K   + T            HL +C+ D+
Sbjct: 170 DGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADH 229

Query: 563 TIKLWEVRSGRCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFH 619
           T ++W +     + T   GH   VWD A  AD+  +++ S D  +++WDL + + +  + 
Sbjct: 230 TARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYG 289

Query: 620 G 620
           G
Sbjct: 290 G 290

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 86/224 (38%), Gaps = 56/224 (25%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384
           +  F+GH   V ++ F  + R + T S D T+ +WD+ +  + R    ++   + +   +
Sbjct: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPN 127

Query: 385 Q-KLITGSLDKTIRVWNYITGEC------------------------------------- 406
           Q +LI+   D  IR+W+    +C                                     
Sbjct: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187

Query: 407 ------------ISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVES--RTCYTLK 450
                       ++ +R H+  +  +   S  K + + SAD T +VW ++   +   TL 
Sbjct: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLD 247

Query: 451 GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
           GH  WV        S    + S D  +R+WD+ T   +R + GH
Sbjct: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 324 LCTIQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLFTG-KLIRRLTGHSDGVKTL 380
           L  + +F+ H   +  + L  + + L T S D T  +W +    KL   L GH   V   
Sbjct: 197 LKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC 256

Query: 381 YF--DDQKLITGSLDKTIRVWNYITGECISTYRGH 413
            F  D   L+T S D  +R+W+  T E +  Y GH
Sbjct: 257 AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 330 FKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384
             GH   V    F  +   L T S D  V +WDL T +++R+  GH  G   +  +D
Sbjct: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 131/284 (46%), Gaps = 30/284 (10%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITG 404
           +    + +T+ +WD   G L+ R   H   V+ + F   +   ++   D TI+VW+  + 
Sbjct: 26  VLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESN 85

Query: 405 ECISTYRGHTDSVMSVDSHKKI--IVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKL 461
           +C+ T  GH D V +V  H ++  I+S S D+T+++W+ ++R     L GH  +V C + 
Sbjct: 86  KCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQF 145

Query: 462 HPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGE 521
           HP      S S D T+R+WDI   + LR  + H              A    + E +  +
Sbjct: 146 HPVEDLVVSASLDETVRVWDI---SGLR--KRH-------------SAPGTQSFEEQMRQ 187

Query: 522 EDDIASNGTGEDDPENGVNGQ-RELDKKMPYPT--HLLSCALDNTIKLWEVRSGRC--IR 576
           + ++   G G+   +  + G  R ++    +PT   ++S + D  +KLW + + +   + 
Sbjct: 188 QQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVD 247

Query: 577 TQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTF 618
           T  GH   V  +        IIS   D ++++WDL     +  F
Sbjct: 248 TCRGHTNNVDSVIFHPQQNLIISVGEDKTVRVWDLDKRTPIKQF 291

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 96/223 (43%), Gaps = 40/223 (17%)

Query: 319 NWRKGLCTIQEFKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDG 376
           ++R G+  +  F+ H   V  + F+    L  +   D T+ +W L + K +  L GH D 
Sbjct: 39  DYRMGVL-LHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESNKCLFTLDGHLDY 97

Query: 377 VKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH--KKIIVSGSA 432
           V+T++F  +   +I+ S D+TIR+WN+   + I+   GH   VM    H  + ++VS S 
Sbjct: 98  VRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASL 157

Query: 433 DKTVKVWHVESR-------------------------------TCYTLKGHTEWVNCVKL 461
           D+TV+VW +                                    + L+GHT  VN    
Sbjct: 158 DETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWASF 217

Query: 462 HPKSFSCYSCSDDTTIRMWDIRTNTCLRVF--RGHVGQVQKVI 502
           HP      S SDD  +++W +       V   RGH   V  VI
Sbjct: 218 HPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVI 260

 Score = 79.3 bits (194), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 94/200 (47%), Gaps = 39/200 (19%)

Query: 332 GHMDGVLTLQFNYRL--LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKL 387
           GH+D V T+ F++ L  + + S D T+ IW+    K I  LTGH+  V    F   +  +
Sbjct: 93  GHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLV 152

Query: 388 ITGSLDKTIRVWNYI----------------------------TGECISTY--RGHTDSV 417
           ++ SLD+T+RVW+                               G+C+  +   GHT  V
Sbjct: 153 VSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGV 212

Query: 418 MSVDSHK--KIIVSGSADKTVKVWHVESRTCY---TLKGHTEWVNCVKLHPKSFSCYSCS 472
                H    +IVSGS D+ VK+W + +   +   T +GHT  V+ V  HP+     S  
Sbjct: 213 NWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQQNLIISVG 272

Query: 473 DDTTIRMWDIRTNTCLRVFR 492
           +D T+R+WD+   T ++ F+
Sbjct: 273 EDKTVRVWDLDKRTPIKQFK 292

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (47%), Gaps = 7/117 (5%)

Query: 323 GLCTIQE-FKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKL--IRRLTGHSDGV 377
           G C ++   +GH  GV    F+    L+ +GS D  V +W +   K   +    GH++ V
Sbjct: 197 GDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNV 256

Query: 378 KTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSA 432
            ++ F  Q+  +I+   DKT+RVW+      I  ++   D    V +H  + + G+A
Sbjct: 257 DSVIFHPQQNLIISVGEDKTVRVWDLDKRTPIKQFKRENDRFWLVRAHPNLNLFGAA 313

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 555 LLSCALDNTIKLWEVRSGRCI---RTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQS 611
           +L     +TI+LW+ R G  +       G V G+ D        +S   D +IK+W L+S
Sbjct: 26  VLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGI-DFHPTQPLFVSAGDDYTIKVWSLES 84

Query: 612 GKCMHTFHG 620
            KC+ T  G
Sbjct: 85  NKCLFTLDG 93

>Kwal_0.212
          Length = 303

 Score = 82.8 bits (203), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 125/309 (40%), Gaps = 56/309 (18%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDG-VKTLYFD-DQKLITGSLDKTIRVWNYIT 403
           +L +  YD T+  W+  TG +  R   HSD  V  L    D++ +  +    +R+++  T
Sbjct: 4   ILASAGYDHTIRFWEALTG-VCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62

Query: 404 GEC--ISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCV 459
                ++++ GH  +V S+      K +VS S D T+KVW V + +      H   VN V
Sbjct: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV 122

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKP 519
            +HP      SC  D  +R+WD+  N C+                       L   +  P
Sbjct: 123 VIHPNQGELISCDQDGNVRIWDLGENQCV---------------------HQLAPEDDTP 161

Query: 520 GEEDDIASNGTGEDDPENGVN-----GQRELDKKMPYPT--------------------H 554
            +   +AS+G+      N  N        + D   P P                     H
Sbjct: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQS 611
           L +C+ D+T ++W +     + T    H   VWD A  AD+  +++   D  +++WDL +
Sbjct: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281

Query: 612 GKCMHTFHG 620
            + +  + G
Sbjct: 282 REIVRQYGG 290

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 81/191 (42%), Gaps = 17/191 (8%)

Query: 320 WRKGLCTIQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDG- 376
           W     ++Q    H   V  + +  N   L +   D  V IWDL   + + +L    D  
Sbjct: 102 WDVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTP 161

Query: 377 VKTLYF--DDQKLITGSLDKTIRVW------NYITGECISTYRGHTDSVMSV--DSHKKI 426
           +++L    D   L+ G+      VW      +    + ++ +R H   +  V   S  K 
Sbjct: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221

Query: 427 IVSGSADKTVKVWHVES--RTCYTLKGHTEWV-NCVKLHPKSFSCYSCSDDTTIRMWDIR 483
           + + SAD T +VW ++   +   TL  H  WV +C      ++   +CSD   +R+WD+ 
Sbjct: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHY-VRLWDLS 280

Query: 484 TNTCLRVFRGH 494
           T   +R + GH
Sbjct: 281 TREIVRQYGGH 291

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 5/99 (5%)

Query: 327 IQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLFTG-KLIRRLTGHSDGVKTLYF- 382
           + +F+ H   +  + L  + + L T S D T  +W +    +L   L  H   V    F 
Sbjct: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259

Query: 383 -DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV 420
            D   L+T   D  +R+W+  T E +  Y GH    + V
Sbjct: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 111/253 (43%), Gaps = 61/253 (24%)

Query: 370 LTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKK 425
           L GHS  V +  F  D++ L++ S DKT+R+W+  T   + +Y+GH   V  +S      
Sbjct: 472 LIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGH 531

Query: 426 IIVSGSADKTVKVWHVESRTCYTLK---GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
              + S D+T ++W  +    Y L+   GH   V+CV  HP     ++ S D T RMWDI
Sbjct: 532 YFATASHDQTARLWSCDH--IYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDI 589

Query: 483 RTNTCLRVFRGHVGQV--QKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVN 540
            T   +R+F GH   V    V P    D + L T     G ED I               
Sbjct: 590 GTGDSVRLFLGHTAPVISTAVSP----DGRWLST-----GSEDGI--------------- 625

Query: 541 GQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVE-GVWDI--AADNFRIIS 597
                                  I +W++ +G+ ++   GH +  V+ +  + +   ++S
Sbjct: 626 -----------------------INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVS 662

Query: 598 GSHDGSIKIWDLQ 610
           G  D S+++WDL+
Sbjct: 663 GGADHSVRVWDLK 675

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 7/124 (5%)

Query: 330 FKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGV--KTLYFDDQ 385
           F GH++ V  + F  N   +FTGS D T  +WD+ TG  +R   GH+  V    +  D +
Sbjct: 556 FAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGR 615

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK---IIVSGSADKTVKVWHVE 442
            L TGS D  I VW+  TG+ +   RGH  + +   S+ K   ++VSG AD +V+VW ++
Sbjct: 616 WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

Query: 443 SRTC 446
             T 
Sbjct: 676 RSTA 679

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 87/218 (39%), Gaps = 50/218 (22%)

Query: 408 STYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPK 464
           +T  GH+ +V S       K ++S S DKTV++W +++  +  + KGH   V  V   P 
Sbjct: 470 TTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPL 529

Query: 465 SFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDD 524
                + S D T R+W       LR+F GH+  V  V                       
Sbjct: 530 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCV----------------------S 567

Query: 525 IASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEG 584
              NGT                       ++ + + D T ++W++ +G  +R   GH   
Sbjct: 568 FHPNGT-----------------------YVFTGSTDKTCRMWDIGTGDSVRLFLGHTAP 604

Query: 585 VWD--IAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
           V    ++ D   + +GS DG I +WD+ +GK +    G
Sbjct: 605 VISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRG 642

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 75/170 (44%), Gaps = 7/170 (4%)

Query: 332 GHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD--QKL 387
           GH   V +  F  + + L + S D TV +W + T   +    GH+  V  + F       
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYF 533

Query: 388 ITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVESRT 445
            T S D+T R+W+      +  + GH + V  V  H     + +GS DKT ++W + +  
Sbjct: 534 ATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGD 593

Query: 446 CYTL-KGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
              L  GHT  V    + P      + S+D  I +WDI T   L+  RGH
Sbjct: 594 SVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 643

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 5/80 (6%)

Query: 326 TIQEFKGHMDGVLT--LQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHS-DGVKTLYF 382
           +++ F GH   V++  +  + R L TGS D  + +WD+ TGK ++++ GH  + V +L +
Sbjct: 594 SVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSY 653

Query: 383 DDQK--LITGSLDKTIRVWN 400
             +   L++G  D ++RVW+
Sbjct: 654 SKEGTVLVSGGADHSVRVWD 673

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 7/74 (9%)

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWDLQS 611
           +LLS + D T++LW + +   + +  GH   VWD++         + SHD + ++W    
Sbjct: 490 YLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLW---- 545

Query: 612 GKCMHTFHGRKLKG 625
             C H +  R   G
Sbjct: 546 -SCDHIYPLRIFAG 558

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 82.0 bits (201), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 79/149 (53%), Gaps = 9/149 (6%)

Query: 326 TIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFT-----GKLIRRLTGHSDGVK-- 378
           T++   G +  + T      LL + S D T+  W L       G  ++   GHS  V+  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDC 71

Query: 379 TLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTV 436
           TL  +    ++GS DKT+R+W+  TGE   T+ GH   VMSV   KK  +I+SGS DK++
Sbjct: 72  TLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSI 131

Query: 437 KVWHVESRTCYTLKGHTEWVNCVKLHPKS 465
           KVW ++     TL GH +WV+ V++   S
Sbjct: 132 KVWSIKGDCLATLIGHNDWVSQVRIANSS 160

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 49/89 (55%), Gaps = 3/89 (3%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKIWDLQ 610
            + LS + D T++LW+V +G   +T  GH   V  +A D     IISGS D SIK+W ++
Sbjct: 78  AYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIKVWSIK 137

Query: 611 SGKCMHTFHGRKLKGSDVNTSSNPDHDER 639
            G C+ T  G     S V  +++ D D++
Sbjct: 138 -GDCLATLIGHNDWVSQVRIANSSDDDDK 165

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 72/144 (50%), Gaps = 14/144 (9%)

Query: 370 LTGHSDGVKTLYFDDQK---LITGSLDKTIRVWNYITGE------CISTYRGHTDSVM-- 418
           L GH+  V +L     +   L++ S DKT+  W  +TG+       + +++GH+  V   
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWK-LTGDDQKFGVPVKSFKGHSHIVQDC 71

Query: 419 SVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTI 477
           ++  +    +SGS DKT+++W V +  T  T  GH   V  V +  K+    S S D +I
Sbjct: 72  TLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSI 131

Query: 478 RMWDIRTNTCLRVFRGHVGQVQKV 501
           ++W I+ + CL    GH   V +V
Sbjct: 132 KVWSIKGD-CLATLIGHNDWVSQV 154

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 84/227 (37%), Gaps = 63/227 (27%)

Query: 409 TYRGHTDSVMSVDS---HKKIIVSGSADKTVKVWHVESR------TCYTLKGHTEWVNCV 459
           T  GH   V S+ +      +++S S DKT+  W +            + KGH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDC 71

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKP 519
            L        S S D T+R+WD+ T    + F GH G V  V                  
Sbjct: 72  TLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSV------------------ 113

Query: 520 GEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQF 579
                                    +DKK    + ++S + D +IK+W ++ G C+ T  
Sbjct: 114 ------------------------AIDKK---ASMIISGSRDKSIKVWSIK-GDCLATLI 145

Query: 580 GHVEGVWDIAA-------DNFRIISGSHDGSIKI-WDLQSGKCMHTF 618
           GH + V  +         D   +IS  +D  +K+ W+  +   M+T 
Sbjct: 146 GHNDWVSQVRIANSSDDDDKVTVISAGNDKMVKVLWNSAAKVPMYTL 192

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 83.6 bits (205), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 124/271 (45%), Gaps = 16/271 (5%)

Query: 366 LIRRLTGHSDGVKTLYFD---DQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSV 420
           L R + GH   V+ +  D   ++   TGS DKTI++WN  +G+   T + H  +V  +++
Sbjct: 107 LTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAI 166

Query: 421 DSHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
            +    + S S DKTVK W +E  T      GH   V+ V +HP      +   D+ +++
Sbjct: 167 SNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKV 226

Query: 480 WDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGV 539
           WDIRT   +    GH G + KV  L  +D Q + +         D+ +  +     +   
Sbjct: 227 WDIRTRLPVMTLPGHKGPITKVRCLP-VDPQVISSSVDASIRLWDLVAGKSM----KVLT 281

Query: 540 NGQRELDKKMPYPTHL-LSCALDNTIKLWEVRSGRCIR---TQFGHVEGVWDIAADNFRI 595
           + QR +     +P+    + A  N I+ W +  G  +    +Q   V     I  D+  +
Sbjct: 282 HHQRTVRDISVHPSEFSFASACTNDIRSWLLPKGELLTNFVSQDLDVINTVSINQDDV-L 340

Query: 596 ISGSHDGSIKIWDLQSGKCMHTFHGRKLKGS 626
            +GS +GS+  +D +SG    TF  ++  GS
Sbjct: 341 FAGSDNGSLTFFDYKSGHKYQTFKTKEAPGS 371

 Score = 83.2 bits (204), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 77/158 (48%), Gaps = 5/158 (3%)

Query: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGEC 406
           TGS D T+ IW+L +GKL   L  H   V+ L   ++   + + S DKT++ W+      
Sbjct: 133 TGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKNTA 192

Query: 407 ISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVESR-TCYTLKGHTEWVNCVKLHP 463
           I  Y GH   V +VD H    ++V+   D  VKVW + +R    TL GH   +  V+  P
Sbjct: 193 IRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLP 252

Query: 464 KSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
                 S S D +IR+WD+     ++V   H   V+ +
Sbjct: 253 VDPQVISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDI 290

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 73/163 (44%), Gaps = 14/163 (8%)

Query: 338 LTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKT--LYFDDQKLITGSLDKT 395
           L +   +  +F+ S D TV  WDL     IR   GH  GV T  ++     ++T   D  
Sbjct: 164 LAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSV 223

Query: 396 IRVWNYITGECISTYRGHTDSV-----MSVDSHKKIIVSGSADKTVKVWH-VESRTCYTL 449
           ++VW+  T   + T  GH   +     + VD     ++S S D ++++W  V  ++   L
Sbjct: 224 VKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQ---VISSSVDASIRLWDLVAGKSMKVL 280

Query: 450 KGHTEWVNCVKLHPKSFSCYS-CSDDTTIRMWDIRTNTCLRVF 491
             H   V  + +HP  FS  S C++D  IR W +     L  F
Sbjct: 281 THHQRTVRDISVHPSEFSFASACTND--IRSWLLPKGELLTNF 321

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 89/198 (44%), Gaps = 8/198 (4%)

Query: 439 WHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIRTNTCLRVFRGHVGQ 497
           WH        + GH  WV C+ +       ++  S+D TI++W++ +       + H   
Sbjct: 101 WHAPWHLTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMT 160

Query: 498 VQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLS 557
           V+  + ++          E K  +  D+  N T   +    ++G   +D   P    +++
Sbjct: 161 VRD-LAISNRHPYMFSVSEDKTVKCWDLEKN-TAIRNYHGHLSGVHTVDIH-PTVDVVVT 217

Query: 558 CALDNTIKLWEVRSGRCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCM 615
              D+ +K+W++R+   + T  GH   +  +     + ++IS S D SI++WDL +GK M
Sbjct: 218 AGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVAGKSM 277

Query: 616 H--TFHGRKLKGSDVNTS 631
              T H R ++   V+ S
Sbjct: 278 KVLTHHQRTVRDISVHPS 295

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (46%)

Query: 573 RCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSS 632
           R I    G V  +     DN    +GS+D +IKIW+L SGK   T     +   D+  S+
Sbjct: 109 RVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISN 168

>Scas_630.6
          Length = 621

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 112/250 (44%), Gaps = 48/250 (19%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWH 440
           D + L TG+ DK IR+WN    + +   +GH   + S+D     + +VSGS D+++++W 
Sbjct: 352 DGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWD 411

Query: 441 VESRTCYTLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
           +++  C       + V  V + P      +  S D ++R+WD  ++T   V R       
Sbjct: 412 LKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWD--SSTGFLVER------- 462

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCA 559
                  +D+ N    E   G +D + S    +D       GQ           H++S +
Sbjct: 463 -------LDSDN----ESGNGHQDSVYSVAFTKD-------GQ-----------HVVSGS 493

Query: 560 LDNTIKLWEVR-----SGRCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWDLQSG 612
           LD T+KLW +      +G+C  T  GH + V  +A   D+  I SGS D  + IWD  SG
Sbjct: 494 LDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSG 553

Query: 613 KCMHTFHGRK 622
             +    G +
Sbjct: 554 NPILMLQGHR 563

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 122/290 (42%), Gaps = 71/290 (24%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFDD-QKLITGSLDKTIRVWNYI 402
             L TG+ D  + IW++   K++  L GH   + +L YF D QKL++GS D++IR+W+  
Sbjct: 354 EFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLK 413

Query: 403 TGEC---ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLK--------- 450
           TG+C   +S   G T   +S +   K+I +GS D++V++W  +S T + ++         
Sbjct: 414 TGQCSLTLSIEDGVTTVAVSPN-EGKLIAAGSLDRSVRIW--DSSTGFLVERLDSDNESG 470

Query: 451 -GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI-----RTNTCLRVFRGHVGQVQKVIPL 504
            GH + V  V          S S D T+++W++      T  C   + GH          
Sbjct: 471 NGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGH---------- 520

Query: 505 TIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTI 564
                            +D + S  T  DD                   ++ S + D  +
Sbjct: 521 -----------------KDFVLSVATSNDD------------------KYIFSGSKDRGV 545

Query: 565 KLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKC 614
            +W+  SG  I    GH + V  +A  N  +  G +    K++   SG C
Sbjct: 546 IIWDKDSGNPILMLQGHRKSVISVATVNSNVDDGKN---YKLFATGSGDC 592

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 64/126 (50%), Gaps = 18/126 (14%)

Query: 332 GHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLF-----TGKLIRRLTGHSDGVKTLYF-- 382
           GH D V ++ F  + + + +GS D TV +W+L      TGK      GH D V ++    
Sbjct: 472 GHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSN 531

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDS---------HKKIIVSGSAD 433
           DD+ + +GS D+ + +W+  +G  I   +GH  SV+SV +         + K+  +GS D
Sbjct: 532 DDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRKSVISVATVNSNVDDGKNYKLFATGSGD 591

Query: 434 KTVKVW 439
              ++W
Sbjct: 592 CKARIW 597

>Scas_603.5
          Length = 589

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 112/236 (47%), Gaps = 39/236 (16%)

Query: 413 HTDSVMSVD---SHKKIIVSGSADKTVKVWHVESR-TCYTLKGHTEWVNCVKLHPKSFSC 468
           +TD+V  +D   S K +  +G  + ++KVW +E+      L  H   V C++LHP S + 
Sbjct: 293 YTDTVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHPDSKTL 352

Query: 469 YSCSDDTTIRMWDI------------RTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHE 516
            + S D T+++WD+              ++C+  F  H  ++  V      D + L++  
Sbjct: 353 ITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVS----YDNEYLLSAS 408

Query: 517 R-KPGEEDDIA------------SNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNT 563
           R K   + D+             S+ +G +  ++ V   + +         L + + D  
Sbjct: 409 RDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAA------LATGSKDGI 462

Query: 564 IKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFH 619
           I+LW++RSG+ +RT   H   +  +  D+ +II+GS D +I + DL++G  + T+H
Sbjct: 463 IRLWDLRSGKVVRTLLKHQGPITSLQFDSTKIITGSTDANISVSDLRTGNILETYH 518

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 90/195 (46%), Gaps = 26/195 (13%)

Query: 333 HMDGVLTLQFNY--RLLFT-GSYDTTVAIWDLFTGKLIRRLTGHSDGVK--TLYFDDQKL 387
           + D V  L F+   ++L+T G Y+T++ +WDL T   +  L  H   V    L+ D + L
Sbjct: 293 YTDTVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHPDSKTL 352

Query: 388 ITGSLDKTIRVWNYITG------------ECISTYRGHTDSVMSVDSHKKIIVSGSADKT 435
           ITGS D T+++W+                 CI+T+  HT  + SV    + ++S S DK+
Sbjct: 353 ITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSYDNEYLLSASRDKS 412

Query: 436 VKVWHVESRTCY-TLKG---HTEWVN-----CVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
           ++ W + +  C  TL+    H    N        L     +  + S D  IR+WD+R+  
Sbjct: 413 IRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSKDGIIRLWDLRSGK 472

Query: 487 CLRVFRGHVGQVQKV 501
            +R    H G +  +
Sbjct: 473 VVRTLLKHQGPITSL 487

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 81/190 (42%), Gaps = 27/190 (14%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTG------------KLIRRLTG 372
           + +   H+  V  +Q   + + L TGS D T+ +WDL                 I     
Sbjct: 330 VMDLDDHIASVTCMQLHPDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEA 389

Query: 373 HSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRG----------HTDSVMSVDS 422
           H+  + ++ +D++ L++ S DK+IR W+  TG C+ T                +V ++ S
Sbjct: 390 HTAEITSVSYDNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQS 449

Query: 423 HKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWD 481
               + +GS D  +++W + S +   TL  H   +  ++    S    + S D  I + D
Sbjct: 450 VGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQF--DSTKIITGSTDANISVSD 507

Query: 482 IRTNTCLRVF 491
           +RT   L  +
Sbjct: 508 LRTGNILETY 517

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 54/103 (52%), Gaps = 3/103 (2%)

Query: 337 VLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTI 396
           V  LQ     L TGS D  + +WDL +GK++R L  H   + +L FD  K+ITGS D  I
Sbjct: 444 VEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFDSTKIITGSTDANI 503

Query: 397 RVWNYITGECISTYRGHTDS-VMSVDSHKKIIVSGSADKTVKV 438
            V +  TG  + TY  H D+ + + D     +V  +  K V+V
Sbjct: 504 SVSDLRTGNILETY--HCDAPINTFDFENDKLVVAADTKDVRV 544

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 12/83 (14%)

Query: 550 PYPTHLLSCALDNTIKLWEVRSG------------RCIRTQFGHVEGVWDIAADNFRIIS 597
           P    L++ + D T+KLW++                CI T   H   +  ++ DN  ++S
Sbjct: 347 PDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSYDNEYLLS 406

Query: 598 GSHDGSIKIWDLQSGKCMHTFHG 620
            S D SI+ WDL +G C+ T   
Sbjct: 407 ASRDKSIRQWDLTTGNCVQTLEA 429

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 80.1 bits (196), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 123/298 (41%), Gaps = 34/298 (11%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-DDQKLITGSLDKTIRVWNYITG 404
           +L +  YD T+  W+  TG   R +      V  L    D++ +  +    +R+++  T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRFLAAAGHLHVRLYDIRTT 63

Query: 405 EC--ISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVK 460
               ++++ GH  +V S+   +  K +VS S D T+KVW V + +      H   VN V 
Sbjct: 64  NPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVV 123

Query: 461 LHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTII----DAQNLVTHE 516
           +HP      SC  D  IR+WD+  N C      H    +   PL  +    D   LV   
Sbjct: 124 IHPNQGELISCDQDGNIRIWDLGENQCT-----HQLTPEDDTPLQSLSIASDGSMLVAGN 178

Query: 517 RK--------PGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPT---HLLSCALDNTIK 565
            K        P   D           P        +   ++   +   HL +C+ D+T +
Sbjct: 179 NKGNCYVWQMPNHTD------AANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTAR 232

Query: 566 LWEVRSGRCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
           +W +     + T   GH   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 233 VWSIEDNFKLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 89/225 (39%), Gaps = 58/225 (25%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384
           +  F+GH   V ++ F  + + + + S D T+ +WD+    + R    H+   + +   +
Sbjct: 68  VTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVIHPN 127

Query: 385 Q-KLITGSLDKTIRVWNYITGEC------------------------------------- 406
           Q +LI+   D  IR+W+    +C                                     
Sbjct: 128 QGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNKGNCYVWQ 187

Query: 407 ------------ISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVES--RTCYTLK 450
                       ++ +R HT  +  V   S  K + + SAD T +VW +E   +   TL 
Sbjct: 188 MPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNFKLETTLD 247

Query: 451 GHTEWV-NCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
           GH  WV +C      ++   +CSD   +R+WD+ T   +R + GH
Sbjct: 248 GHQRWVWDCAFSADSAYLVTACSDHY-VRLWDLSTREIVRQYGGH 291

 Score = 36.2 bits (82), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 42/95 (44%), Gaps = 5/95 (5%)

Query: 324 LCTIQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLFTG-KLIRRLTGHSDGVKTL 380
           L  + +F+ H   +  + L  + + L T S D T  +W +    KL   L GH   V   
Sbjct: 197 LKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNFKLETTLDGHQRWVWDC 256

Query: 381 YF--DDQKLITGSLDKTIRVWNYITGECISTYRGH 413
            F  D   L+T   D  +R+W+  T E +  Y GH
Sbjct: 257 AFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 83/310 (26%), Positives = 128/310 (41%), Gaps = 79/310 (25%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFD-DQKLITGSLDKTIRVWNYI 402
           + L TG+ D  + IWDL T K++  L GH   + +L YF    KL++GS D+T+R+W+  
Sbjct: 365 KYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLR 424

Query: 403 TGEC---ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLK--------- 450
           TG+C   +S   G T   +S     K I +GS D+TV+VW  +S T + ++         
Sbjct: 425 TGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRTVRVW--DSETGFLVERLDSENELS 481

Query: 451 -GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT-------NTCLRVFRGHVGQVQKVI 502
            GH + V  V          S S D ++++WD+R         TC   + GH        
Sbjct: 482 TGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGH-------- 533

Query: 503 PLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDN 562
                              +D + S  T +DD                   ++LS + D 
Sbjct: 534 -------------------KDFVLSVATTQDD------------------EYILSGSKDR 556

Query: 563 TIKLWEVRSGRCIRTQFGHVEGVWDIAADN-FRI-------ISGSHDGSIKIWDLQSGKC 614
            +  W+  SG  +    GH   V  +A  N F +        +GS D   +IW   + K 
Sbjct: 557 GVLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKY-TKKS 615

Query: 615 MHTFHGRKLK 624
             T  G KL+
Sbjct: 616 NPTATGAKLQ 625

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 109/252 (43%), Gaps = 50/252 (19%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWH 440
           D + L TG+ DK IR+W+  T + + T +GH   + S+D       +VSGS D+TV++W 
Sbjct: 363 DGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWD 422

Query: 441 VESRTCYTLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
           + +  C       + V  V + P      +  S D T+R+WD  + T   V R       
Sbjct: 423 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD--SETGFLVER------- 473

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCA 559
                  +D++N    E   G +D + S     D       GQ            ++S +
Sbjct: 474 -------LDSEN----ELSTGHKDSVYSVVFTRD-------GQ-----------GVISGS 504

Query: 560 LDNTIKLWEVRS-------GRCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWDLQ 610
           LD ++KLW++R          C  T  GH + V  +A   D+  I+SGS D  +  WD  
Sbjct: 505 LDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTA 564

Query: 611 SGKCMHTFHGRK 622
           SG  +    G +
Sbjct: 565 SGNPLLMLQGHR 576

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 94/203 (46%), Gaps = 26/203 (12%)

Query: 321 RKGLCTIQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVK 378
           +K L T+Q   GH   + +L +      L +GS D TV IWDL TG+    L+   DGV 
Sbjct: 384 KKILMTLQ---GHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLS-IEDGVT 439

Query: 379 TLYF---DDQKLITGSLDKTIRVWNYITGECISTY-------RGHTDSVMSV--DSHKKI 426
           T+     D + +  GSLD+T+RVW+  TG  +           GH DSV SV      + 
Sbjct: 440 TVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQG 499

Query: 427 IVSGSADKTVKVWHVES-------RTC-YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIR 478
           ++SGS D++VK+W +          TC  T  GH ++V  V          S S D  + 
Sbjct: 500 VISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVL 559

Query: 479 MWDIRTNTCLRVFRGHVGQVQKV 501
            WD  +   L + +GH   V  V
Sbjct: 560 FWDTASGNPLLMLQGHRNSVISV 582

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 66/139 (47%), Gaps = 19/139 (13%)

Query: 332 GHMDGVLTLQF--NYRLLFTGSYDTTVAIWDL--FTGKLIRR-----LTGHSDGVKTLYF 382
           GH D V ++ F  + + + +GS D +V +WDL    G+          TGH D V ++  
Sbjct: 483 GHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVAT 542

Query: 383 --DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--------DSHKKIIVSGSA 432
             DD+ +++GS D+ +  W+  +G  +   +GH +SV+SV             +  +GS 
Sbjct: 543 TQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSG 602

Query: 433 DKTVKVWHVESRTCYTLKG 451
           D   ++W    ++  T  G
Sbjct: 603 DCKARIWKYTKKSNPTATG 621

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 71/230 (30%), Positives = 104/230 (45%), Gaps = 37/230 (16%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           +   KGH   + +L +  +   L +GS D TV IWDL TG     L+   DGV T+    
Sbjct: 441 VMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLS-IEDGVTTVAVSP 499

Query: 383 -DDQKLITGSLDKTIRVWNYITGECISTY-------RGHTDSVMSV--DSHKKIIVSGSA 432
            + + +  GSLD+T+RVW+  TG  +           GH DSV SV      K +VSGS 
Sbjct: 500 GEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSL 559

Query: 433 DKTVKVW----------HVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
           D++VK+W          H E    YT  GH ++V  V          S S D  +  WD 
Sbjct: 560 DRSVKLWNLNGLSGQKSHAECEVTYT--GHKDFVLSVATTQNDEYILSGSKDRGVLFWDT 617

Query: 483 RTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGE 532
           ++   L + +GH      VI +T+ +   L       G E  + + G+G+
Sbjct: 618 KSGNPLLMLQGH---RNSVISVTVANGHPL-------GPEYGVFATGSGD 657

 Score = 78.2 bits (191), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 122/286 (42%), Gaps = 64/286 (22%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFDD-QKLITGSLDKTIRVWNYI 402
           + L TG+ D  + IWDL T K++  L GH   + +L YF    KL++GS D+T+R+W+  
Sbjct: 419 KFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLT 478

Query: 403 TGEC---ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLK--------- 450
           TG C   +S   G T   +S     K I +GS D+TV+VW  +S T + ++         
Sbjct: 479 TGTCSLTLSIEDGVTTVAVS-PGEGKFIAAGSLDRTVRVW--DSDTGFLVERLDSENELG 535

Query: 451 -GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDA 509
            GH + V  V          S S D ++++W++          G  GQ           A
Sbjct: 536 TGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNL---------NGLSGQKSH--------A 578

Query: 510 QNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEV 569
           +  VT+    G +D + S  T ++D                   ++LS + D  +  W+ 
Sbjct: 579 ECEVTYT---GHKDFVLSVATTQND------------------EYILSGSKDRGVLFWDT 617

Query: 570 RSGRCIRTQFGHVEGVWDIAADNFRII--------SGSHDGSIKIW 607
           +SG  +    GH   V  +   N   +        +GS D   +IW
Sbjct: 618 KSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 110/252 (43%), Gaps = 50/252 (19%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWH 440
           D + L TG+ DK IR+W+  T + + T +GH   + S+D       +VSGS D+TV++W 
Sbjct: 417 DGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWD 476

Query: 441 VESRTCYTLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
           + + TC       + V  V + P      +  S D T+R+WD  ++T   V R       
Sbjct: 477 LTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWD--SDTGFLVER------- 527

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCA 559
                  +D++N +               GTG  D    V   R  D K      ++S +
Sbjct: 528 -------LDSENEL---------------GTGHRDSVYSVVFTR--DGK-----GVVSGS 558

Query: 560 LDNTIKLWEVRS-------GRCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWDLQ 610
           LD ++KLW +           C  T  GH + V  +A   ++  I+SGS D  +  WD +
Sbjct: 559 LDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTK 618

Query: 611 SGKCMHTFHGRK 622
           SG  +    G +
Sbjct: 619 SGNPLLMLQGHR 630

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 71/174 (40%), Gaps = 69/174 (39%)

Query: 335 DGVLTLQFNY---RLLFTGSYDTTVAIWDLFTGKLIRRL-------TGHSDGVKTLYF-- 382
           DGV T+  +    + +  GS D TV +WD  TG L+ RL       TGH D V ++ F  
Sbjct: 490 DGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTR 549

Query: 383 DDQKLITGSLDKTIRVWNY--ITG-----ECISTYRGHTD-------------------- 415
           D + +++GSLD+++++WN   ++G     EC  TY GH D                    
Sbjct: 550 DGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKD 609

Query: 416 ----------------------SVMSV---DSHK-----KIIVSGSADKTVKVW 439
                                 SV+SV   + H       +  +GS D   ++W
Sbjct: 610 RGVLFWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

>Kwal_27.12053
          Length = 755

 Score = 81.6 bits (200), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 126/299 (42%), Gaps = 76/299 (25%)

Query: 339 TLQF--NYRLLFTGSYDTTVAIWDL----FTGKLIRR---------LTGHSDGVKTLYF- 382
           +L+F  + RL   G  D+ + IW L       KL  +         L GHS  V +  F 
Sbjct: 432 SLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTSFS 491

Query: 383 -DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVW 439
            D++ L++ S DKT+R+W+  T   +  Y+GH   +  ++         + S D+T ++W
Sbjct: 492 PDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARLW 551

Query: 440 HVESRTCYTLK---GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVG 496
             +    Y L+   GH   V+ V  HP     ++ S D T RMWDI +   +R+F GH  
Sbjct: 552 SCDH--IYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTA 609

Query: 497 QVQK--VIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTH 554
            V    V P    D + L T     G ED +                             
Sbjct: 610 PVTSTAVSP----DGRWLST-----GSEDGV----------------------------- 631

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVE-GVWDI--AADNFRIISGSHDGSIKIWDLQ 610
                    I +W++ +G+ ++   GH +  V+ +  + +   +ISG  D S+++WD++
Sbjct: 632 ---------INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 68/124 (54%), Gaps = 7/124 (5%)

Query: 330 FKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQ 385
           F GH++ V T+ F  N   +FTGS D T  +WD+ +G  +R   GH+  V +     D +
Sbjct: 562 FAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGR 621

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK---IIVSGSADKTVKVWHVE 442
            L TGS D  I VW+  TG+ +   RGH  + +   S+ K   +++SG AD +V+VW V+
Sbjct: 622 WLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

Query: 443 SRTC 446
             T 
Sbjct: 682 KSTA 685

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 100/260 (38%), Gaps = 66/260 (25%)

Query: 381 YFDDQKLIT-GSLDKTIRVWNYITGECI--------------STYRGHTDSVMSVD--SH 423
           + DD +L   G  D  I++W+ + GE +               T  GH+ +V S      
Sbjct: 435 FSDDVRLAAAGFQDSIIKIWS-LDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTSFSPD 493

Query: 424 KKIIVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
            + ++S S DKTV++W  ++ T     KGH   +  V   P      + S D T R+W  
Sbjct: 494 NRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSC 553

Query: 483 RTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQ 542
                LR+F GH+  V  V                          NGT            
Sbjct: 554 DHIYPLRIFAGHLNDVDTV----------------------SFHPNGT------------ 579

Query: 543 RELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWD--IAADNFRIISGSH 600
                      ++ + + D T ++W++ SG  +R   GH   V    ++ D   + +GS 
Sbjct: 580 -----------YVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSE 628

Query: 601 DGSIKIWDLQSGKCMHTFHG 620
           DG I +WD+ +GK +    G
Sbjct: 629 DGVINVWDIGTGKRLKQMRG 648

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 87/188 (46%), Gaps = 14/188 (7%)

Query: 325 CTIQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF 382
            ++  +KGH   +  + F+       T S+D T  +W       +R   GH + V T+ F
Sbjct: 515 TSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSF 574

Query: 383 --DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMS--VDSHKKIIVSGSADKTVKV 438
             +   + TGS DKT R+W+  +G+ +  + GHT  V S  V    + + +GS D  + V
Sbjct: 575 HPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINV 634

Query: 439 WHVES-RTCYTLKGHTE-WVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTC------LRV 490
           W + + +    ++GH +  V  +    +     S   D ++R+WD++ +T        + 
Sbjct: 635 WDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVKKSTAEPGSEPEQP 694

Query: 491 FRGHVGQV 498
           F G+ G V
Sbjct: 695 FTGYSGDV 702

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 9/83 (10%)

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWDLQS 611
           +LLS + D T++LW   +   +    GH   +WD+A         + SHD + ++W    
Sbjct: 496 YLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARLW---- 551

Query: 612 GKCMHTFHGRKLKG--SDVNTSS 632
             C H +  R   G  +DV+T S
Sbjct: 552 -SCDHIYPLRIFAGHLNDVDTVS 573

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 79.0 bits (193), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 120/294 (40%), Gaps = 26/294 (8%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-DDQKLITGSLDKTIRVWNYITG 404
           +L +  YD T+  W+  TG   R +      V  L    D++ +  +    +R+++  T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAAGHLHVRMYDIRTT 63

Query: 405 EC--ISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVK 460
               ++++ GH  +V S+   +  K +VS S D T+KVW V S +      H   VN V 
Sbjct: 64  NPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEVV 123

Query: 461 LHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERK-- 518
           +HP      SC  D  I++WD+  N C            + + +   D   LV    K  
Sbjct: 124 IHPNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIA-SDGSMLVAGNNKGN 182

Query: 519 ------PGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPT---HLLSCALDNTIKLWEV 569
                 P   D      T    P        +   ++       HL +C+ D+T ++W V
Sbjct: 183 CYVWKMPNHTD------TASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSV 236

Query: 570 RSGRCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
                + T    H   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 237 EDNFQLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 91/227 (40%), Gaps = 62/227 (27%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384
           +  F+GH   V ++ F  + + + + S D T+ +WD+ +  + R     +   + +   +
Sbjct: 68  VTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEVVIHPN 127

Query: 385 Q-KLITGSLDKTIRVWNYITGEC------------------------------------- 406
           Q +LI+   D  I++W+    +C                                     
Sbjct: 128 QGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNKGNCYVWK 187

Query: 407 ------------ISTYRGH----TDSVMSVDSHKKIIVSGSADKTVKVWHVES--RTCYT 448
                       ++ +R H    T  ++SVD   K + + SAD T +VW VE   +   T
Sbjct: 188 MPNHTDTASLKPVTKFRSHSKYITRVLLSVDV--KHLATCSADHTARVWSVEDNFQLETT 245

Query: 449 LKGHTEWV-NCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
           L  H+ WV +C      ++   +CSD   +R+WD+ T   +R + GH
Sbjct: 246 LDAHSRWVWDCAFSADSAYLVTACSDHY-VRLWDLSTREIVRQYGGH 291

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 5/95 (5%)

Query: 324 LCTIQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLFTG-KLIRRLTGHSDGVKTL 380
           L  + +F+ H   +  + L  + + L T S D T  +W +    +L   L  HS  V   
Sbjct: 197 LKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDNFQLETTLDAHSRWVWDC 256

Query: 381 YF--DDQKLITGSLDKTIRVWNYITGECISTYRGH 413
            F  D   L+T   D  +R+W+  T E +  Y GH
Sbjct: 257 AFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 81.6 bits (200), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 118/279 (42%), Gaps = 55/279 (19%)

Query: 352 YDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECIST 409
           Y     IW+  T   +R ++     V+   F  +K  +I GS D  IRV+NY TGE +  
Sbjct: 33  YSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPRKSWIIVGSDDFKIRVFNYNTGEKVVD 92

Query: 410 YRGHTDSVMSVDSH--KKIIVSGSADKTVKVWHVESRTCY--TLKGHTEWVNCVKLHPKS 465
           +  H D + ++  H  +  ++S S D TVK+W+ E       T +GH  +V  V  +PK 
Sbjct: 93  FEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKD 152

Query: 466 FSCYSCS-DDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDD 524
            + ++ +  D T+++W +   T     R H+                             
Sbjct: 153 PNTFATACLDHTVKIWSLGQETSNFTLRAHL----------------------------- 183

Query: 525 IASNGTGEDDPENGVNGQRELDKKMPY--PTHLLSCALDNTIKLWEVRSGRCIRTQFGHV 582
                      E GVN         P+    +L++ + D T+K+W+ ++  C+ T  GH+
Sbjct: 184 -----------EKGVN----FVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHL 228

Query: 583 EGVWDIAADNFR--IISGSHDGSIKIWDLQSGKCMHTFH 619
             V           IISGS DG++KIW+  + K   T +
Sbjct: 229 SNVSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLN 267

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 75/156 (48%), Gaps = 11/156 (7%)

Query: 319 NWRKGLCTIQEFKGHMDGVLTLQFNYR---LLFTGSYDTTVAIWDLFTGKLIRRLTGHSD 375
           NW K     Q F+GH   V+++ FN +      T   D TV IW L        L  H +
Sbjct: 125 NWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLE 184

Query: 376 -GVKTL----YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK--KIIV 428
            GV  +    + D   LIT S D+T++VW+Y T  C++T  GH  +V     H    II+
Sbjct: 185 KGVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIII 244

Query: 429 SGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHP 463
           SGS D TVK+W+  + +   TL    E   CV  HP
Sbjct: 245 SGSEDGTVKIWNSNTYKLERTLNLGLERSWCVAAHP 280

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 82/166 (49%), Gaps = 10/166 (6%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITG 404
           +  GS D  + +++  TG+ +     H D ++ L     +  +++ S D T+++WN+   
Sbjct: 70  IIVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKN 129

Query: 405 ECIS-TYRGHTDSVMSVDSHKK---IIVSGSADKTVKVWHVESRTC-YTLKGHTE-WVNC 458
             +  T+ GH   VMSV  + K      +   D TVK+W +   T  +TL+ H E  VN 
Sbjct: 130 WALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNF 189

Query: 459 VKLHPKSFSCY--SCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVI 502
           V  +P     Y  + SDD T+++WD +T +C+    GH+  V   +
Sbjct: 190 VDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAV 235

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 80/204 (39%), Gaps = 51/204 (25%)

Query: 424 KKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
           K  I+ GS D  ++V++  +       + H +++  + +HP      S SDD T+++W+ 
Sbjct: 67  KSWIIVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNW 126

Query: 483 RTNTCL-RVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNG 541
             N  L + F GH   V  V                                +P++    
Sbjct: 127 EKNWALEQTFEGHEHFVMSVTF------------------------------NPKD---- 152

Query: 542 QRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVE-GVWDIAADNFR----II 596
                     P    +  LD+T+K+W +       T   H+E GV  +    F+    +I
Sbjct: 153 ----------PNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKPYLI 202

Query: 597 SGSHDGSIKIWDLQSGKCMHTFHG 620
           + S D ++K+WD Q+  C+ T  G
Sbjct: 203 TSSDDRTVKVWDYQTKSCVATLEG 226

>Scas_629.12
          Length = 671

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 121/286 (42%), Gaps = 56/286 (19%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFDD-QKLITGSLDKTIRVWNYI 402
             L TG+ D  + IWD+   K++  L GH   V +L YF + +KL++GS D+T+R+W+  
Sbjct: 400 EFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLR 459

Query: 403 TGEC---ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLK--------- 450
           TG+C   +S   G T   +S +   K I +GS D+ V+VW  +S T + ++         
Sbjct: 460 TGQCSLTLSIEYGVTTVAVSPNDG-KFIAAGSLDRAVRVW--DSTTGFLVERLDSENELG 516

Query: 451 -GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDA 509
            GH + V  V          S S D T+++W++R +          G       +T +  
Sbjct: 517 TGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYV-- 574

Query: 510 QNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEV 569
                     G +D + S  T +DD                   ++LS + D  I  W+ 
Sbjct: 575 ----------GHKDFVLSVTTSQDD------------------KYILSGSKDRGILFWDK 606

Query: 570 RSGRCIRTQFGHVEGVWDIAADNFRII--------SGSHDGSIKIW 607
            SG  +    GH   V  +A  N   +        +GS D   +IW
Sbjct: 607 ESGNPLLMLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIW 652

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 93/204 (45%), Gaps = 35/204 (17%)

Query: 330 FKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQ 385
            KGH   V +L +  N   L +GS D TV IWDL TG+    L+    GV T+    +D 
Sbjct: 425 LKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEY-GVTTVAVSPNDG 483

Query: 386 KLI-TGSLDKTIRVWNYITGECISTY-------RGHTDSVMSV----DSHKKIIVSGSAD 433
           K I  GSLD+ +RVW+  TG  +           GH DSV SV    D ++  +VSGS D
Sbjct: 484 KFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNE--VVSGSLD 541

Query: 434 KTVKVWHVE---------------SRTC-YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTI 477
           KTVK+W++                S TC  T  GH ++V  V          S S D  I
Sbjct: 542 KTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGI 601

Query: 478 RMWDIRTNTCLRVFRGHVGQVQKV 501
             WD  +   L + +GH   V  V
Sbjct: 602 LFWDKESGNPLLMLQGHRNSVISV 625

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 115/295 (38%), Gaps = 69/295 (23%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK------------------ 424
           D Q L TG  +KT +++    GE I+  +   DSV S D+                    
Sbjct: 339 DGQFLATG-CNKTTQIYRVSDGELIA--KLSDDSVTSPDTSSATSGSTPSTDLYIRSVCF 395

Query: 425 ----KIIVSGSADKTVKVWHVESR-TCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
               + + +G+ DK +++W ++ R     LKGH + V  +   P      S S D T+R+
Sbjct: 396 SPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRI 455

Query: 480 WDIRTNTCLRVFRGHVGQVQKVI---------------PLTIIDAQNLVTHERKPGEEDD 524
           WD+RT  C        G     +                + + D+      ER   E + 
Sbjct: 456 WDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENE- 514

Query: 525 IASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVR-------------- 570
               GTG  D    V   R+ ++       ++S +LD T+KLW +R              
Sbjct: 515 ---LGTGHRDSVYSVVFTRDGNE-------VVSGSLDKTVKLWNMRHSGNSNNESNDKGS 564

Query: 571 -SGRCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRK 622
            S  C  T  GH + V  +  + D+  I+SGS D  I  WD +SG  +    G +
Sbjct: 565 ASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHR 619

>Kwal_23.6429
          Length = 750

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 125/286 (43%), Gaps = 59/286 (20%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFDD-QKLITGSLDKTIRVWNYI 402
           + L TG+ D  + IWDL T +++  L GH   + +L YF    KL++GS D+T+R+W+  
Sbjct: 483 KFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 542

Query: 403 TGEC---ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLK--------- 450
           TG+C   +S   G T   +S     K+I +GS D+TV++W  +S T + ++         
Sbjct: 543 TGQCSLTLSIEDGVTTVAVS-PGDGKLIAAGSLDRTVRIW--DSETGFLVERLDSENELG 599

Query: 451 -GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDA 509
            GH + V  V          S S D ++++W++R+        G   + +         A
Sbjct: 600 TGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSA------NGGTAEGKANT------A 647

Query: 510 QNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEV 569
            + VT+    G +D + S  T ++D                    +LS + D  +  W+ 
Sbjct: 648 ASEVTYT---GHKDFVLSVATTQND------------------EFILSGSKDRGVLFWDT 686

Query: 570 RSGRCIRTQFGHVEGVWDIAADNFRII--------SGSHDGSIKIW 607
            SG  +    GH   V  +A  N   +        +GS D   +IW
Sbjct: 687 PSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 732

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 105/235 (44%), Gaps = 42/235 (17%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD- 383
           +   +GH   + +L +  +   L +GS D TV IWDL TG+    L+   DGV T+    
Sbjct: 505 VMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLS-IEDGVTTVAVSP 563

Query: 384 -DQKLIT-GSLDKTIRVWNYITGECISTY-------RGHTDSVMSV----DSHKKIIVSG 430
            D KLI  GSLD+T+R+W+  TG  +           GH DSV SV    D H   +VSG
Sbjct: 564 GDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHG--VVSG 621

Query: 431 SADKTVKVWHVES-------------RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTI 477
           S D++VK+W++ S              +  T  GH ++V  V          S S D  +
Sbjct: 622 SLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGV 681

Query: 478 RMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGE 532
             WD  +   L + +GH   V  V           V ++   G E  + + G+G+
Sbjct: 682 LFWDTPSGNPLLMLQGHRNSVISVA----------VANDHPLGPEYGVFATGSGD 726

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/258 (26%), Positives = 106/258 (41%), Gaps = 57/258 (22%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWH 440
           D + L TG+ DK IR+W+  T   + T +GH   + S+D       +VSGS D+TV++W 
Sbjct: 481 DGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 540

Query: 441 VESRTCYTLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
           + +  C       + V  V + P      +  S D T+R+WD  + T   V R       
Sbjct: 541 LRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWD--SETGFLVER------- 591

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCA 559
                  +D++N +               GTG  D    V   R+          ++S +
Sbjct: 592 -------LDSENEL---------------GTGHKDSVYSVVFTRDGHG-------VVSGS 622

Query: 560 LDNTIKLWEVRSGR------------CIRTQFGHVEGVWDIAA---DNFRIISGSHDGSI 604
           LD ++KLW +RS                 T  GH + V  +A    D F I+SGS D  +
Sbjct: 623 LDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEF-ILSGSKDRGV 681

Query: 605 KIWDLQSGKCMHTFHGRK 622
             WD  SG  +    G +
Sbjct: 682 LFWDTPSGNPLLMLQGHR 699

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 62/139 (44%), Gaps = 24/139 (17%)

Query: 332 GHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLF------------TGKLIRRLTGHSDGV 377
           GH D V ++ F  +   + +GS D +V +W+L             T       TGH D V
Sbjct: 601 GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFV 660

Query: 378 KTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--------DSHKKII 427
            ++    +D+ +++GS D+ +  W+  +G  +   +GH +SV+SV             + 
Sbjct: 661 LSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVF 720

Query: 428 VSGSADKTVKVWHVESRTC 446
            +GS D   ++W    +T 
Sbjct: 721 ATGSGDCKARIWKYSKQTS 739

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 85/166 (51%), Gaps = 10/166 (6%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITG 404
           +  GS D  + +++  TG+ +     H D ++++     K  ++TGS D TI++WN+   
Sbjct: 70  VVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKN 129

Query: 405 -ECISTYRGHTDSVMSVDSHKK---IIVSGSADKTVKVWHV-ESRTCYTLKGH-TEWVNC 458
             C  T+ GH   VMSV  + K      SG  D T+KVW + +    +TLK H T+ VN 
Sbjct: 130 WGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHETKGVNY 189

Query: 459 VKLHPKSFSCY--SCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVI 502
           V  +P     Y  + SDD TI++WD +T + +    GH+  V   +
Sbjct: 190 VDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANVSYAV 235

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 123/279 (44%), Gaps = 55/279 (19%)

Query: 352 YDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECIST 409
           Y   + IW+  T   +R +      V+   F  +K  ++ GS D  +RV+NY TGE ++ 
Sbjct: 33  YSGRIEIWNYETQTQVRSIPLCDAPVRAGRFIARKNWVVVGSDDFKLRVYNYNTGEKVTE 92

Query: 410 YRGHTDSVMSVDSH--KKIIVSGSADKTVKVWHVESR-TCY-TLKGHTEWVNCVKLHPKS 465
           +  H D + S+  H  K  +++GS D T+K+W+ E    C  T  GH  +V  V  +PK 
Sbjct: 93  FEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKD 152

Query: 466 FSCYSCS-DDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDD 524
            + ++    D TI++W I                Q V   T      L  HE K      
Sbjct: 153 PNQFASGCLDHTIKVWSIG---------------QDVPNFT------LKAHETK------ 185

Query: 525 IASNGTGEDDPENGVN--GQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHV 582
                        GVN      L  K PY   L++ + D TIK+W+ ++   + T  GH+
Sbjct: 186 -------------GVNYVDYYPLQDK-PY---LITTSDDGTIKVWDYQTKSNVATLEGHM 228

Query: 583 EGV-WDIAADNFRII-SGSHDGSIKIWDLQSGKCMHTFH 619
             V + +      II SGS DG++KIW+  + K   T +
Sbjct: 229 ANVSYAVFHPTLPIIISGSEDGTLKIWNANTYKLEKTLN 267

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 76/167 (45%), Gaps = 15/167 (8%)

Query: 319 NWRKGLCTIQEFKGHMDGVLTLQFNYR---LLFTGSYDTTVAIWDLFTGKLIRRLTGHSD 375
           NW K     Q F GH   V+++ FN +      +G  D T+ +W +  G+ +   T  + 
Sbjct: 125 NWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSI--GQDVPNFTLKAH 182

Query: 376 GVKTLYF-------DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK--KI 426
             K + +       D   LIT S D TI+VW+Y T   ++T  GH  +V     H    I
Sbjct: 183 ETKGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANVSYAVFHPTLPI 242

Query: 427 IVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCS 472
           I+SGS D T+K+W+  + +   TL    E   C+  HP     Y  S
Sbjct: 243 IISGSEDGTLKIWNANTYKLEKTLNIGLERSWCIATHPSGKRNYIAS 289

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 106/265 (40%), Gaps = 57/265 (21%)

Query: 368 RRLTGHSDGVKTLYFDDQK---LITGSLDKTIRVWNYITGECISTYRGHTDSVMS--VDS 422
           ++L+  +D VK + F  ++   LIT      I +WNY T   + +       V +    +
Sbjct: 7   KKLSARTDRVKGIDFHPEEPWVLIT-LYSGRIEIWNYETQTQVRSIPLCDAPVRAGRFIA 65

Query: 423 HKKIIVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWD 481
            K  +V GS D  ++V++  +    T  + H +++  + +HP      + SDD TI++W+
Sbjct: 66  RKNWVVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWN 125

Query: 482 IRTN-TCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVN 540
              N  C + F GH   V  V                        A N      P++   
Sbjct: 126 WEKNWGCQQTFTGHEHFVMSV------------------------AFN------PKD--- 152

Query: 541 GQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGH-VEGV----WDIAADNFRI 595
                      P    S  LD+TIK+W +       T   H  +GV    +    D   +
Sbjct: 153 -----------PNQFASGCLDHTIKVWSIGQDVPNFTLKAHETKGVNYVDYYPLQDKPYL 201

Query: 596 ISGSHDGSIKIWDLQSGKCMHTFHG 620
           I+ S DG+IK+WD Q+   + T  G
Sbjct: 202 ITTSDDGTIKVWDYQTKSNVATLEG 226

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 121/298 (40%), Gaps = 83/298 (27%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFDD-QKLITGSLDKTIRVWNYI 402
           + L TG+ D  + IWD+   K++  L GH   + +L YF    KL++GS D+T+R+W+  
Sbjct: 568 KFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLK 627

Query: 403 TGEC---ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLK--------- 450
           TG+C   +S   G T   +S     K I +GS D+ V+VW  +S T + ++         
Sbjct: 628 TGQCTLTLSIEDGVTTVAVS-PGDGKFIAAGSLDRAVRVW--DSDTGFLVERLDSENELG 684

Query: 451 -GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIR------------TNTCLRVFRGHVGQ 497
            GH + V  V          S S D ++++W++R            + TC   + GH   
Sbjct: 685 TGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGH--- 741

Query: 498 VQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLS 557
                                   +D + S  T EDD                   ++LS
Sbjct: 742 ------------------------KDFVLSVATTEDD------------------EYILS 759

Query: 558 CALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAAD-------NFRIIS-GSHDGSIKIW 607
            + D  +  W+  SG  +    GH   V  +A +       N+ I + GS D   +IW
Sbjct: 760 GSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIW 817

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 109/257 (42%), Gaps = 55/257 (21%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWH 440
           D + L TG+ DK IR+W+    + +   +GH   + S+D       +VSGS D+TV++W 
Sbjct: 566 DGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 625

Query: 441 VESRTCYTLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
           +++  C       + V  V + P      +  S D  +R+WD  ++T   V R       
Sbjct: 626 LKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD--SDTGFLVER------- 676

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCA 559
                  +D++N    E   G +D + S     D   NGV                +S +
Sbjct: 677 -------LDSEN----ELGTGHKDSVYSVVFTRDG--NGV----------------VSGS 707

Query: 560 LDNTIKLWEVR------------SGRCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIK 605
           LD ++KLW +R            SG C  T  GH + V  +A   D+  I+SGS D  + 
Sbjct: 708 LDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVL 767

Query: 606 IWDLQSGKCMHTFHGRK 622
            WD  SG  +    G +
Sbjct: 768 FWDKVSGNPLLMLQGHR 784

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 63/132 (47%), Gaps = 24/132 (18%)

Query: 332 GHMDGVLTLQF--NYRLLFTGSYDTTVAIWDL------------FTGKLIRRLTGHSDGV 377
           GH D V ++ F  +   + +GS D +V +W+L             +G      TGH D V
Sbjct: 686 GHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFV 745

Query: 378 KTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--------DSHKKII 427
            ++    DD+ +++GS D+ +  W+ ++G  +   +GH +SV+SV          +  I 
Sbjct: 746 LSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIF 805

Query: 428 VSGSADKTVKVW 439
            +GS D   ++W
Sbjct: 806 ATGSGDCKARIW 817

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 43/109 (39%), Gaps = 11/109 (10%)

Query: 304 KSWKMVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDL 361
           K W +        +     G C +  + GH D VL++        + +GS D  V  WD 
Sbjct: 713 KLWNLRNVNHNNADGKPTSGTCEV-TYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDK 771

Query: 362 FTGKLIRRLTGHSDGVKTLYFDD--------QKLITGSLDKTIRVWNYI 402
            +G  +  L GH + V ++  +             TGS D   R+W YI
Sbjct: 772 VSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIWKYI 820

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 101/216 (46%), Gaps = 51/216 (23%)

Query: 324 LCTIQEFKGHMDGVLTLQFNYR-----LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVK 378
           L  I+ F  H D  ++ Q  ++     LL + S D TV +W +   + ++  + HS+ VK
Sbjct: 211 LKLIRSFNAH-DSTVSSQKTWQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVK 269

Query: 379 TLYFDDQKLITGSLDKTIRVWNYITGECISTYRGH------------TDSVMSVDSHK-- 424
           ++   D+ +++GSLD T+R+ ++ +G  +S   GH            +DS +    ++  
Sbjct: 270 SIDVLDEYILSGSLDSTLRLTHWPSGNGLSVGTGHEFPIERVLIIPFSDSKICTSPYRDQ 329

Query: 425 -----------KIIVSGSADKTVKVWHVE--------------SRTCY----TLKGHTEW 455
                      K   S + D T+K+W V               + T +    TL+GHT W
Sbjct: 330 NEHSAFAPLRFKYCASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSW 389

Query: 456 VNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVF 491
           V  +KL  +    +SCSDD TI+ WD+ T  C++ +
Sbjct: 390 VKDLKL--RGDHLFSCSDDETIKCWDLNTGNCVKTW 423

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 119/285 (41%), Gaps = 61/285 (21%)

Query: 371 TGHSDGVKTL----------YFDDQKLI-TGSLDKTIRVWNYI--TGEC--ISTYRGHTD 415
           T HS  + ++          + D   L+ T S D  I V+++   TGE   I ++  H  
Sbjct: 163 TAHSKAITSIEVIEAHNFEEFIDSTTLVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDS 222

Query: 416 SVMSVDSHKK----IIVSGSADKTVKVWHV-ESRTCYTLKGHTEWVNCVKLHPKSFSCYS 470
           +V S  + +K    ++ S S D TVKVW V +SR   +   H+EWV  + +  +     S
Sbjct: 223 TVSSQKTWQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSIDVLDEYI--LS 280

Query: 471 CSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGT 530
            S D+T+R+    +   L V  GH   +++V+ +   D++   +  R   E    A    
Sbjct: 281 GSLDSTLRLTHWPSGNGLSVGTGHEFPIERVLIIPFSDSKICTSPYRDQNEHSAFAP--- 337

Query: 531 GEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEV-----------------RSGR 573
                            +  Y     S A DNTIK+WEV                  + +
Sbjct: 338 ----------------LRFKY---CASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFK 378

Query: 574 CIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTF 618
           C+ T  GH   V D+      + S S D +IK WDL +G C+ T+
Sbjct: 379 CVMTLRGHTSWVKDLKLRGDHLFSCSDDETIKCWDLNTGNCVKTW 423

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 90/216 (41%), Gaps = 29/216 (13%)

Query: 456 VNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTC-LRVFRGHVGQVQKVIPLT------IID 508
           V  +KLHP     Y  +D   +  +DI   T  L V   H   +  +  +        ID
Sbjct: 126 VTAIKLHPSLAIVYVGTDTGRLIAYDILNYTIPLAVTTAHSKAITSIEVIEAHNFEEFID 185

Query: 509 AQNLVTHERKPGEED--DIASNGTGE-------DDPENGVNGQRELDKKMPYPTHLLSCA 559
           +  LV+   K  + +  D +SN TGE       +  ++ V+ Q+   K       L S +
Sbjct: 186 STTLVSTTSKDAQINVYDHSSN-TGELKLIRSFNAHDSTVSSQKTWQKD--NDVLLASSS 242

Query: 560 LDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFH 619
            D T+K+W V   RC+++   H E V  I   +  I+SGS D ++++    SG  +    
Sbjct: 243 RDATVKVWRVNDSRCLQSFSPHSEWVKSIDVLDEYILSGSLDSTLRLTHWPSGNGLSVGT 302

Query: 620 GRK----------LKGSDVNTSSNPDHDERTKSAPV 645
           G +             S + TS   D +E +  AP+
Sbjct: 303 GHEFPIERVLIIPFSDSKICTSPYRDQNEHSAFAPL 338

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 53/130 (40%), Gaps = 33/130 (25%)

Query: 340 LQFNYRLLFTGSYDTTVAIWDL-----------------FTGKLIRRLTGHSDGVKTLYF 382
           L+F Y    + + D T+ IW++                  T K +  L GH+  VK L  
Sbjct: 338 LRFKY--CASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKDLKL 395

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTY--------------RGHTDSVMSVDSHKKIIV 428
               L + S D+TI+ W+  TG C+ T+              R  T    S    ++I+V
Sbjct: 396 RGDHLFSCSDDETIKCWDLNTGNCVKTWSSIHNNFINCIDIDREATIEQFSPSLQREILV 455

Query: 429 SGSADKTVKV 438
           SG  D  VK+
Sbjct: 456 SGDMDNKVKI 465

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 73/342 (21%), Positives = 130/342 (38%), Gaps = 98/342 (28%)

Query: 321 RKGLCTIQEF-----------KGHMDGVLTLQFNY---RLLFTGSYDTTVAIWDLFTGKL 366
           RK   T+Q+F           K H + +  L F+     +   GS D +V +WDL   K 
Sbjct: 373 RKTYPTLQQFYDSGSKITSLPKAHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQ 432

Query: 367 IRRLTGHSDGVKTLYFDD-QKLITGSLDKTIRVWNYITG-------------ECISTYRG 412
           I  L GH   +  +  D    LITG  D  +++W+                  C+ T+  
Sbjct: 433 IATLHGHLASISCMQIDQYSTLITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDS 492

Query: 413 HTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTL------------KGHTEWVNCVK 460
           H D + ++      +VSGS D+TV+ W + S  C               + +    N V 
Sbjct: 493 HVDEITAISFDGDNLVSGSQDRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRNSVL 552

Query: 461 L--HPKSFSCYSCSD--------DTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQ 510
           L   P +     C D        D  +R+WD+R+   +R+  GH   +  +      D+ 
Sbjct: 553 LTKEPPAIGALQCFDAALATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSL----QFDSV 608

Query: 511 NLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVR 570
           NLVT                                            A+D +I++W++R
Sbjct: 609 NLVT-------------------------------------------GAMDRSIRIWDLR 625

Query: 571 SGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSG 612
           +G  +   F + + +  +  D  +I+  +++ ++KI++ + G
Sbjct: 626 TG-ILSDVFAYEQPITSLHFDLDKIVISNNEPTVKIYNRKDG 666

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 104/254 (40%), Gaps = 49/254 (19%)

Query: 327 IQEFKGHMDGVLTLQFN-YRLLFTGSYDTTVAIWDLFTGKL-------------IRRLTG 372
           I    GH+  +  +Q + Y  L TG  D  + +WD+                  +     
Sbjct: 433 IATLHGHLASISCMQIDQYSTLITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDS 492

Query: 373 HSDGVKTLYFDDQKLITGSLDKTIRVWNYITGEC-----ISTYRGHTDSVMSVDSHKKII 427
           H D +  + FD   L++GS D+T+R W+  +G+C     IS   G   S  ++     ++
Sbjct: 493 HVDEITAISFDGDNLVSGSQDRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRNSVL 552

Query: 428 VS------------------GSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSC 468
           ++                  G+ D  V++W + S +    L+GHT+ +  ++    S + 
Sbjct: 553 LTKEPPAIGALQCFDAALATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQF--DSVNL 610

Query: 469 YSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASN 528
            + + D +IR+WD+RT     VF       ++ I     D   +V    +P  +     +
Sbjct: 611 VTGAMDRSIRIWDLRTGILSDVF-----AYEQPITSLHFDLDKIVISNNEPTVKIYNRKD 665

Query: 529 GT----GEDDPENG 538
           G     GEDDPE G
Sbjct: 666 GNHWFCGEDDPEQG 679

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/229 (20%), Positives = 84/229 (36%), Gaps = 85/229 (37%)

Query: 429 SGSADKTVKVWHV-ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIR---- 483
           +GS D +VKVW + + +   TL GH   ++C+++   S +  +   D  +++WDI     
Sbjct: 415 AGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYS-TLITGGRDAVLKLWDIDKAMA 473

Query: 484 ---------TNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDD 534
                     + CL  F  HV ++  +      D  NLV                     
Sbjct: 474 DEASNSSEDNDACLYTFDSHVDEITAIS----FDGDNLV--------------------- 508

Query: 535 PENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRT-----QFGHVEGVWDIA 589
                                 S + D T++ W++ SG+C +T       G +    +I 
Sbjct: 509 ----------------------SGSQDRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIP 546

Query: 590 ADNFRIIS------------------GSHDGSIKIWDLQSGKCMHTFHG 620
             N  +++                  G+ DG +++WDL+SGK +    G
Sbjct: 547 LRNSVLLTKEPPAIGALQCFDAALATGTKDGIVRLWDLRSGKVVRMLEG 595

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 83/218 (38%), Gaps = 56/218 (25%)

Query: 450 KGHTEWVNCVKLH-PKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIID 508
           K H E + C+    P    C + S D ++++WD+     +    GH+  +     + I  
Sbjct: 394 KAHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASIS---CMQIDQ 450

Query: 509 AQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWE 568
              L+T  R                   + V    ++DK M       + + DN      
Sbjct: 451 YSTLITGGR-------------------DAVLKLWDIDKAMADEAS--NSSEDN------ 483

Query: 569 VRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDV 628
                C+ T   HV+ +  I+ D   ++SGS D +++ WDL SGKC  T         D+
Sbjct: 484 ---DACLYTFDSHVDEITAISFDGDNLVSGSQDRTVRQWDLNSGKCTQTI--------DI 532

Query: 629 NTSSNPDHDER----------TKSAPVACVCIGDSECF 656
           + ++ P   +R          TK  P     IG  +CF
Sbjct: 533 SFATGPMRSQRNIPLRNSVLLTKEPP----AIGALQCF 566

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 84/177 (47%), Gaps = 21/177 (11%)

Query: 330 FKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGV-KTLYFDDQKLI 388
             GH   V  L+     L + S+D T  +W    G   R L+GH+  V   L     + +
Sbjct: 104 LAGHSGNVCALEARDGQLVSSSWDQTARVWR--EGTEERALSGHNATVWHALALGYDRFL 161

Query: 389 TGSLDKTIRVWNYITGECISTYRGHTDSV----MSVDSHKKIIVSGSADKTVKVWHVESR 444
           T S DKTI++W+      ++TY  HTD V    ++ D H     S S D +VKV  ++ +
Sbjct: 162 TASADKTIKLWD--GARDLATYNVHTDVVRHLALAPDGHH--FASCSNDGSVKVHTLDGK 217

Query: 445 TCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
           T  T  GH  +V CVK  P      SC +D T+R+WD+          GHV QV ++
Sbjct: 218 TVRTFDGHESFVYCVKYLPDG-GLVSCGEDKTVRVWDM---------SGHVRQVIRL 264

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 104/273 (38%), Gaps = 70/273 (25%)

Query: 365 KLIRRLTGHSDGVKTLY-FDDQKLITGSLDKTIRVWNYIT-------GECISTYRGHTDS 416
           +L   L GHS  VK++    D ++ +GS D T+RVW   T       G  + +   + ++
Sbjct: 9   ELSSSLLGHSMDVKSVVAISDTQIASGSRDGTVRVWTRDTSDSRLWSGAILHSTERYVNA 68

Query: 417 VMSVDSHKKIIVSGSADKTVK-----VWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSC 471
           V   + +++++  G  +  +      V  V+  + Y L GH+   N   L  +     S 
Sbjct: 69  V-CYEENEQLVFFGGQEAVIGAVSPLVLEVQDAS-YLLAGHSG--NVCALEARDGQLVSS 124

Query: 472 SDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTG 531
           S D T R+W  R  T  R   GH   V   + L                          G
Sbjct: 125 SWDQTARVW--REGTEERALSGHNATVWHALAL--------------------------G 156

Query: 532 EDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGV--WDIA 589
            D                      L+ + D TIKLW+    R + T   H + V    +A
Sbjct: 157 YD--------------------RFLTASADKTIKLWD--GARDLATYNVHTDVVRHLALA 194

Query: 590 ADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRK 622
            D     S S+DGS+K+  L  GK + TF G +
Sbjct: 195 PDGHHFASCSNDGSVKVHTLD-GKTVRTFDGHE 226

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 59/96 (61%), Gaps = 1/96 (1%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGEC 406
           L TG+ D  V +WDL  GK +R L GH+DG+ +L FD +KL+TGS+D ++R+W+  T   
Sbjct: 518 LATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSI 577

Query: 407 ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVE 442
           +     +   V S+D   K+I  G+ +  V V+++E
Sbjct: 578 LDVI-AYDLPVSSLDFDGKLITVGANEGGVNVFNME 612

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 88/213 (41%), Gaps = 50/213 (23%)

Query: 327 IQEFKGHMDGVLTLQF---NYRLLFTGSYDTTVAIWDL-------------------FTG 364
           + E  GH+  V  +Q    NY +L TGS D T+ +WDL                      
Sbjct: 371 VGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVT 430

Query: 365 KLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTY-----RGHTDSVMS 419
             I     H D +  L FD + L++GS DK I  W+  TG+CI          H+D  M 
Sbjct: 431 PCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMP 490

Query: 420 VDS--------------------HKKIIVSGSADKTVKVWHVE-SRTCYTLKGHTEWVNC 458
             S                    +   + +G+ D  V++W +   +    L+GHT+ +  
Sbjct: 491 ARSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITS 550

Query: 459 VKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVF 491
           +K    S    + S D ++R+WD+RT++ L V 
Sbjct: 551 LKF--DSEKLVTGSMDNSVRIWDLRTSSILDVI 581

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 108/244 (44%), Gaps = 43/244 (17%)

Query: 393 DKTIRVWNYITGECISTYRGHTDSV--MSVDSHK-KIIVSGSADKTVKVWHVE-SRTCY- 447
           D+ ++VW+   G  +    GH  +V  M +D     ++++GS D T+K+W +  SR  Y 
Sbjct: 357 DRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYL 416

Query: 448 ---TLKGHTEWV--NCV---KLHPKSFSCYSC--------SDDTTIRMWDIRTNTCLRVF 491
               LK  TE +   C+   +LH    +  S         S D  I  WD+ T  C++  
Sbjct: 417 DHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQ-- 474

Query: 492 RGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPY 551
                Q+  +   T  D        + P    +  +   G + P  G            Y
Sbjct: 475 -----QLDLIFTPTHSDI-------KMPARSLNNGACLLGTEAPMIGA--------LQCY 514

Query: 552 PTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQS 611
            + L +   D  ++LW++R G+ +R   GH +G+  +  D+ ++++GS D S++IWDL++
Sbjct: 515 NSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRT 574

Query: 612 GKCM 615
              +
Sbjct: 575 SSIL 578

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 93/231 (40%), Gaps = 53/231 (22%)

Query: 333 HMDGVLTLQFN--YRLLFTGSY-DTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--- 386
           H + +  L F+  +  L + SY D  V +WDL  G  +  L GH   V  +  D +    
Sbjct: 334 HGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNM 393

Query: 387 LITGSLDKTIRVWNY-------------------ITGECISTYRGHTDSVMSVDSHKKII 427
           LITGS D T+++W+                    I   CI  +  H D + ++    + +
Sbjct: 394 LITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEAL 453

Query: 428 VSGSADKTVKVWHVESRTCYTLKG--HTEWVNCVKLHPKSFS-----------------C 468
           VSGS DK +  W + +  C        T   + +K+  +S +                 C
Sbjct: 454 VSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQC 513

Query: 469 YSCS-----DDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVT 514
           Y+ +      D  +R+WD+R    +R+  GH   +  +      D++ LVT
Sbjct: 514 YNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSL----KFDSEKLVT 560

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 60/121 (49%), Gaps = 9/121 (7%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK 386
           ++  +GH DG+ +L+F+   L TGS D +V IWDL T  ++  +  +   V +L FD + 
Sbjct: 538 VRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSIL-DVIAYDLPVSSLDFDGKL 596

Query: 387 LITGSLDKTIRVWN------YITGECISTYRGHTDS--VMSVDSHKKIIVSGSADKTVKV 438
           +  G+ +  + V+N      ++T E   +  G   S  +  V      +++G  D  + V
Sbjct: 597 ITVGANEGGVNVFNMERDEHWMTPEPPHSLDGDELSRRIAIVKYKDGFLINGHNDGDINV 656

Query: 439 W 439
           W
Sbjct: 657 W 657

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 87/211 (41%), Gaps = 39/211 (18%)

Query: 429 SGSADKTVKVWHVE-SRTCYTLKGHTEWVNCVKLHPKSFSCY-SCSDDTTIRMWDIRTNT 486
           S   D+ VKVW +        L GH   VNC+++  K+++   + S D T+++WD+  N 
Sbjct: 353 SSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDL--NL 410

Query: 487 CLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELD 546
              ++  H    +K   +      N   H+      D+I +      D E  V+G R  D
Sbjct: 411 SREIYLDHSPLKEKTEEIVTPCIHNFELHK------DEITALSF---DSEALVSGSR--D 459

Query: 547 KKMPY-----------------PTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA 589
           KK+ +                 PTH      D  +    + +G C+      + G   + 
Sbjct: 460 KKIFHWDLTTGKCIQQLDLIFTPTHS-----DIKMPARSLNNGACLLGTEAPMIGA--LQ 512

Query: 590 ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
             N  + +G+ DG +++WDL+ GK +    G
Sbjct: 513 CYNSALATGTKDGIVRLWDLRVGKPVRLLEG 543

>Kwal_33.15591
          Length = 714

 Score = 75.1 bits (183), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 81/159 (50%), Gaps = 20/159 (12%)

Query: 332 GHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKL---- 387
           GH + V  L  +   + +GS+DTT  +W  F G L   L GH+  V    +D + L    
Sbjct: 103 GHENNVCVLNSSQGYVLSGSWDTTAKVW--FQGALKHELKGHTASV----WDVKMLPEVG 156

Query: 388 --ITGSLDKTIRVWNYITGE-CISTYRG-HTDSV--MSVDSHKKIIVSGSADKTVKVWHV 441
             +T S D TI++W    GE  + T+ G HTD +  + +D+  +   S S D TVK+  +
Sbjct: 157 FYMTASADGTIKLWE---GEKVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDM 213

Query: 442 ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
           E +T  TL GH  +V  VK  P      SC +D T+R+W
Sbjct: 214 EGKTLKTLVGHESFVYSVKFAPNG-DVISCGEDRTVRIW 251

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 64/135 (47%), Gaps = 7/135 (5%)

Query: 370 LTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKI--I 427
           L GH + V  L      +++GS D T +VW    G      +GHT SV  V    ++   
Sbjct: 101 LIGHENNVCVLNSSQGYVLSGSWDTTAKVW--FQGALKHELKGHTASVWDVKMLPEVGFY 158

Query: 428 VSGSADKTVKVWHVESRTCYTLKG-HTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
           ++ SAD T+K+W  E +   T  G HT+ +  + +        SCS+D T+++ D+   T
Sbjct: 159 MTASADGTIKLWEGE-KVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDMEGKT 217

Query: 487 CLRVFRGHVGQVQKV 501
            L+   GH   V  V
Sbjct: 218 -LKTLVGHESFVYSV 231

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 84/197 (42%), Gaps = 49/197 (24%)

Query: 412 GHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSC 471
           GH ++V  ++S +  ++SGS D T KVW  +    + LKGHT  V  VK+ P+     + 
Sbjct: 103 GHENNVCVLNSSQGYVLSGSWDTTAKVWF-QGALKHELKGHTASVWDVKMLPEVGFYMTA 161

Query: 472 SDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTG 531
           S D TI++W+       +V +   G    VI    IDA                    +G
Sbjct: 162 SADGTIKLWEGE-----KVLKTFTGLHTDVIRHIDIDA--------------------SG 196

Query: 532 EDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA-A 590
           E                        SC+ D T+K+ ++  G+ ++T  GH   V+ +  A
Sbjct: 197 E---------------------KFASCSNDGTVKINDME-GKTLKTLVGHESFVYSVKFA 234

Query: 591 DNFRIISGSHDGSIKIW 607
            N  +IS   D +++IW
Sbjct: 235 PNGDVISCGEDRTVRIW 251

 Score = 36.6 bits (83), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 47/92 (51%), Gaps = 6/92 (6%)

Query: 547 KKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFG-HVEGV--WDIAADNFRIISGSHDGS 603
           K +P     ++ + D TIKLWE    + ++T  G H + +   DI A   +  S S+DG+
Sbjct: 150 KMLPEVGFYMTASADGTIKLWE--GEKVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGT 207

Query: 604 IKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPD 635
           +KI D++ GK + T  G +     V  + N D
Sbjct: 208 VKINDME-GKTLKTLVGHESFVYSVKFAPNGD 238

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 80/314 (25%), Positives = 133/314 (42%), Gaps = 73/314 (23%)

Query: 343 NYRLLFTGSYDTTVAIWDLFTGKLIRRL-----TGHSDG---------VKTLYF--DDQK 386
           N   L TG   TT  I+++ TG L+  L     TG  D          ++++ F  D + 
Sbjct: 329 NGEYLATGCNKTT-KIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKF 387

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVESR 444
           L TG+ DK IR+W+    + +   RGH   + S+D  +    +VSGS D+T+++W + + 
Sbjct: 388 LATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTG 447

Query: 445 TCYTLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIP 503
            C       + V  V + P + +  +  S D T+R+WD  +N+   V R           
Sbjct: 448 QCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWD--SNSGFLVER----------- 494

Query: 504 LTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNT 563
              +D++         GE       G G  D    V   R+         +++S +LD +
Sbjct: 495 ---LDSE---------GE------TGVGHKDSVYSVVFTRD-------GKNIVSGSLDRS 529

Query: 564 IKLWEVRS-------------GRCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWD 608
           +KLW +R+             G C  T  GH + V  +    ++  I+SGS D  +  WD
Sbjct: 530 VKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWD 589

Query: 609 LQSGKCMHTFHGRK 622
             SG  +    G +
Sbjct: 590 KVSGVPLLMLQGHR 603

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 91/200 (45%), Gaps = 29/200 (14%)

Query: 330 FKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF---DD 384
            +GH   + +L +  +   L +GS D T+ IWDL TG+    L+   DGV T+     + 
Sbjct: 411 LRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSLTLS-IEDGVTTVAVSPGNG 469

Query: 385 QKLITGSLDKTIRVWNYITGECI-------STYRGHTDSVMSVDSHK--KIIVSGSADKT 435
             +  GSLD+T+RVW+  +G  +        T  GH DSV SV   +  K IVSGS D++
Sbjct: 470 NYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRS 529

Query: 436 VKVWHV--------------ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWD 481
           VK+W++              E     T  GH ++V  V          S S D  +  WD
Sbjct: 530 VKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWD 589

Query: 482 IRTNTCLRVFRGHVGQVQKV 501
             +   L + +GH   V  V
Sbjct: 590 KVSGVPLLMLQGHRNSVISV 609

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 65/137 (47%), Gaps = 25/137 (18%)

Query: 332 GHMDGVLTLQF--NYRLLFTGSYDTTVAIWDL-------------FTGKLIRRLTGHSDG 376
           GH D V ++ F  + + + +GS D +V +W+L               G       GH D 
Sbjct: 504 GHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDF 563

Query: 377 VKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--------DSHKKI 426
           V ++    +DQ +++GS D+ +  W+ ++G  +   +GH +SV+SV         ++  +
Sbjct: 564 VLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNV 623

Query: 427 IVSGSADKTVKVWHVES 443
             +GS D   K+W  ++
Sbjct: 624 FATGSGDCKAKIWKFQT 640

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 98/201 (48%), Gaps = 21/201 (10%)

Query: 338 LTLQFNYRLLFTGSYDTTVAIWD------LFTG---------KLIRRLT---GHSDGVKT 379
           L L  + + L T S D TV  WD      L  G         KLI   T   G       
Sbjct: 473 LDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVK 532

Query: 380 LYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-SH-KKIIVSGSADKTVK 437
           +  +D+ L    LD T++V+   + +   +  GH   V+S+D SH  K+I++ SADK +K
Sbjct: 533 ISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIK 592

Query: 438 VWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVG 496
           +W ++   C+ +L  H + +  VK  P+S + +SCS D T++ WD  +  C++   GH G
Sbjct: 593 IWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQG 652

Query: 497 QVQKVIPLTIIDAQNLVTHER 517
           +V  +   +   A   V+H+R
Sbjct: 653 EVWALAVSSDGQAVVSVSHDR 673

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 120/275 (43%), Gaps = 45/275 (16%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLT-GHSDGVKTLYF--DDQKLITGSLDKTIRVWNYI 402
           L+  G+    + ++DL +  ++  +   H+  + +L    D ++L+T S DKT++ W++ 
Sbjct: 438 LVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFK 497

Query: 403 TGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLH 462
                                ++ +V+G+ DK V    +   T   L G   W  CVK+ 
Sbjct: 498 V--------------------EQELVAGTLDKFVPKMKLIHDTTLDL-GEDLW--CVKIS 534

Query: 463 PKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERK---- 518
           P+         D T++++ + +        GH       +P+  +D    ++H+ K    
Sbjct: 535 PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHK------LPVLSMD----ISHDSKLIIT 584

Query: 519 PGEEDDIASNGTGEDDPENGVNGQRELD---KKMPYPTHLLSCALDNTIKLWEVRSGRCI 575
              + +I   G    D    +   ++     K +P   +  SC+ D T+K W+  S  CI
Sbjct: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCI 644

Query: 576 RTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWD 608
           +  +GH   VW +A  +D   ++S SHD SI++W+
Sbjct: 645 QKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 95/239 (39%), Gaps = 62/239 (25%)

Query: 386 KLITGSLDKTIRVWNYITGECISTYR-----GHTDS-------VMSVDSHKK--IIVSGS 431
           ++ITG+L++ ++ W   TGE + T R     G  D+          +  H++  I+  G 
Sbjct: 36  QVITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGY 94

Query: 432 ADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRV 490
           AD T+K+W ++++T       H+  +  ++         S S D TI +WD+   T L  
Sbjct: 95  ADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCK 154

Query: 491 FRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMP 550
            R H                           +D I       DD                
Sbjct: 155 LRSH---------------------------KDAITGIWCENDD---------------- 171

Query: 551 YPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDL 609
               L+S + D  IKLW+++  +C+ T   H    W +A  +  +I+ + +  IK+W+L
Sbjct: 172 ---WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWEL 227

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 82/172 (47%), Gaps = 15/172 (8%)

Query: 330 FKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD-DQK 386
           F  H   +  L+F+     L +GS D T+ +WDL     + +L  H D +  ++ + D  
Sbjct: 113 FHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDW 172

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVE---- 442
           LI+ S D  I++W+    +C+ T+  HT    S+     ++++ +A+  +K+W ++    
Sbjct: 173 LISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERP 232

Query: 443 SRTCYTLKGHTEWVNCVKLHPKSFSC--------YSCSDDTTIRMWDIRTNT 486
           + +    KG  E  +  +    SF+         YS + D T+ ++ IR+ T
Sbjct: 233 NGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSET 284

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 74/155 (47%), Gaps = 9/155 (5%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD--QKLITGSLDKTIRVWNYIT 403
           +L  G  D T+ IWD+ T  ++     HS  +  L FD    +LI+GS D TI +W+ + 
Sbjct: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148

Query: 404 GECISTYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKL 461
              +   R H D++  +   +   ++S S D  +K+W ++   C  T   HT    C  L
Sbjct: 149 ETGLCKLRSHKDAITGIWCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTG--ECWSL 206

Query: 462 HPKSFSCYSCSDDTTIRMWDI---RTNTCLRVFRG 493
             K     + + ++ I++W++   R N  + + +G
Sbjct: 207 AVKDNMVITANAESEIKLWELDLERPNGSMLLEKG 241

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 91/236 (38%), Gaps = 35/236 (14%)

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVES 443
           D KL+  + +  ++VWN  T  CI                  +++ G+    ++++ + S
Sbjct: 396 DDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLAS 455

Query: 444 RTCY--TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
            T      + HT  +  + L        + S D T++ WD +    L       G + K 
Sbjct: 456 STMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVA-----GTLDKF 510

Query: 502 IP-LTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCAL 560
           +P + +I    L                  GED             K  P    L    L
Sbjct: 511 VPKMKLIHDTTL----------------DLGED---------LWCVKISPEDRFLAVSLL 545

Query: 561 DNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQSGKC 614
           DNT+K++ + S +   + +GH   V   DI+ D+  II+ S D +IKIW L  G C
Sbjct: 546 DNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDC 601

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 15/82 (18%)

Query: 552 PTHLLSCALDNTIKLWEVRSGRCIRT-QFGHVEGVWDIAAD-------------NFRIIS 597
           P  +++ AL+  +K WE+++G  ++T + G   G  D  A+              F +  
Sbjct: 34  PGQVITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAV 92

Query: 598 GSHDGSIKIWDLQSGKCMHTFH 619
           G  DG+IKIWD+Q+   +  FH
Sbjct: 93  GYADGTIKIWDMQTQTVLIVFH 114

>Scas_558.3
          Length = 725

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 83/165 (50%), Gaps = 11/165 (6%)

Query: 332 GHMDGVLTLQFNY-RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGV---KTLYFDDQKL 387
           GH   V  L + +   + +GS+DTT  +W    G L   L GH   V   K +  ++   
Sbjct: 100 GHHSNVCALSYKHMSAIISGSWDTTAKVW--INGALQWSLEGHQASVWDAKIISVEENTF 157

Query: 388 ITGSLDKTIRVWNYITGECISTYRG-HTDSVMSVD--SHKKIIVSGSADKTVKVWHVESR 444
           IT S D+T+++W     + + T+ G H+D + +++  S  K I + S D T+K+  ++  
Sbjct: 158 ITASADRTVKLWK--ENKLLKTFSGIHSDVIRNIEVLSSGKEIATCSNDGTIKISDLDGN 215

Query: 445 TCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLR 489
               L GH  +V  VKL  +     SC +D ++R+WDI  N  ++
Sbjct: 216 IKQVLSGHESFVYNVKLSKQGDKLVSCGEDRSLRIWDINNNFNIK 260

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 98/245 (40%), Gaps = 56/245 (22%)

Query: 370 LTGHSDGVKTL-YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMS---VDSHKK 425
           L GH   V  L Y     +I+GS D T +VW  I G    +  GH  SV     +   + 
Sbjct: 98  LIGHHSNVCALSYKHMSAIISGSWDTTAKVW--INGALQWSLEGHQASVWDAKIISVEEN 155

Query: 426 IIVSGSADKTVKVWHVESRTCYTLKG-HTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
             ++ SAD+TVK+W  E++   T  G H++ +  +++        +CS+D TI++ D+  
Sbjct: 156 TFITASADRTVKLWK-ENKLLKTFSGIHSDVIRNIEVLSSGKEIATCSNDGTIKISDLDG 214

Query: 485 NTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRE 544
           N   +V  GH   V  V                K G++                      
Sbjct: 215 N-IKQVLSGHESFVYNV-------------KLSKQGDK---------------------- 238

Query: 545 LDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFG-HVEGVWDI-AADNFRIISGSHDG 602
                     L+SC  D ++++W++ +   I+         +W +    N  I+ G  D 
Sbjct: 239 ----------LVSCGEDRSLRIWDINNNFNIKQVIKLPAVSIWCVDTLPNGDIVVGCSDN 288

Query: 603 SIKIW 607
           +++I+
Sbjct: 289 TVRIF 293

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 69/183 (37%), Gaps = 59/183 (32%)

Query: 365 KLIRRLTGHSDGVK-TLYFDDQKLITGSLDKTIRVWNY---------------------- 401
           +L   L GH+  VK  +  DD ++ + S D T+R+W +                      
Sbjct: 3   QLSATLLGHTQDVKDIVVIDDSQVASVSRDGTLRLWKHNDNGTWQDIVMATSEKFLNAVC 62

Query: 402 ---------------------------ITGECISTYRGHTDSVMSVD-SHKKIIVSGSAD 433
                                      I  + + T  GH  +V ++   H   I+SGS D
Sbjct: 63  YDKDHELLFYSGQESLINGVSLLDIESIDKDPLYTLIGHHSNVCALSYKHMSAIISGSWD 122

Query: 434 KTVKVWHVESRTCYTLKGHTEWV---NCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRV 490
            T KVW +     ++L+GH   V     + +   +F   + S D T+++W  + N  L+ 
Sbjct: 123 TTAKVW-INGALQWSLEGHQASVWDAKIISVEENTF--ITASADRTVKLW--KENKLLKT 177

Query: 491 FRG 493
           F G
Sbjct: 178 FSG 180

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 77/165 (46%), Gaps = 11/165 (6%)

Query: 319 NWRKGLCTIQEFKGHMDGVLTLQFNYR---LLFTGSYDTTVAIWDLFTGKLIRRLTGH-S 374
           NW K     Q F+GH   V+ + FN +      +   D TV IW L        +T H +
Sbjct: 7   NWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMTAHET 66

Query: 375 DGVKTLYF----DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIV 428
            GV  + +    D   LIT S D+++++W+Y T  C++T  GH  +V     H    II+
Sbjct: 67  RGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPSLPIII 126

Query: 429 SGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCS 472
           SGS D TVK+W+  + +   TL    E   CV  HP     Y  S
Sbjct: 127 SGSEDGTVKIWNANTYKLEKTLNLGLERSWCVAAHPTGKRNYVAS 171

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 58/116 (50%), Gaps = 8/116 (6%)

Query: 395 TIRVWNYITGECIS-TYRGHTDSVMSVDSHKK---IIVSGSADKTVKVWHVESRTC-YTL 449
           TI++WN+     +  T+ GH   VM V  + K      S   D TVK+W +  ++  +T+
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTM 61

Query: 450 KGH-TEWVNCVKLHPKSFSCY--SCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVI 502
             H T  VN V  +P     Y  + SDD ++++WD +T +C+    GH+  V   I
Sbjct: 62  TAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAI 117

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 66/140 (47%), Gaps = 10/140 (7%)

Query: 355 TVAIWDLFTG-KLIRRLTGHSDGVKTLYF---DDQKLITGSLDKTIRVWNYITGECISTY 410
           T+ +W+      L +   GH   V  + F   D     +  LD T+++W+        T 
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTM 61

Query: 411 RGH-TDSVMSVDSH----KKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPK 464
             H T  V  VD +    K  +++ S D++VK+W  ++++C  TL+GH   V+    HP 
Sbjct: 62  TAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPS 121

Query: 465 SFSCYSCSDDTTIRMWDIRT 484
                S S+D T+++W+  T
Sbjct: 122 LPIIISGSEDGTVKIWNANT 141

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 83/192 (43%), Gaps = 51/192 (26%)

Query: 435 TVKVWHVESRTCY--TLKGHTEWVNCVKLHPKSFSCYSCS-DDTTIRMWDIRTNTCLRVF 491
           T+K+W+ E       T +GH  +V CV  +PK  + ++ +  D T+++W +         
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSL--------- 52

Query: 492 RGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVN--GQRELDKKM 549
               GQ      +T         HE +                   GVN      L  K 
Sbjct: 53  ----GQQSPNFTMT--------AHETR-------------------GVNFVDYYPLQDK- 80

Query: 550 PYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGV-WDIAADNFRII-SGSHDGSIKIW 607
           PY   L++ + D ++K+W+ ++  C+ T  GH+  V + I   +  II SGS DG++KIW
Sbjct: 81  PY---LITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSEDGTVKIW 137

Query: 608 DLQSGKCMHTFH 619
           +  + K   T +
Sbjct: 138 NANTYKLEKTLN 149

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 552 PTHLLSCALDNTIKLWEVRSGRCIRTQFGH-VEGV----WDIAADNFRIISGSHDGSIKI 606
           P    S  LD+T+K+W +       T   H   GV    +    D   +I+ S D S+KI
Sbjct: 35  PNTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKI 94

Query: 607 WDLQSGKCMHTFHG 620
           WD Q+  C+ T  G
Sbjct: 95  WDYQTKSCVATLEG 108

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 121/298 (40%), Gaps = 83/298 (27%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFDD-QKLITGSLDKTIRVWNYI 402
           + L TG+ D  + IWD+   K++  L GH   + +L YF    KL++GS D+T+R+W+  
Sbjct: 456 KFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 515

Query: 403 TGEC---ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLK--------- 450
           TG+C   +S   G T   +S     K I +GS D+ V+VW  +S T + ++         
Sbjct: 516 TGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENESG 572

Query: 451 -GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIR------------TNTCLRVFRGHVGQ 497
            GH + V  V       S  S S D ++++W+++            + TC   + GH   
Sbjct: 573 TGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGH--- 629

Query: 498 VQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLS 557
                                   +D + S  T ++D                   ++LS
Sbjct: 630 ------------------------KDFVLSVATTQND------------------EYILS 647

Query: 558 CALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRII--------SGSHDGSIKIW 607
            + D  +  W+ +SG  +    GH   V  +A  N   +        +GS D   +IW
Sbjct: 648 GSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 107/257 (41%), Gaps = 55/257 (21%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWH 440
           D + L TG+ D+ IR+W+    + +   +GH   + S+D       +VSGS D+TV++W 
Sbjct: 454 DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 513

Query: 441 VESRTCYTLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
           + +  C       + V  V + P      +  S D  +R+WD  + T   V R       
Sbjct: 514 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD--SETGFLVER------- 564

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCA 559
                  +D++N                +GTG  D    V   R+          ++S +
Sbjct: 565 -------LDSEN---------------ESGTGHKDSVYSVVFTRD-------GQSVVSGS 595

Query: 560 LDNTIKLWEVR------------SGRCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIK 605
           LD ++KLW ++            SG C  T  GH + V  +A   ++  I+SGS D  + 
Sbjct: 596 LDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVL 655

Query: 606 IWDLQSGKCMHTFHGRK 622
            WD +SG  +    G +
Sbjct: 656 FWDKKSGNPLLMLQGHR 672

 Score = 36.6 bits (83), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 11/89 (12%)

Query: 323 GLCTIQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL 380
           G C +  + GH D VL++    N   + +GS D  V  WD  +G  +  L GH + V ++
Sbjct: 620 GTCEVT-YIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISV 678

Query: 381 YFDDQK--------LITGSLDKTIRVWNY 401
              +            TGS D   R+W Y
Sbjct: 679 AVANGSPLGPEYNVFATGSGDCKARIWKY 707

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 78/158 (49%), Gaps = 17/158 (10%)

Query: 332 GHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGV---KTLYFDDQKLI 388
           GH   V +L F   ++ +GS+D T  +W    G L+  L  H+  V   K + F + K +
Sbjct: 97  GHQGNVCSLSFQDGVVISGSWDKTAKVWK--EGSLVYNLQAHNASVWDAKVVSFSENKFL 154

Query: 389 TGSLDKTIRVWNYITGECISTYRG-HTDSVMSV----DSHKKIIVSGSADKTVKVWHVES 443
           T S DKTI++W     + I T+ G H D V  +    D H    +S S D  +K+  + +
Sbjct: 155 TASADKTIKLWQ--NDKVIKTFSGIHNDVVRHLAVVDDGH---FISCSNDGLIKLVDMHT 209

Query: 444 RTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
                T +GH  +V C+KL P      SC +D T+R+W
Sbjct: 210 GDVLRTYEGHESFVYCIKLLPNG-DIVSCGEDRTVRIW 246

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 71/157 (45%), Gaps = 11/157 (7%)

Query: 345 RLLFTGSYDTTVAIWDLFTGK---LIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNY 401
            LL  G  DT +    LF       +  L GH   V +L F D  +I+GS DKT +VW  
Sbjct: 67  ELLLFGGKDTMINGVPLFATSGEDPLYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVWK- 125

Query: 402 ITGECISTYRGHTDSVMS---VDSHKKIIVSGSADKTVKVWHVESRTCYTLKG-HTEWVN 457
             G  +   + H  SV     V   +   ++ SADKT+K+W    +   T  G H + V 
Sbjct: 126 -EGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQ-NDKVIKTFSGIHNDVVR 183

Query: 458 CVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
            + +        SCS+D  I++ D+ T   LR + GH
Sbjct: 184 HLAVVDDG-HFISCSNDGLIKLVDMHTGDVLRTYEGH 219

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 113/274 (41%), Gaps = 65/274 (23%)

Query: 351 SYDTTVAIW---DLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIR-VWNYITG 404
           S D TV +W   D + G ++    G    + ++ +D +K  L+ G  D  I  V  + T 
Sbjct: 31  SRDGTVRLWSKDDQWLGTVVYTGQGF---LNSVCYDSEKELLLFGGKDTMINGVPLFATS 87

Query: 405 --ECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLH 462
             + + T  GH  +V S+     +++SGS DKT KVW  E    Y L+ H   V   K+ 
Sbjct: 88  GEDPLYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVWK-EGSLVYNLQAHNASVWDAKV- 145

Query: 463 PKSFS---CYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKP 519
             SFS     + S D TI++W  + +  ++ F G    V  V  L ++D           
Sbjct: 146 -VSFSENKFLTASADKTIKLW--QNDKVIKTFSGIHNDV--VRHLAVVD----------- 189

Query: 520 GEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQF 579
                                             H +SC+ D  IKL ++ +G  +RT  
Sbjct: 190 --------------------------------DGHFISCSNDGLIKLVDMHTGDVLRTYE 217

Query: 580 GHVEGVWDIA-ADNFRIISGSHDGSIKIWDLQSG 612
           GH   V+ I    N  I+S   D +++IW  ++G
Sbjct: 218 GHESFVYCIKLLPNGDIVSCGEDRTVRIWSKENG 251

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 100/246 (40%), Gaps = 60/246 (24%)

Query: 386 KLITGSLDKTIRVW---NYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVE 442
           K+ + S D T+R+W   +   G  + T +G  +SV   DS K++++ G  D  +    + 
Sbjct: 26  KVASVSRDGTVRLWSKDDQWLGTVVYTGQGFLNSV-CYDSEKELLLFGGKDTMINGVPLF 84

Query: 443 SRT----CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQV 498
           + +     YTL GH    N   L  +     S S D T ++W  +  + +   + H   V
Sbjct: 85  ATSGEDPLYTLIGHQG--NVCSLSFQDGVVISGSWDKTAKVW--KEGSLVYNLQAHNASV 140

Query: 499 QKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSC 558
                    DA+ +   E K                                     L+ 
Sbjct: 141 W--------DAKVVSFSENK------------------------------------FLTA 156

Query: 559 ALDNTIKLWEVRSGRCIRTQFG-HVEGVWDIAA-DNFRIISGSHDGSIKIWDLQSGKCMH 616
           + D TIKLW+  + + I+T  G H + V  +A  D+   IS S+DG IK+ D+ +G  + 
Sbjct: 157 SADKTIKLWQ--NDKVIKTFSGIHNDVVRHLAVVDDGHFISCSNDGLIKLVDMHTGDVLR 214

Query: 617 TFHGRK 622
           T+ G +
Sbjct: 215 TYEGHE 220

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 85/182 (46%), Gaps = 21/182 (11%)

Query: 338 LTLQFNYRLLFTGSYDTTVAIWD------LFTG---KLIRRLTGHSDGVKTL-------- 380
           L L  + + L TGS D TV  WD      L  G   K +  L  H D    L        
Sbjct: 479 LDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVR 538

Query: 381 -YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH--KKIIVSGSADKTVK 437
              DD+ L    LD T++V+   + +   +  GH   V+S+D     K+I++ SADK +K
Sbjct: 539 VSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 598

Query: 438 VWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVG 496
           +W ++   C+ +L  H + +  VK  P+S + +SCS D  ++ WD     C++    H  
Sbjct: 599 IWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQS 658

Query: 497 QV 498
           +V
Sbjct: 659 EV 660

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 60/287 (20%), Positives = 109/287 (37%), Gaps = 69/287 (24%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLT-GHSDGVKTLYF--DDQKLITGSLDKTIRVWNY- 401
           L+  G+ +  + ++DL +  L+  +   H   + +L    D ++L+TGS DKT++ W++ 
Sbjct: 444 LVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 503

Query: 402 --------ITGECISTYRGHTDSVMS---------VDSHKKIIVSGSADKTVKVWHVESR 444
                      + +   + H D+ +          V    + +     D TVKV+ ++S 
Sbjct: 504 VENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSM 563

Query: 445 TCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIP 503
             Y +L GH   V  + +   S    + S D  I++W +    C +    H   +  V  
Sbjct: 564 KFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV-- 621

Query: 504 LTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNT 563
                                                      K +P   +  SC+ D  
Sbjct: 622 -------------------------------------------KFLPQSHNFFSCSKDAV 638

Query: 564 IKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWD 608
           +K W+     CI+  + H   VW   +A D   ++S SHD SI+IW+
Sbjct: 639 VKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWE 685

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 72/159 (45%), Gaps = 18/159 (11%)

Query: 356 VAIWDLFTGKLIRRLT-----GHSDG-----VKTLYFDDQK----LITGSLDKTIRVWNY 401
           V IWD+ TG L+ +L+     G SD       +  Y +  K    L  G  D  I+VW+ 
Sbjct: 49  VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDL 108

Query: 402 ITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVESRT-CYTLKGHTEWVNC 458
           ++   +  + GH  ++  +  D     ++SGS D  + VW +      Y L+ H + +  
Sbjct: 109 MSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITG 168

Query: 459 VKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQ 497
                + +   S S D  I++WD++T+ C+     H G+
Sbjct: 169 FWCQGEDW-LISTSKDGMIKLWDLKTHQCIETHIAHTGE 206

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 64/144 (44%), Gaps = 9/144 (6%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL--YFDDQKLITGSLDKTIRVWNYI 402
           R L     D TV ++ L + K    L GH   V ++   FD + +IT S DK I++W   
Sbjct: 544 RYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603

Query: 403 TGECISTYRGHTDSVMSV----DSHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVN 457
            G+C  +   H DS+M+V     SH     S S D  VK W  E   C   L  H   V 
Sbjct: 604 FGDCHKSLFAHQDSIMNVKFLPQSHN--FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVW 661

Query: 458 CVKLHPKSFSCYSCSDDTTIRMWD 481
            + +        S S D +IR+W+
Sbjct: 662 ALAVATDGGFVVSSSHDHSIRIWE 685

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 330 FKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK- 386
           F GH   +  LQF+     L +GS D+ + +WDL     + +L  H D +   +   +  
Sbjct: 117 FNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDW 176

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVE 442
           LI+ S D  I++W+  T +CI T+  HT     +     ++++   D  VK+W ++
Sbjct: 177 LISTSKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLD 232

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 93/240 (38%), Gaps = 64/240 (26%)

Query: 386 KLITGSLDKTIRVWNYITGECISTYR-----GHTDSVMS-------VDSHKK--IIVSGS 431
           +LIT +L+  + +W+  TG+ +S        G +D+  +       +++HK   ++  G 
Sbjct: 40  QLITSALED-VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGY 98

Query: 432 ADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRV 490
           AD  +KVW + S+T      GH   +  ++         S S D+ I +WD+     L  
Sbjct: 99  ADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYK 158

Query: 491 FRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNG-TGEDDPENGVNGQRELDKKM 549
            R H                           +D I      GED                
Sbjct: 159 LRSH---------------------------KDSITGFWCQGED---------------- 175

Query: 550 PYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDL 609
                L+S + D  IKLW++++ +CI T   H    W +A  +  +I+   D  +KIW L
Sbjct: 176 ----WLISTSKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKL 231

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 6/141 (4%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWNYIT 403
           LL  G  D  + +WDL +  ++    GH   +  L FD    +LI+GS D  I VW+ + 
Sbjct: 93  LLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVG 152

Query: 404 GECISTYRGHTDSVMSVDSH-KKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKL 461
              +   R H DS+       +  ++S S D  +K+W +++  C  T   HT    C  L
Sbjct: 153 EVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTHQCIETHIAHTG--ECWGL 210

Query: 462 HPKSFSCYSCSDDTTIRMWDI 482
             K     +   D+ +++W +
Sbjct: 211 AVKDDLLITTGTDSQVKIWKL 231

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 98/236 (41%), Gaps = 33/236 (13%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVE 442
           DD KL+  + + ++++WN  T +CI T+               +++ G+ +  ++++ + 
Sbjct: 401 DDNKLLATASNGSLKIWNIKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLA 460

Query: 443 SRTCY-TLK-GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQK 500
           S +   T++  H   +  + L        + S D T++ WD +    L       G   K
Sbjct: 461 SSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVP-----GTKNK 515

Query: 501 VIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCAL 560
            +P+  +       H+      DDI       DD                   +L    L
Sbjct: 516 FLPVLKLH------HDTTLELTDDILCVRVSPDD------------------RYLAISLL 551

Query: 561 DNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQSGKC 614
           DNT+K++ + S +   + +GH   V   DI+ D+  II+ S D +IKIW L  G C
Sbjct: 552 DNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 6/115 (5%)

Query: 332 GHMDGVLTL--QFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--L 387
           GH   VL++   F+ +++ T S D  + IW L  G   + L  H D +  + F  Q    
Sbjct: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNF 630

Query: 388 ITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWH 440
            + S D  ++ W+    ECI     H   V  ++V +    +VS S D ++++W 
Sbjct: 631 FSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWE 685

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 58/148 (39%), Gaps = 52/148 (35%)

Query: 474 DTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGED 533
           D  I++WD+ + T L  F GH    +  I L   D                    GTG  
Sbjct: 100 DGVIKVWDLMSKTVLLNFNGH----KAAITLLQFD--------------------GTG-- 133

Query: 534 DPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRC----IRTQFGHVEGVWDIA 589
                              T L+S + D+ I +W++  G      +R+    + G W   
Sbjct: 134 -------------------TRLISGSKDSNIIVWDL-VGEVGLYKLRSHKDSITGFWCQG 173

Query: 590 ADNFRIISGSHDGSIKIWDLQSGKCMHT 617
            D   +IS S DG IK+WDL++ +C+ T
Sbjct: 174 ED--WLISTSKDGMIKLWDLKTHQCIET 199

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 26/33 (78%), Gaps = 1/33 (3%)

Query: 587 DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFH 619
           DI+ DN ++++ + +GS+KIW++++ KC+ TF 
Sbjct: 398 DISDDN-KLLATASNGSLKIWNIKTHKCIRTFE 429

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 15/85 (17%)

Query: 552 PTHLLSCALDNTIKLWEVRSGRCI-RTQFGHVEGVWDIAA-------------DNFRIIS 597
           P  L++ AL++ + +W++++G  + +   G   G  D                D   +  
Sbjct: 38  PGQLITSALED-VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAV 96

Query: 598 GSHDGSIKIWDLQSGKCMHTFHGRK 622
           G  DG IK+WDL S   +  F+G K
Sbjct: 97  GYADGVIKVWDLMSKTVLLNFNGHK 121

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 78/161 (48%), Gaps = 9/161 (5%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYIT 403
           L F  S    + +++  +   I +  GH D   +L +  D  +++T S D  I+VW+  +
Sbjct: 317 LAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITS 376

Query: 404 GECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWH-VESRTCYTLKGHTEWV--NC 458
           G C++T+  HT SV +V   K+  ++ S S D TV+ W  +  R   T  G TE +  NC
Sbjct: 377 GFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTG-TERIQFNC 435

Query: 459 VKLHPKS-FSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQV 498
           + + P     C    D+  I +W ++T   L    GH G V
Sbjct: 436 LAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPV 476

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 87/186 (46%), Gaps = 23/186 (12%)

Query: 331 KGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD--QK 386
           +GH D   +L +  +   + T S D  + +WD+ +G  +     H+  V  + F    Q 
Sbjct: 342 QGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQV 401

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSV----MSVDSHKKIIVSGSADKT-VKVWHV 441
           + + SLD T+R W+ I      T+ G T+ +    ++VD   +++ +GS D   + VW V
Sbjct: 402 MFSSSLDGTVRAWDLIRYRNFRTFTG-TERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSV 460

Query: 442 ES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQK 500
           ++ +    L GH   V+C+    ++    S S D TIR+W I             G+ Q+
Sbjct: 461 QTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSI------------FGRSQQ 508

Query: 501 VIPLTI 506
           V P+ +
Sbjct: 509 VEPIEV 514

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 63/135 (46%), Gaps = 17/135 (12%)

Query: 323 GLCTIQEFKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL 380
           G C +  F+ H   V  +QF  R  ++F+ S D TV  WDL   +  R  TG     + +
Sbjct: 377 GFC-LATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTG----TERI 431

Query: 381 YFD-------DQKLITGSLDKT-IRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSG 430
            F+        + +  GSLD   I VW+  TG+ +    GH   V  +S      ++ S 
Sbjct: 432 QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASA 491

Query: 431 SADKTVKVWHVESRT 445
           S DKT+++W +  R+
Sbjct: 492 SWDKTIRIWSIFGRS 506

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/309 (22%), Positives = 113/309 (36%), Gaps = 45/309 (14%)

Query: 332 GHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGK---LIRRLTGHSDGVKTLYF--DD 384
           GH   + +L +  + R + T S D +  IW + + +         GH D V   +F  D 
Sbjct: 144 GHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQ 203

Query: 385 QKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESR 444
           +K+ T S D  + VW +       T R   D     +   K       D +   W +  +
Sbjct: 204 EKIYTVSKDGAVFVWEF-------TKRPSDDDDNESEDDDK---QEEVDISKYSWRITKK 253

Query: 445 TCYTLKGHTEWVNCVKLHPKS-----------FSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
             +    +   V CV  HP +           F  Y   D T I+   +  N    V   
Sbjct: 254 HFFY--ANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSMGQNPVNTV--- 308

Query: 494 HVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPT 553
            V Q  + +         L+ +E    + +       G  D  N +          P  +
Sbjct: 309 SVNQTGEWLAFGSSKLGQLLVYE---WQSESYILKQQGHFDSTNSL-------AYSPDGS 358

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQS 611
            +++ + D  IK+W++ SG C+ T   H   V  +  A     + S S DG+++ WDL  
Sbjct: 359 RVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIR 418

Query: 612 GKCMHTFHG 620
            +   TF G
Sbjct: 419 YRNFRTFTG 427

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 127/303 (41%), Gaps = 54/303 (17%)

Query: 407 ISTYRGHTDSVMSVD--------SHKK---IIVSGSADKTVKVWHVESRTC-----YTLK 450
           +++ + HT ++ S+D        S KK   +IV+ S D  + V+   S  C      +L 
Sbjct: 191 LASLQSHTKAITSMDVLFTNYTNSSKKNYLVIVTASKDLQIHVFKWVSEECKFQQIRSLL 250

Query: 451 GHTEWVNCVKLHPKSFSCY--SCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPL--TI 506
           GH   V+ VK+  K+   +  SCS D T+++WD      L+ F+ H   V+ +  L   I
Sbjct: 251 GHEHIVSAVKIWQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQPHSQWVRSIDVLGDYI 310

Query: 507 IDAQNLVTHERKPGEEDDIASNGTGEDDPENGV------NGQRELDKKMPYP-------- 552
           I   +  T         +  S GTG + P   V          E+  + P          
Sbjct: 311 ISGSHDTTLRLTHWPSGNGLSVGTGHEFPIEKVKFIHFIEDSPEIRFRTPSTDRYKNWGM 370

Query: 553 THLLSCALDNTIKLWEV-----------------RSGRCIRTQFGHVEGVWDIAADNFRI 595
            + +S + D TIK+WE+                  + RC+ T  GH+  V DI+     +
Sbjct: 371 QYCVSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCVLTLKGHLSWVRDISIRGQYL 430

Query: 596 ISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHDERTKSAPVACVCIGDSEC 655
            S + D S++ WDL +G+C+H +   KL    VN   + D D  +   P   +  G  +C
Sbjct: 431 FSCADDKSVRCWDLNTGQCLHVW--EKLHTGFVN-CLDLDVDFDSNVTPRQMMVTGGLDC 487

Query: 656 FSG 658
            S 
Sbjct: 488 KSN 490

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/280 (20%), Positives = 111/280 (39%), Gaps = 94/280 (33%)

Query: 343 NYRLLFTGSYDTTVAIWDLFTG----KLIRRLTGHSDGVKTLYF----DDQKLITGSLDK 394
           NY ++ T S D  + ++   +     + IR L GH   V  +      +D  + + S D+
Sbjct: 218 NYLVIVTASKDLQIHVFKWVSEECKFQQIRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQ 277

Query: 395 TIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTL-KGH- 452
           T+++W++  G  + T++ H+  V S+D     I+SGS D T+++ H  S    ++  GH 
Sbjct: 278 TVKIWDFHNGWSLKTFQPHSQWVRSIDVLGDYIISGSHDTTLRLTHWPSGNGLSVGTGHE 337

Query: 453 -----TEWVNCVKLHP------------KSFS---CYSCSDDTTIRMWDIRTNT------ 486
                 ++++ ++  P            K++    C S S D TI++W+I   T      
Sbjct: 338 FPIEKVKFIHFIEDSPEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLMAHRA 397

Query: 487 -----------CLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDP 535
                      C+   +GH+  V+ +                                  
Sbjct: 398 PIPNPTDSNFRCVLTLKGHLSWVRDI---------------------------------- 423

Query: 536 ENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCI 575
              + GQ           +L SCA D +++ W++ +G+C+
Sbjct: 424 --SIRGQ-----------YLFSCADDKSVRCWDLNTGQCL 450

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 74/178 (41%), Gaps = 42/178 (23%)

Query: 326 TIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHS---DGVKTLYF 382
           +++ F+ H   V ++      + +GS+DTT+ +    +G  +   TGH    + VK ++F
Sbjct: 289 SLKTFQPHSQWVRSIDVLGDYIISGSHDTTLRLTHWPSGNGLSVGTGHEFPIEKVKFIHF 348

Query: 383 DD--------------------QKLITGSLDKTIRVWNYITG-----------------E 405
            +                    Q  ++ S D+TI++W                       
Sbjct: 349 IEDSPEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFR 408

Query: 406 CISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTL--KGHTEWVNCVKL 461
           C+ T +GH   V  +    + + S + DK+V+ W + +  C  +  K HT +VNC+ L
Sbjct: 409 CVLTLKGHLSWVRDISIRGQYLFSCADDKSVRCWDLNTGQCLHVWEKLHTGFVNCLDL 466

>Scas_713.50
          Length = 983

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 86/182 (47%), Gaps = 21/182 (11%)

Query: 338 LTLQFNYRLLFTGSYDTTVAIW------DLFTG---KLIRRLTGHSDGVKTLYFD----- 383
           L L  + + L TGS D +V  W      +L  G   K + +L  H D    L  D     
Sbjct: 517 LDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVR 576

Query: 384 ----DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH--KKIIVSGSADKTVK 437
               D+ L    LD T++V+   + +   +  GH   V+S+D     K+I++ SADK +K
Sbjct: 577 VSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 636

Query: 438 VWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVG 496
           +W ++   C+ +L  H + +  VK  P+S + +SCS D  I+ WD     C++    H  
Sbjct: 637 IWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQKLAAHQS 696

Query: 497 QV 498
           +V
Sbjct: 697 EV 698

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 95/241 (39%), Gaps = 54/241 (22%)

Query: 386 KLITGSLDKTIRVWNYITGECISTYR-GHTDSVMSVDS-------------HKK--IIVS 429
           ++ITG+L+  + +W+  TGE  S    G      SVD+             HK+  ++  
Sbjct: 65  QIITGALE-NVNIWDLKTGELASFLNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAV 123

Query: 430 GSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCL 488
           G  D  VKVW + S+T    L GH+  +  +K         S S D+ I +WD+ +   L
Sbjct: 124 GYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGL 183

Query: 489 RVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKK 548
              R H   +                              G   ++  N    + ELD  
Sbjct: 184 YKLRSHKDAI-----------------------------TGIWCNEVTNNNQEENELD-- 212

Query: 549 MPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWD 608
                 L+S + D  IK+W+++  +C+ T   H    W +A  N  +I+ S D  +K W 
Sbjct: 213 -----WLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKFWQ 267

Query: 609 L 609
           L
Sbjct: 268 L 268

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 108/287 (37%), Gaps = 69/287 (24%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLT-GHSDGVKTLYF--DDQKLITGSLDKTIRVWNY- 401
           L+  G+    + ++DL +   I  +   H   + +L    D ++LITGS DK+++ WN+ 
Sbjct: 482 LVIIGTRAGELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQ 541

Query: 402 ITGECIS---------------TYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVESR 444
           +  E +                T    +D ++SV      K +     D TVKV+ ++S 
Sbjct: 542 LEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSM 601

Query: 445 TCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIP 503
             + +L GH   V  + +   S    + S D  I++W +    C +    H   +  V  
Sbjct: 602 KFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV-- 659

Query: 504 LTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNT 563
                                                      K +P   +  SC+ D  
Sbjct: 660 -------------------------------------------KFVPESHNFFSCSKDGI 676

Query: 564 IKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWD 608
           IK W+     CI+    H   VW   IA D   ++S SHD SI+IW+
Sbjct: 677 IKYWDGDKFECIQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWE 723

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 71/151 (47%), Gaps = 16/151 (10%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQ--KLITGSLDKTIRVWNYIT 403
           LL  G  D  V +WDL++  ++  L GHS  +  L FD    +LI+GS D  I VW+ ++
Sbjct: 120 LLAVGYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVS 179

Query: 404 GECISTYRGHTDSVMSV-----------DSHKKIIVSGSADKTVKVWHVESRTCY-TLKG 451
              +   R H D++  +           ++    ++S S D  +K+W ++ + C  T   
Sbjct: 180 EVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIA 239

Query: 452 HTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
           HT    C  L  ++    + S D+ ++ W +
Sbjct: 240 HTG--ECWSLAVRNDLVITTSSDSQVKFWQL 268

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 66/144 (45%), Gaps = 9/144 (6%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL--YFDDQKLITGSLDKTIRVWNYI 402
           + L     D TV ++ L + K    L GH   V ++   FD + +IT S DK I++W   
Sbjct: 582 KFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 641

Query: 403 TGECISTYRGHTDSVMSV----DSHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVN 457
            G+C  +   H DS+M+V    +SH     S S D  +K W  +   C   L  H   V 
Sbjct: 642 FGDCHKSLFAHQDSIMNVKFVPESHN--FFSCSKDGIIKYWDGDKFECIQKLAAHQSEVW 699

Query: 458 CVKLHPKSFSCYSCSDDTTIRMWD 481
            + +   +    S S D +IR+W+
Sbjct: 700 ALAIANDASFVVSSSHDHSIRIWE 723

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 62/131 (47%), Gaps = 16/131 (12%)

Query: 324 LCTIQEFKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLY 381
           LC +    GH   +  L+F+     L +GS D+ + +WDL +   + +L  H D +  ++
Sbjct: 141 LCNLN---GHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIW 197

Query: 382 FDDQK-----------LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSG 430
            ++             LI+ S D  I++W+    +C+ T+  HT    S+     ++++ 
Sbjct: 198 CNEVTNNNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITT 257

Query: 431 SADKTVKVWHV 441
           S+D  VK W +
Sbjct: 258 SSDSQVKFWQL 268

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 94/236 (39%), Gaps = 33/236 (13%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVE 442
           DD KL+  + + ++++WN  T  CI T+               +++ G+    ++++ + 
Sbjct: 439 DDNKLLATASNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLVIIGTRAGELQLFDLA 498

Query: 443 SRT--CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQK 500
           S T      + H   +  + L        + S D +++ W+ +    L       G   K
Sbjct: 499 SSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVP-----GTSDK 553

Query: 501 VIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCAL 560
            +P      +  + H+      DDI S     +D                    L    L
Sbjct: 554 FVP------KLGLHHDTTLELSDDILSVRVSPEDK------------------FLAVSLL 589

Query: 561 DNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQSGKC 614
           DNT+K++ + S +   + +GH   V   DI+ D+  II+ S D +IKIW L  G C
Sbjct: 590 DNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 645

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 553 THLLSCAL-DNTIKLWEVRSGRCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKIWDL 609
           T+LL+    D  +K+W++ S   +    GH   +  +  D    R+ISGS D +I +WDL
Sbjct: 118 TNLLAVGYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDL 177

Query: 610 QSGKCMHTF--HGRKLKGSDVNTSSNPDHDE 638
            S   ++    H   + G   N  +N + +E
Sbjct: 178 VSEVGLYKLRSHKDAITGIWCNEVTNNNQEE 208

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 11/76 (14%)

Query: 553 THLLSCALDNTIKLWEVRSGRCI---RTQFGHVEGVW--DIAADNFR------IISGSHD 601
           T L+S + D+ I +W++ S   +   R+    + G+W  ++  +N        +IS S D
Sbjct: 161 TRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKD 220

Query: 602 GSIKIWDLQSGKCMHT 617
           G IKIWDL+  +C+ T
Sbjct: 221 GLIKIWDLKIQQCVET 236

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 25/33 (75%), Gaps = 1/33 (3%)

Query: 587 DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFH 619
           DI+ DN ++++ + +GS+KIW+L++  C+ TF 
Sbjct: 436 DISDDN-KLLATASNGSLKIWNLKTKLCIRTFE 467

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 82/193 (42%), Gaps = 24/193 (12%)

Query: 330 FKGHMDGVLT------LQFNY-RLLFTGSYDTTVAIWDL------------FTGKLIRRL 370
           F GH   V        ++ NY + + T S D TV  W++                 I   
Sbjct: 432 FVGHAASVSAVCLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTR 491

Query: 371 TGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKI 426
             H   +  +    +D    T S DKT ++WN  TGE ++T   H   +  V     +K 
Sbjct: 492 HAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKW 551

Query: 427 IVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN 485
           I + S DKTVK+W +ES T   TL+GHT  V       K     S   D  I++WDI + 
Sbjct: 552 IATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASG 611

Query: 486 TCLRVFRGHVGQV 498
            C++   GH  ++
Sbjct: 612 DCIKNLDGHSNRI 624

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/311 (22%), Positives = 117/311 (37%), Gaps = 75/311 (24%)

Query: 327 IQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLF-TGK---LIRRLTGHSDGVKTL 380
           +  ++GH D +  L    + + L T S D T  +W    T K   +     GH+  V  +
Sbjct: 383 VNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAV 442

Query: 381 YFDD-------QKLITGSLDKTIRVWN------------YITGECISTYRGHTDSV--MS 419
              +       + +IT S D T++ W             +I    I T   H   +  +S
Sbjct: 443 CLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAIS 502

Query: 420 VDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIR 478
           +  +  I  + S DKT K+W+V++     TL  H   +  V          +CS D T++
Sbjct: 503 MAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVK 562

Query: 479 MWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENG 538
           +W + + T L+   GH   VQ+                                    + 
Sbjct: 563 IWSLESFTVLKTLEGHTNAVQRC-----------------------------------SF 587

Query: 539 VNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA--DNFRII 596
           +N Q++          L+S   D  IK+W++ SG CI+   GH   +W ++   D   II
Sbjct: 588 MNKQKQ----------LVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLII 637

Query: 597 SGSHDGSIKIW 607
           S   D   + W
Sbjct: 638 SADADSVFQFW 648

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 104/251 (41%), Gaps = 51/251 (20%)

Query: 407 ISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVE--SRTCY---TLKGHTEWVNCV 459
           ++ Y GH+D + S+   +  + + + S DKT  +WH    S+  Y   T  GH   V+ V
Sbjct: 383 VNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAV 442

Query: 460 ---KLHPKSFSCY--SCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVT 514
               +  K++  Y  + S+D T++ W+I         +  + +V  ++  +I        
Sbjct: 443 CLPNVMEKNYPKYIITASNDLTVKKWEIPP------MKNDLNEVPFIVKSSI-------- 488

Query: 515 HERKPGEEDDIASNGTGEDDPENGVNGQR-----ELDKKMPYPTH--------------- 554
           + R   E+D  A +    D      +  +      +D   P  T                
Sbjct: 489 YTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCES 548

Query: 555 ---LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFR--IISGSHDGSIKIWDL 609
              + +C+ D T+K+W + S   ++T  GH   V   +  N +  ++S   DG IK+WD+
Sbjct: 549 EKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDI 608

Query: 610 QSGKCMHTFHG 620
            SG C+    G
Sbjct: 609 ASGDCIKNLDG 619

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/188 (18%), Positives = 78/188 (41%), Gaps = 20/188 (10%)

Query: 337 VLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQ------KLITG 390
           V+T      L+  G  D ++ + D+  G +     GH   + +L F  +       L +G
Sbjct: 108 VMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLLGSG 167

Query: 391 SLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK------IIVSGSADKTVKVWHV--- 441
             +   +VW+ +T +C  T + H+ ++  +D  K        +++G  D  + +W     
Sbjct: 168 DTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWRFNIK 227

Query: 442 --ESRTCYTLKGHTEWVNCVKL-HPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQ- 497
              S+   T+  H +   C  + H      Y+   D   ++ D+  ++ ++  +  + + 
Sbjct: 228 GKSSKLVKTIPAHLQIEACGFITHNDETFAYTAGGDAVFQIIDLNESSVVKCTKKPIEEL 287

Query: 498 -VQKVIPL 504
            +  VIP+
Sbjct: 288 FITGVIPI 295

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 12/84 (14%)

Query: 330 FKGHMDGVLTLQF------NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF- 382
           FKGH   + +L+F      N  LL +G  +    +WDL T K    +  HS  ++ + F 
Sbjct: 141 FKGHGGTISSLKFYGELGTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFT 200

Query: 383 --DDQ---KLITGSLDKTIRVWNY 401
             DD+    LITG  D  + +W +
Sbjct: 201 KNDDKDVLNLITGGRDNVLNLWRF 224

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/106 (20%), Positives = 48/106 (45%), Gaps = 18/106 (16%)

Query: 548 KMPYPTHLLSC----------ALDNTIKLWEVRSGRCIRTQFGH------VEGVWDIAAD 591
           K+  P+++++C            D +I + ++ +G    +  GH      ++   ++  +
Sbjct: 101 KVSSPSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTN 160

Query: 592 NFRIISGSHDGSIKIWDLQSGKCMHTF--HGRKLKGSDVNTSSNPD 635
            + + SG  +G  K+WDL + KC  T   H   ++G D   + + D
Sbjct: 161 IWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKD 206

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 41/86 (47%), Gaps = 14/86 (16%)

Query: 551 YPTHLLSCALDNTIKLWEVRSGR------------CIRTQFGHVEGVWDI--AADNFRII 596
           YP ++++ + D T+K WE+   +             I T+  H + +  I  A ++    
Sbjct: 452 YPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSIFA 511

Query: 597 SGSHDGSIKIWDLQSGKCMHTFHGRK 622
           + S+D + K+W++ +G+ + T    K
Sbjct: 512 TASYDKTCKLWNVDTGEPVATLANHK 537

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/310 (22%), Positives = 118/310 (38%), Gaps = 76/310 (24%)

Query: 330 FKGHMDGVLTLQFNYRLLF--TGSYDTTVAIWDLFTG----KLIRRLTGHSDGVKTLYFD 383
           ++GH D + +L      L+  T S D +V +W         +   +  GH+  V  +   
Sbjct: 378 YEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALP 437

Query: 384 D-------QKLITGSLDKTIRVWN-------------YITGECISTYRGHTDSV--MSVD 421
           +       + L+T S D TI+ W              +I      T R H   +  +S+ 
Sbjct: 438 NVMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMS 497

Query: 422 SHKKIIVSGSADKTVKVWHVESRTC-YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
            +  I  + S DKT K+W+V++     TL  H   +  V      +   +CS D +I +W
Sbjct: 498 PNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLW 557

Query: 481 DIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVN 540
            + + T L+   GH   VQ+V                                   + +N
Sbjct: 558 SLESFTVLKTLEGHTNAVQRV-----------------------------------SFIN 582

Query: 541 GQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA--DNFRIISG 598
           G ++          L+S   D  +K+W+  +G C+RT   H   +W +A   D   II+ 
Sbjct: 583 GNKQ----------LVSTGADGLVKIWDCSTGECVRTLDAHNNRIWALAVANDGQLIITA 632

Query: 599 SHDGSIKIWD 608
             DG  + W+
Sbjct: 633 DADGVFQFWE 642

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 61/276 (22%), Positives = 110/276 (39%), Gaps = 74/276 (26%)

Query: 372 GHSDGVKTL--YFDDQKLITGSLDKTIRVWNY----ITGECISTYRGHTDSVMSVD---- 421
           GH+D + +L    D   L T S D ++ +W Y     + E  + + GH   V ++     
Sbjct: 380 GHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNV 439

Query: 422 ---SHKKIIVSGSADKTVKVW--------------HVESRTCYTLKGHTEWVNCVKLHPK 464
              +  + +++ S D T+K W              H+   + YT + H + +N + + P 
Sbjct: 440 MNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPN 499

Query: 465 SFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDD 524
                + S D T ++W++ T           G+V+            L  H+R       
Sbjct: 500 DSIFATASYDKTCKIWNVDT-----------GEVEA----------TLANHKR------- 531

Query: 525 IASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEG 584
                        G+ G    +    Y   L +C+ D +I LW + S   ++T  GH   
Sbjct: 532 -------------GLWGVAFCE----YDWLLATCSGDRSINLWSLESFTVLKTLEGHTNA 574

Query: 585 VWDIAA--DNFRIISGSHDGSIKIWDLQSGKCMHTF 618
           V  ++    N +++S   DG +KIWD  +G+C+ T 
Sbjct: 575 VQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTL 610

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 67/119 (56%), Gaps = 5/119 (4%)

Query: 325 CTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
            T+   K  + GV   ++++ LL T S D ++ +W L +  +++ L GH++ V+ + F  
Sbjct: 524 ATLANHKRGLWGVAFCEYDW-LLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFIN 582

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVW 439
            +++L++   D  +++W+  TGEC+ T   H + +  ++V +  ++I++  AD   + W
Sbjct: 583 GNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWALAVANDGQLIITADADGVFQFW 641

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 65/143 (45%), Gaps = 17/143 (11%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK------LITGSLDKTIRVW 399
           LL  G  D +V ++D+  G +   L GH   + ++ F  +       L +G  +  +++W
Sbjct: 115 LLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIW 174

Query: 400 NYITGECISTYRGHTDSVMSVD-----SHKKIIVSGSADKTVKVWHVESRTCYTLKGHTE 454
           + +   CI T + HT +V  +D       + +++SG  D  V V H      + +K   +
Sbjct: 175 DLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHVHH------FDMKKKCK 228

Query: 455 WVNCVKLHPKSFSCYSCSDDTTI 477
            +  + +  +  SC    D+T++
Sbjct: 229 LLQTIPVKRQIESCGFIGDNTSL 251

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 87/219 (39%), Gaps = 28/219 (12%)

Query: 425 KIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
           +II +  A +  +V  +E+      +GHT+ +N +          + S D ++ +W  R 
Sbjct: 357 RIIPTPQASEDKEVMEIETEM---YEGHTDLLNSLDATSDGLWLATASKDHSVILW--RY 411

Query: 485 NTC------LRVFRGHVGQVQKVI---------PLTIIDAQNLVTHER----KPGEEDDI 525
           N           F GH G V  +          P  ++ A N +T +R     P +   I
Sbjct: 412 NEASSSFEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAI 471

Query: 526 ASNGTGEDDPENGVNGQRELD--KKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVE 583
                 +         +++++     P  +   + + D T K+W V +G    T   H  
Sbjct: 472 ELPHIVKASEYTRRAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKR 531

Query: 584 GVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
           G+W +A    ++ + + S D SI +W L+S   + T  G
Sbjct: 532 GLWGVAFCEYDWLLATCSGDRSINLWSLESFTVLKTLEG 570

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 47/99 (47%), Gaps = 18/99 (18%)

Query: 548 KMPYPTHLLSC----------ALDNTIKLWEVRSGRCIRTQFGH------VEGVWDIAAD 591
           K+  P ++L C            D ++ ++++ +G    +  GH      V+   ++ + 
Sbjct: 99  KISSPAYVLDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSG 158

Query: 592 NFRIISGSHDGSIKIWDLQSGKCMHTF--HGRKLKGSDV 628
            + + SG  +G +KIWDL   +C+HT   H   ++G D+
Sbjct: 159 MWLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAVRGLDI 197

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 41/88 (46%), Gaps = 5/88 (5%)

Query: 417 VMSVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPK--SFSCYSCSD 473
           V+  D    ++  G  D +V V+ + +    ++LKGH   ++ VK + +  S      S 
Sbjct: 106 VLDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASG 165

Query: 474 DTT--IRMWDIRTNTCLRVFRGHVGQVQ 499
           DT   +++WD+    C+   + H   V+
Sbjct: 166 DTNGMVKIWDLVKRRCIHTVQEHTAAVR 193

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 85/182 (46%), Gaps = 10/182 (5%)

Query: 327 IQEFKGHMDGVLTLQFNYR---LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF- 382
           IQ+     + V T+  N     L F  S    + +++  +   I +  GH D +  L + 
Sbjct: 306 IQQLSMGQNAVNTVAVNRSGEWLAFGSSTLGQLLVYEWQSESYILKQQGHFDALNALAYS 365

Query: 383 -DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVW 439
            D  +++T + D  I++W+ ++G C++T+  HT SV SV   K  +I+ S S D TVK W
Sbjct: 366 PDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAW 425

Query: 440 HVESRTCYTLKGHTEWV--NCVKLHPKS-FSCYSCSDDTTIRMWDIRTNTCLRVFRGHVG 496
            +     +     TE +  +C+   P     C    D+  I++W ++T   L    GH G
Sbjct: 426 DLMRFRNFRTFTATERIQFSCLAADPTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEG 485

Query: 497 QV 498
            V
Sbjct: 486 PV 487

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 88/184 (47%), Gaps = 23/184 (12%)

Query: 331 KGHMDGVLTLQFN---YRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQ 385
           +GH D +  L ++    R++ T + D  + IWD+ +G  +     H+  V ++ F  + Q
Sbjct: 353 QGHFDALNALAYSPDGARIV-TAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQ 411

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTD---SVMSVDSHKKIIVSGSADKT-VKVWHV 441
            + + SLD T++ W+ +      T+        S ++ D   +++ +GS D   ++VW V
Sbjct: 412 IMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCAGSLDNYDIQVWSV 471

Query: 442 ES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQK 500
           ++ +   TL GH   V+C+    ++    S S D TIR+W I             G+ Q+
Sbjct: 472 QTGQLLDTLSGHEGPVSCLSFSRENSILASASWDKTIRVWSI------------FGRSQQ 519

Query: 501 VIPL 504
           V P+
Sbjct: 520 VEPI 523

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 74/194 (38%), Gaps = 56/194 (28%)

Query: 436 VKVWHVESRTCYTLK--GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
           V  W  ES   Y LK  GH + +N +   P      + ++D  I++WDI +  CL  F  
Sbjct: 340 VYEWQSES---YILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEE 396

Query: 494 HVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPT 553
           H   V  V                                  +   NGQ           
Sbjct: 397 HTSSVTSV----------------------------------QFAKNGQI---------- 412

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWD--IAAD--NFRIISGSHDG-SIKIWD 608
            + S +LD T+K W++   R  RT F   E +    +AAD     + +GS D   I++W 
Sbjct: 413 -MFSSSLDGTVKAWDLMRFRNFRT-FTATERIQFSCLAADPTGEVVCAGSLDNYDIQVWS 470

Query: 609 LQSGKCMHTFHGRK 622
           +Q+G+ + T  G +
Sbjct: 471 VQTGQLLDTLSGHE 484

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 564 IKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTF 618
           + ++E +S   I  Q GH + +  +A   D  RI++ + DG IKIWD+ SG C+ TF
Sbjct: 338 LLVYEWQSESYILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATF 394

>Kwal_23.5351
          Length = 474

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 103/238 (43%), Gaps = 55/238 (23%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRG-HTDSVMSV--DSHKKIIVSGSADKTVKVW 439
           D   L  GS +  +++ +  + E + +  G H D +  V   S  +++ +G AD  VK+W
Sbjct: 193 DGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIW 252

Query: 440 HVESRTC-----YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
           + ++++        L+GH   V+ VK HP      S S D T R+WD+   T L++  GH
Sbjct: 253 NPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGH 312

Query: 495 VGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTH 554
             +V  +                      D   +G                       + 
Sbjct: 313 AKEVYCL----------------------DFQCDG-----------------------SL 327

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQ 610
           L S  LD+   +W++R+GR +    GH + ++ +  + +   + +GS DG++++WD++
Sbjct: 328 LCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIR 385

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 115/283 (40%), Gaps = 30/283 (10%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTG-HSDGVKTLYF--DDQKLITGSLDKTIRVWN--- 400
           L  GS++  V I    + +++R L G H D +  + +  D Q L TG  D  +++WN   
Sbjct: 197 LAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQA 256

Query: 401 -YITGECISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVESRTCYTLK-GHTEWV 456
              +       RGH   V  V  H   + + S S D T ++W VE  T   L+ GH + V
Sbjct: 257 QSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEV 316

Query: 457 NCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV--------IPLTIID 508
            C+          S   D+   +WD+RT   L V  GH   +  V        +     D
Sbjct: 317 YCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGD 376

Query: 509 AQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWE 568
               V   RK  +   I ++        N +  +   +K+      L+S + D TI ++ 
Sbjct: 377 GTVQVWDIRKANKPSSILAH--------NSIVSEVNFEKE--NGNFLVSSSYDRTIGVFA 426

Query: 569 VRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDL 609
             S   + +  GH + +   DI+     + S   D S+KIW L
Sbjct: 427 TGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 80/164 (48%), Gaps = 8/164 (4%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           +Q  +GH   V  L F  +  LL +   D+   +WD+ TG+ +  L GH+  +  + +  
Sbjct: 306 LQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSP 365

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK---IIVSGSADKTVKVW 439
           +   + TGS D T++VW+       S+   H   V  V+  K+    +VS S D+T+ V+
Sbjct: 366 NGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVF 425

Query: 440 HVESRT-CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
              S     +L+GHT+ +  V +     + +S   D ++++W +
Sbjct: 426 ATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 80/180 (44%), Gaps = 8/180 (4%)

Query: 330 FKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQ 385
            +GH   V  ++F+   R + + S+D T  +WD+     ++   GH+  V  L F  D  
Sbjct: 267 LRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGS 326

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHV-E 442
            L +  LD    VW+  TG  +    GH   +  V    +   + +GS D TV+VW + +
Sbjct: 327 LLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRK 386

Query: 443 SRTCYTLKGHTEWVNCVKLHPKSFS-CYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
           +    ++  H   V+ V    ++ +   S S D TI ++   +   L   +GH  ++  V
Sbjct: 387 ANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILSV 446

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 84/178 (47%), Gaps = 18/178 (10%)

Query: 327 IQEFKGHMDGVLTLQF---NYRLLFTGSYDTTVAIWDLFTG-KLIRRLTGHSDGVKTLYF 382
           I  +KGH +G  +L+       L+ +G  D TV +WD +   K +R   GHS  +KTL F
Sbjct: 141 IYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDF 200

Query: 383 --DDQKLITGSLDKTIRVWNYITGEC---ISTYRGHTDSVMSVDSHKKIIVSGSADKTVK 437
             D  + ++GS D+ +++W+  TG+    ++TY     +     S  + +V  S+ K   
Sbjct: 201 TSDSSQFLSGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSK--- 257

Query: 438 VWHVESRT------CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLR 489
           + H ++R             H   +  +K  P      S S+D T+R+W+ + N  ++
Sbjct: 258 IKHYDTRVSEKDGLVQVYDHHLSSILAIKYFPDGSKFISSSEDKTLRIWNNQVNIPIK 315

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 5/79 (6%)

Query: 540 NGQRELDKKMPYPTHL-LSCALDNTIKLWEVRSGR-CIRTQFGHVEGV--WDIAADNFRI 595
           NG   L + +P   HL LS   DNT+KLW+    R C+R   GH + +   D  +D+ + 
Sbjct: 149 NGTTSL-RLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQF 207

Query: 596 ISGSHDGSIKIWDLQSGKC 614
           +SGS+D  +KIWD ++GK 
Sbjct: 208 LSGSYDQQVKIWDTETGKV 226

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 88/182 (48%), Gaps = 21/182 (11%)

Query: 338 LTLQFNYRLLFTGSYDTTVAIWDLFTGKL-IRRLTGHSDGVKTLYFD------------- 383
           L L  + R L TGS D TV  W     ++ +   +  +  +  L+ D             
Sbjct: 476 LDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVV 535

Query: 384 ---DQKLITGSL-DKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVK 437
              D K I  SL D T++V+   + +   +  GH   V+S+D     K+IV+ SADK +K
Sbjct: 536 ISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIK 595

Query: 438 VWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVG 496
           +W ++   C+ +L  H + +  VK  P+S++ +SCS D T++ WD +   C++    H  
Sbjct: 596 IWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQS 655

Query: 497 QV 498
           +V
Sbjct: 656 EV 657

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 108/287 (37%), Gaps = 69/287 (24%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGV---KTLYFDDQKLITGSLDKTIRVWNYI 402
           L+  G+ +  + ++D+ +  ++    G  D       L  D +KL+TGS DKT+R W + 
Sbjct: 441 LVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFE 500

Query: 403 TGEC-ISTYRGHT---------------DSVMSV--DSHKKIIVSGSADKTVKVWHVESR 444
             E  +S     T               D ++SV      K I     D TVKV+ ++S 
Sbjct: 501 VSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSM 560

Query: 445 TCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIP 503
             + +L GH   V  + +   S    +CS D  I++W +    C +    H   +  V  
Sbjct: 561 KFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNV-- 618

Query: 504 LTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNT 563
                                                      K +P   +  SC+ D T
Sbjct: 619 -------------------------------------------KFLPESYNFFSCSKDAT 635

Query: 564 IKLWEVRSGRCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWD 608
           +K W+ +   CI+    H   VW I+   D   +IS  HD SI++W+
Sbjct: 636 VKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 66/141 (46%), Gaps = 6/141 (4%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWNYIT 403
           LL  G  D  + IWDL +  ++    GH   +  L FD    +LI+ S D  I VW+ + 
Sbjct: 93  LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVG 152

Query: 404 GECISTYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKL 461
              +   R H D++  +    +  ++S S D  VK+W ++S+ C  T   HT    C  L
Sbjct: 153 ESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTG--ECWSL 210

Query: 462 HPKSFSCYSCSDDTTIRMWDI 482
                   +CS D+ +++W +
Sbjct: 211 GIIEDMAVTCSADSQVKLWKL 231

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 61/116 (52%), Gaps = 3/116 (2%)

Query: 330 FKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK- 386
           F GH   +  L F+     L + S D+ + +WDL     + +L  H D +  L+ +D+  
Sbjct: 117 FNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENW 176

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVE 442
           LI+ S D  +++W+  + +C+ T+  HT    S+   + + V+ SAD  VK+W ++
Sbjct: 177 LISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLD 232

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 76/159 (47%), Gaps = 18/159 (11%)

Query: 356 VAIWDLFTGKLIRRLT-----GHSDG-----VKTLYF----DDQKLITGSLDKTIRVWNY 401
           + +WD+ TG+ I +LT     G SD       +T +     +   L  G  D  I++W+ 
Sbjct: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108

Query: 402 ITGECISTYRGHTDS--VMSVDSHKKIIVSGSADKTVKVWHVESRT-CYTLKGHTEWVNC 458
           I+   + ++ GH  +  V++ D+    ++S S D  + VW +   +  Y L+ H + +  
Sbjct: 109 ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITG 168

Query: 459 VKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQ 497
           +    +++   S S D  +++WD+++  C+     H G+
Sbjct: 169 LWCEDENW-LISTSKDGLVKIWDLKSQQCVETHLAHTGE 206

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/262 (19%), Positives = 103/262 (39%), Gaps = 39/262 (14%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVE 442
           DD KL+  + + ++++WN  T  CI ++               ++V G+ +  ++++ + 
Sbjct: 398 DDNKLLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIA 457

Query: 443 SRTCYTLK--GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQK 500
           S T    K   H   +  + L        + S D T+R W    +           +  K
Sbjct: 458 SSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEV-----PVSDESNK 512

Query: 501 VIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVN-------------------- 540
            +P+  +       H+     +DDI S     DD    V+                    
Sbjct: 513 TMPMLQL------FHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSL 566

Query: 541 -GQR--ELDKKMPYPTHLL-SCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFR 594
            G +   L   + Y + L+ +C+ D  IK+W +  G C ++ F H + + ++    +++ 
Sbjct: 567 YGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYN 626

Query: 595 IISGSHDGSIKIWDLQSGKCMH 616
             S S D ++K WD Q  +C+ 
Sbjct: 627 FFSCSKDATVKYWDGQKFECIQ 648

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 53/115 (46%), Gaps = 6/115 (5%)

Query: 332 GHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKL 387
           GH   VL++  +Y  +L+ T S D  + IW L  G   + L  H D +  + F  +    
Sbjct: 568 GHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNF 627

Query: 388 ITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWH 440
            + S D T++ W+    ECI     H   V  +SV +    ++S   D +++VW 
Sbjct: 628 FSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 72/163 (44%), Gaps = 22/163 (13%)

Query: 459 VKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIID--AQNLVTHE 516
           +K HP++    +   D  I++WD+ + T L  F GH    +  I +   D     L++  
Sbjct: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH----KSAITVLAFDTTGTRLISAS 140

Query: 517 RKPGEEDDIASNGTGED------DPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVR 570
           +   + D I  +  GE         ++ + G    D+       L+S + D  +K+W+++
Sbjct: 141 K---DSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENW-----LISTSKDGLVKIWDLK 192

Query: 571 SGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIW--DLQS 611
           S +C+ T   H    W +       ++ S D  +K+W  DLQ+
Sbjct: 193 SQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQA 235

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 57/134 (42%), Gaps = 10/134 (7%)

Query: 493 GHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGT--GEDDPENGVNGQRELDKKMP 550
           G++GQV       +   +N++  + K GE+    ++G   G  D +     +    K  P
Sbjct: 36  GNLGQV------IVGGLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHP 89

Query: 551 YPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWD 608
               L +   D  IK+W++ S   + +  GH   +  +A D    R+IS S D  I +WD
Sbjct: 90  ETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWD 149

Query: 609 LQSGKCMHTFHGRK 622
           L     ++     K
Sbjct: 150 LVGESGLYKLRSHK 163

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/66 (21%), Positives = 33/66 (50%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKC 614
           LL+ A + ++K+W +++ RCIR+                 ++ G+ +G ++++D+ S   
Sbjct: 402 LLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTM 461

Query: 615 MHTFHG 620
           +    G
Sbjct: 462 LDNKEG 467

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 78/158 (49%), Gaps = 9/158 (5%)

Query: 332 GHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGV-KTLYFDDQKLITG 390
           GH   V  L+F   LL + S+D T  IWD    KL   L  H   V  +    D  ++T 
Sbjct: 100 GHTGNVCGLRFQNGLLLSSSWDKTAKIWD--NNKLKYDLRNHEASVWDSTMVSDDIILTA 157

Query: 391 SLDKTIRVWNYITGECISTYRG-HTDSVMSVDS-HKKIIVSGSADKTVKVWHVESRTCYT 448
           S DK+I VW  + G+ I      H D +  ++     I  S S D T+K+ ++E      
Sbjct: 158 SADKSIGVW--MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLNLEGEIKNV 215

Query: 449 LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
            +GH  +V CVK H  + + +SC +D+T+R+W I  +T
Sbjct: 216 FEGHESFVYCVK-HMNN-TLFSCGEDSTVRIWSINGST 251

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 66/137 (48%), Gaps = 6/137 (4%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTG-HSDGVKTL-YFDDQKLITGSLDKTIRVWNYIT 403
           ++ T S D ++ +W    GKLI++L+  H D ++ L Y  +    + S D TI++ N + 
Sbjct: 153 IILTASADKSIGVW--MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLN-LE 209

Query: 404 GECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHP 463
           GE  + + GH   V  V      + S   D TV++W +   T   ++     V  + L P
Sbjct: 210 GEIKNVFEGHESFVYCVKHMNNTLFSCGEDSTVRIWSINGSTKQVIRIPAVSVWNLDLLP 269

Query: 464 KSFSCYSCSDDTTIRMW 480
                  CSD+ TIR++
Sbjct: 270 NGDFVICCSDN-TIRIF 285

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 127/307 (41%), Gaps = 35/307 (11%)

Query: 335 DGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFDDQKLITGSLD 393
           D V +L      +++GSYD  V  ++L +GK+ ++ +GHS  ++ + Y    +L++   D
Sbjct: 104 DWVSSLDVGSNYIYSGSYDGIVRTYNL-SGKVEKQYSGHSGPIRAVHYISSTRLVSAGND 162

Query: 394 KTIRVWNYIT-------------GECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWH 440
           +T+R+W                 G+ ++   GH   V+S+D  K  I+S S D TV +W 
Sbjct: 163 RTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSASCDNTVSLWS 222

Query: 441 VESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQK 500
              +    +    +    V    K     +  D +      IR    L +F  H   V+ 
Sbjct: 223 TNYKEMTVIDPMEDLGGNVSTAAKKRRKLTLKDGS------IRRRAPLALFESHSAPVEA 276

Query: 501 VIPLTIIDAQNL-VTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSC- 558
           VI     D     V+ +      D I +           +    +L K      +LL+C 
Sbjct: 277 VIFDKSDDTVGYSVSQDHTIKTWDLITAKCVDTKTTSYSLLSVAQLPK-----LNLLACG 331

Query: 559 --ALDNTIKLWEVRSGRCIRTQ--FGHVEGV--WDIAADN-FRIISGSHDGSIKIWDLQS 611
             A   T+    V S   I  Q   GH   V   D   +N + I S SHDG++K+WD++S
Sbjct: 332 SSARHITLHDPRVNSSSKITQQQLVGHKNFVVALDTCPENEYMICSASHDGTVKVWDVRS 391

Query: 612 GKCMHTF 618
              M+T 
Sbjct: 392 NTAMYTI 398

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 113/275 (41%), Gaps = 45/275 (16%)

Query: 364 GKLIRRLTGHSDGVKTLYFDDQKLI---TGSLDKTIRVWNYITGECISTYRGHTDSVMSV 420
           G+L + L  H D + +L  + Q  +   T +LD  I++W+  T +C+    GH  +V + 
Sbjct: 270 GQLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTT 329

Query: 421 D--SHKKIIVSGSADKTVKVWHVESRT-----------CYTLKGHTEWVNCVKLHPKSFS 467
                 +++ S   D +VKVW V++               T  GH + V    L     +
Sbjct: 330 RFIDDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTA--LATTGNA 387

Query: 468 CYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIAS 527
             S S+D T+R WD+ +  C++        +   I L ++  Q++   +  P     +  
Sbjct: 388 IVSGSNDKTLRHWDLGSGKCIQ-------SIDLTIALKMV-PQSVSKLDITPSFNTPLIG 439

Query: 528 NGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWD 587
              G D  +N                 L++   D  + LW++R GR + +  GH   +  
Sbjct: 440 ---GADCIDNA----------------LVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITS 480

Query: 588 IAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRK 622
           +      +I+GS D S +IWDL+ G         K
Sbjct: 481 LKYMGSELITGSMDKSTRIWDLRMGSVAELLSFEK 515

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 94/209 (44%), Gaps = 36/209 (17%)

Query: 328 QEFKGHMDGVLTLQFNYRLLF---TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-D 383
           +  K H D + +L  N +L     T + D  + +WD+ T + +  L+GH   V T  F D
Sbjct: 274 KTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFID 333

Query: 384 DQKLI-TGSLDKTIRVW----------NYITGECISTYRGHTDSVMSVDSHKKIIVSGSA 432
           D +L+ +   D +++VW          N     C++T+ GH DSV ++ +    IVSGS 
Sbjct: 334 DTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATTGNAIVSGSN 393

Query: 433 DKTVKVWHVESRTC-------YTLKGHTEWVNCVKLHPKSF-------------SCYSCS 472
           DKT++ W + S  C         LK   + V+ + + P SF             +  + +
Sbjct: 394 DKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITP-SFNTPLIGGADCIDNALVTGT 452

Query: 473 DDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
            D  + +WD+R    +    GH G +  +
Sbjct: 453 KDGIVYLWDLRIGRVVGSLEGHRGPITSL 481

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 52/93 (55%), Gaps = 1/93 (1%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGEC 406
           L TG+ D  V +WDL  G+++  L GH   + +L +   +LITGS+DK+ R+W+   G  
Sbjct: 448 LVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGSELITGSMDKSTRIWDLRMG-S 506

Query: 407 ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVW 439
           ++        V+SV+  +  +++    + VK++
Sbjct: 507 VAELLSFEKEVVSVEESQTQLINALEGEPVKIY 539

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 71/184 (38%), Gaps = 44/184 (23%)

Query: 317 ESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRR------- 369
           + N    LC +  F GH D V  L      + +GS D T+  WDL +GK I+        
Sbjct: 359 DGNANDNLC-LATFDGHKDSVTALATTGNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIAL 417

Query: 370 -------------------LTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTY 410
                              L G +D +      D  L+TG+ D  + +W+   G  + + 
Sbjct: 418 KMVPQSVSKLDITPSFNTPLIGGADCI------DNALVTGTKDGIVYLWDLRIGRVVGSL 471

Query: 411 RGHTDSVMSVDSHKKIIVSGSADKTVKVWHV-----------ESRTCYTLKGHTEWVNCV 459
            GH   + S+      +++GS DK+ ++W +           E       +  T+ +N +
Sbjct: 472 EGHRGPITSLKYMGSELITGSMDKSTRIWDLRMGSVAELLSFEKEVVSVEESQTQLINAL 531

Query: 460 KLHP 463
           +  P
Sbjct: 532 EGEP 535

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 12/90 (13%)

Query: 557 SCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI-AADNFRII-SGSHDGSIKIWDLQS--- 611
           +  LDN IKLW++ + +C+    GH   V      D+ R++ S   D S+K+WD+ +   
Sbjct: 298 TANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFIDDTRLLASAGKDASVKVWDVDNIVD 357

Query: 612 -------GKCMHTFHGRKLKGSDVNTSSNP 634
                    C+ TF G K   + + T+ N 
Sbjct: 358 KDGNANDNLCLATFDGHKDSVTALATTGNA 387

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 57/115 (49%), Gaps = 3/115 (2%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWH 440
           +D    T S DKT ++WN   GE  +T   H   +  V    + K++ + S DKTVK+W 
Sbjct: 502 NDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWS 561

Query: 441 VESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
           +++ +   TL+GHT  V       K     SC  D  I++WD  +  CL+   GH
Sbjct: 562 LDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGH 616

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 64/120 (53%), Gaps = 5/120 (4%)

Query: 338 LTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKT 395
           L++  N  +  T SYD T  IW+L  G+L   L  H  G+  + F   D+ L T S DKT
Sbjct: 497 LSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKT 556

Query: 396 IRVWNYITGECISTYRGHTDSVM--SVDSHKKIIVSGSADKTVKVWHVESRTCY-TLKGH 452
           +++W+  T   + T  GHT++V   S  + +K ++S  AD  +K+W   S  C  TL GH
Sbjct: 557 VKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGH 616

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/309 (22%), Positives = 117/309 (37%), Gaps = 73/309 (23%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLF--TGSYDTTVAIWDLFTGK----LIRRLTGHSDGVKTL 380
           ++ ++GH D + +L      L+  T S D T  +W          +  +  GHS  V  +
Sbjct: 381 VEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAV 440

Query: 381 YFDD-------QKLITGSLDKTIRVWNYITGEC--------ISTYRGHTD----SVMSVD 421
              +       + L+T S D TI+ W               +S Y  H      + +SV 
Sbjct: 441 GLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVS 500

Query: 422 SHKKIIVSGSADKTVKVWHVESRTC-YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
            +  I  + S DKT K+W++E+     TL  H   +  V          + S D T+++W
Sbjct: 501 PNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIW 560

Query: 481 DIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVN 540
            + T + ++   GH   VQ+                                    + +N
Sbjct: 561 SLDTFSVMKTLEGHTNAVQRC-----------------------------------SFIN 585

Query: 541 GQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA--DNFRIISG 598
            Q++          L+SC  D  IK+W+  SG C++T  GH   +W ++   D   I+S 
Sbjct: 586 KQKQ----------LISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSA 635

Query: 599 SHDGSIKIW 607
             DG  + W
Sbjct: 636 DADGVFQFW 644

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 105/275 (38%), Gaps = 71/275 (25%)

Query: 372 GHSDGVKTLYFDDQKL--ITGSLDKTIRVWNYITGEC----ISTYRGHTDSVMSV----- 420
           GH D + +L   +  L   T S D T  VW Y    C     + Y GH+ +V +V     
Sbjct: 386 GHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNI 445

Query: 421 --DSHKKIIVSGSADKTVKVWHVESRTC-----------YTLKGHTEWVNCVKLHPKSFS 467
               + + +++ S D T+K W +   T            YT   H + +N + + P    
Sbjct: 446 VSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSI 505

Query: 468 CYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIAS 527
             + S D T ++W++             G+++            L  H+R          
Sbjct: 506 FATASYDKTCKIWNLEN-----------GELEA----------TLANHKR---------- 534

Query: 528 NGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWD 587
                        G  ++     Y   L + + D T+K+W + +   ++T  GH   V  
Sbjct: 535 -------------GLWDV-SFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQR 580

Query: 588 IAADNFR--IISGSHDGSIKIWDLQSGKCMHTFHG 620
            +  N +  +IS   DG IKIWD  SG+C+ T  G
Sbjct: 581 CSFINKQKQLISCGADGLIKIWDCSSGECLKTLDG 615

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 85/230 (36%), Gaps = 53/230 (23%)

Query: 407 ISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVESRTC-----YTLKGHTEWVNCV 459
           +  Y GH D + S+D+ +    I + S D T  VW     +C         GH+  V  V
Sbjct: 381 VEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAV 440

Query: 460 KLHPKSFS------CYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNL- 512
            L P   S        + S+D TI+ W I                    P   +D Q + 
Sbjct: 441 GL-PNIVSKGYPEFLLTASNDLTIKKWIIPK------------------PTASMDVQIIK 481

Query: 513 VTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSG 572
           V+   +   E DI +     +D                  +   + + D T K+W + +G
Sbjct: 482 VSEYTRHAHEKDINALSVSPND------------------SIFATASYDKTCKIWNLENG 523

Query: 573 RCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWDLQSGKCMHTFHG 620
               T   H  G+WD++   +   + + S D ++KIW L +   M T  G
Sbjct: 524 ELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEG 573

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 82/175 (46%), Gaps = 12/175 (6%)

Query: 336 GVLTLQFNYRLLFTGSYDTTVAIWDLFTG--KLIRRLTGHSDGVKT---LYFDDQKLITG 390
            V T+  N ++L T   D  + I DL  G  K++ +++   +   T   L  D Q L   
Sbjct: 21  AVATVSENGKILATPVLDE-INIIDLTPGSRKILHKISNEDEQEITALKLTPDGQYLTYV 79

Query: 391 SLDKTIRVWNYITGECISTYRGHTDS-VMSVDSHKKIIVSGSADKTVKVWHVES-RTCYT 448
           S  + +++++  TG+ + + +  + S ++  DS   ++  G  D ++ V  +E+    ++
Sbjct: 80  SQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHS 139

Query: 449 LKGHTEWVNCVK----LHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
            KGH   ++ +K    L+ K +   S   +  +++WD+    CL   + H   V+
Sbjct: 140 FKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVR 194

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 47/108 (43%), Gaps = 14/108 (12%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK------LITGSLDKTIRVW 399
           LL  G  D ++ + D+  G +     GH   + +L F  Q       L +G  +  ++VW
Sbjct: 116 LLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVW 175

Query: 400 NYITGECISTYRGHTDSVMSV--------DSHKKIIVSGSADKTVKVW 439
           + +  +C+ T + HT +V  +        D     ++SG  D  + +W
Sbjct: 176 DLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLW 223

 Score = 36.6 bits (83), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 4/46 (8%)

Query: 595 IISGSHDGSIKIWDLQSGKCMHTF--HGRKLKGSDVNTSSNPDHDE 638
           + SG  +G +K+WDL   KC+HT   H   ++G D+     PD+DE
Sbjct: 163 LASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDI--IEVPDNDE 206

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 547 KKMPYPTHLLSCALDNTIKLWEVRSGRCIRT-QFGHVEGVWDIAADNFRIISGSHDGSIK 605
           K  P   +L   +    +K++ +++G+ +R+ +      + D  + +  +  G  DGSI 
Sbjct: 68  KLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVGGTDGSII 127

Query: 606 IWDLQSGKCMHTFHG 620
           + D+++G   H+F G
Sbjct: 128 VVDIENGYITHSFKG 142

>Scas_720.83d
          Length = 915

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 75/160 (46%), Gaps = 7/160 (4%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYIT 403
           L F  S    + +++  +   I +  GH D   +L +  D  +++T + D  I+VW+ ++
Sbjct: 315 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVS 374

Query: 404 GECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWH-VESRTCYTLKGHTE-WVNCV 459
           G C++T++ HT SV  V   K+  ++ S S D TV+ W  +  R   T         NC+
Sbjct: 375 GFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCL 434

Query: 460 KLHPK-SFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQV 498
            + P     C    D+  I +W ++T   L    GH G V
Sbjct: 435 AVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPV 474

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 84/185 (45%), Gaps = 21/185 (11%)

Query: 331 KGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD--QK 386
           +GH D   +L +  +   + T + D  + +WD+ +G  +     H+  V  + F    Q 
Sbjct: 340 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQEHTSSVTQVQFAKRGQV 399

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTD---SVMSVDSHKKIIVSGSADKT-VKVWHVE 442
           L + SLD T+R W+ I      T+        + ++VD   +++ +GS D   + VW V+
Sbjct: 400 LFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ 459

Query: 443 S-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
           + +   TL GH   V+C+    ++    S S D T+R+W I             G+ Q+V
Sbjct: 460 TGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSI------------FGRSQQV 507

Query: 502 IPLTI 506
            P  +
Sbjct: 508 EPFDV 512

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 63/135 (46%), Gaps = 17/135 (12%)

Query: 323 GLCTIQEFKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL 380
           G C +  F+ H   V  +QF  R  +LF+ S D TV  WDL   +  R  T      + +
Sbjct: 375 GFC-LATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTA----AERI 429

Query: 381 YFD-------DQKLITGSLDKT-IRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSG 430
            F+        + +  GSLD   I VW+  TG+ + T  GH   V  ++      ++ S 
Sbjct: 430 QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASA 489

Query: 431 SADKTVKVWHVESRT 445
           S DKTV+VW +  R+
Sbjct: 490 SWDKTVRVWSIFGRS 504

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 83/195 (42%), Gaps = 42/195 (21%)

Query: 436 VKVWHVESRTCYTLK--GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
           V  W  ES   Y LK  GH +  N +   P      + ++D  I++WD+ +  CL  F+ 
Sbjct: 327 VYEWQSES---YILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQE 383

Query: 494 H---VGQVQ-----KVIPLTIID----AQNLVTHE--RKPGEEDDIASNGTGEDDPENGV 539
           H   V QVQ     +V+  + +D    A +L+ +   R     + I  N    D      
Sbjct: 384 HTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVD------ 437

Query: 540 NGQRELDKKMPYPTHLLSCA--LDNT-IKLWEVRSGRCIRTQFGHVEGV--WDIAADNFR 594
                       P+  + CA  LDN  I +W V++G+ + T  GH   V     + +N  
Sbjct: 438 ------------PSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSV 485

Query: 595 IISGSHDGSIKIWDL 609
           + S S D ++++W +
Sbjct: 486 LASASWDKTVRVWSI 500

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 106/294 (36%), Gaps = 59/294 (20%)

Query: 371 TGHSDGVKTLY--FDDQKLITGSLDKTIRVWNYITGE---CISTYRGHTDSVM----SVD 421
            GH   + +L    D + +I+ S D T R+W+  + E      T+ GH D VM    S D
Sbjct: 143 AGHFQDILSLTWSLDSRFIISTSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAFFSAD 202

Query: 422 SHKKIIVSGSADKTVKVWHVESRTCYTL---------------------KGHTEWVN--- 457
             K  I + S D  + VW    ++                         + H  + N   
Sbjct: 203 QEK--IYTVSKDGALFVWEFTKKSTDDEDDDDEEEEEDIDISKYSWRITQKHFFYANQCK 260

Query: 458 --CVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQN--LV 513
             CV  H  S        +   R++++   T L+     +   Q  I    +++    L 
Sbjct: 261 VKCVTFHAPSNMLVVGFTNGEFRLYELPHFTLLQ----QLSMGQNPINTVAVNSSGEWLA 316

Query: 514 THERKPGE-------EDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKL 566
               K G+        +       G  D  N +          P  + +++ A D  IK+
Sbjct: 317 FGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYS-------PDGSRVVTAAEDGKIKV 369

Query: 567 WEVRSGRCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTF 618
           W+V SG C+ T   H   V  +  A     + S S DG+++ WDL   +   TF
Sbjct: 370 WDVVSGFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTF 423

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 564 IKLWEVRSGRCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTFH 619
           + ++E +S   I  Q GH +    +  + D  R+++ + DG IK+WD+ SG C+ TF 
Sbjct: 325 LLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQ 382

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 34/79 (43%), Gaps = 6/79 (7%)

Query: 410 YRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVESR----TCYTLKGHTEWVNCVKLHP 463
           + GH   ++S+      + I+S S D T ++W ++S        T  GH ++V       
Sbjct: 142 HAGHFQDILSLTWSLDSRFIISTSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAFFSA 201

Query: 464 KSFSCYSCSDDTTIRMWDI 482
                Y+ S D  + +W+ 
Sbjct: 202 DQEKIYTVSKDGALFVWEF 220

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 86/161 (53%), Gaps = 15/161 (9%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYI 402
           + + +GS D TV I  +  G+ IRRL GH+  V ++ ++++   L + S+D++I+ W+ +
Sbjct: 82  KCIASGSEDFTVEITHIIYGR-IRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVL 140

Query: 403 TGECISTYRGHTDSVMSVDSHK---KIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNC 458
           +G  + T   H+D+V+S+D  K    I+ SGS D  ++++  ES  C  TL    +W+  
Sbjct: 141 SGTALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAE 200

Query: 459 VKLHPKSFSCYS--------CSDDTTIRMWDIRTNTCLRVF 491
             + P S   +S         S D  +++W+    T +R F
Sbjct: 201 DGVVPISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTF 241

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 3/67 (4%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFR---IISGSHDGSIKIWDLQS 611
           L S ++D +IK W V SG  ++T   H + V  I    F    + SGS+DG I+I+D +S
Sbjct: 125 LCSSSMDESIKEWHVLSGTALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTES 184

Query: 612 GKCMHTF 618
           G C+ T 
Sbjct: 185 GHCLKTL 191

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 87/216 (40%), Gaps = 40/216 (18%)

Query: 425 KIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
           K I SGS D TV++ H+       L GHT  V  +  + K     S S D +I+ W + +
Sbjct: 82  KCIASGSEDFTVEITHIIYGRIRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLS 141

Query: 485 NTCLRVFRGHVGQVQKV-IP---------------LTIIDAQNLVTHERKPGEEDDIASN 528
            T L+    H   V  + IP               + I D ++    +    ++D IA +
Sbjct: 142 GTALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAED 201

Query: 529 GTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQF--------- 579
           G     P + V   R           LL  +LDN +KLWE   G  +RT           
Sbjct: 202 GVV---PISTVKFSRN-------GKFLLVKSLDNVVKLWEYTRGTVVRTFLWPHQETKAK 251

Query: 580 ----GHVEGVWDIAADNFRIISGSHDGSIKIWDLQS 611
                 +E ++    D   +ISG+  GS+ +W++ S
Sbjct: 252 LKYNCGLELIYPQGKDPL-VISGNDSGSMCVWNVYS 286

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 68/144 (47%), Gaps = 25/144 (17%)

Query: 326 TIQEFKGHMDGVLTL---QFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSD------- 375
            ++    H D V+++   +F+  +L +GSYD  + I+D  +G  ++ LT   D       
Sbjct: 144 ALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAEDGV 203

Query: 376 -GVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYR-GHTDS-----------VMSV 420
             + T+ F  + + L+  SLD  +++W Y  G  + T+   H ++           ++  
Sbjct: 204 VPISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTFLWPHQETKAKLKYNCGLELIYP 263

Query: 421 DSHKKIIVSGSADKTVKVWHVESR 444
                +++SG+   ++ VW+V S+
Sbjct: 264 QGKDPLVISGNDSGSMCVWNVYSK 287

>Scas_631.17
          Length = 474

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 79/180 (43%), Gaps = 8/180 (4%)

Query: 330 FKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQ 385
            +GH   V+ + F  + R + + S+D T  +WD+ +   ++   GH   V +L F  D  
Sbjct: 271 LQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGA 330

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWHVES 443
            L +G LD    VW+  TG+ I   +GH   + SVD       I +G  D  + +W +  
Sbjct: 331 LLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRK 390

Query: 444 RTCYT-LKGHTEWVNCVKLHPKSFSCY-SCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
            T  T L  H   V  V+    +  C  SC  D  IR++       ++   GH  ++  V
Sbjct: 391 TTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKTLEGHTDKILDV 450

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 97/241 (40%), Gaps = 55/241 (22%)

Query: 380 LYFDDQKLITGSLDKTIRVWNYITGECISTYR-GHTDSV--MSVDSHKKIIVSGSADKTV 436
           L  D+    TGS    I++ +  T + IS    GH   +  ++ +S    +VSG+ D  V
Sbjct: 194 LMSDNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLV 253

Query: 437 KVWHVES-----RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVF 491
           K+   +      +    L+GHT  V  V  HP      S S D T R+WDI + T L+  
Sbjct: 254 KIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQ 313

Query: 492 RGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPY 551
            GH  +V        +  QN                                  D  +  
Sbjct: 314 EGHGKEVYS------LSFQN----------------------------------DGAL-- 331

Query: 552 PTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDL 609
              L S  LDN   +W+VR+G+ I    GH + ++  D + D + I +G  DG I IWD+
Sbjct: 332 ---LCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDI 388

Query: 610 Q 610
           +
Sbjct: 389 R 389

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 99/254 (38%), Gaps = 56/254 (22%)

Query: 365 KLIRRLT---GHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV-- 417
           K+I+ LT   GH+  V  + F    + + + S D T R+W+  +   +    GH   V  
Sbjct: 263 KIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYS 322

Query: 418 MSVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTT 476
           +S  +   ++ SG  D    VW V + ++   L+GH + +  V   P  +   +   D  
Sbjct: 323 LSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGV 382

Query: 477 IRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPE 536
           I +WDIR  T       H                N+VT                      
Sbjct: 383 INIWDIRKTTETTRLLAH---------------NNIVT---------------------- 405

Query: 537 NGVNGQRELDKKMPYPTH-LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNF 593
            GV  Q+          H L+SC  D  I+++   +   ++T  GH + +   DI+ D  
Sbjct: 406 -GVRFQKS-------TGHCLVSCGYDKQIRIYSSDNWIQVKTLEGHTDKILDVDISEDAQ 457

Query: 594 RIISGSHDGSIKIW 607
            I+S   D S+K+W
Sbjct: 458 LIVSSGWDRSLKLW 471

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 75/162 (46%), Gaps = 8/162 (4%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           +Q  +GH   V +L F  +  LL +G  D    +WD+ TGK I  L GH+  + ++ +  
Sbjct: 310 LQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSP 369

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKI---IVSGSADKTVKVW 439
           D   + TG  D  I +W+       +    H + V  V   K     +VS   DK ++++
Sbjct: 370 DGYHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIY 429

Query: 440 HVESRT-CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
             ++     TL+GHT+ +  V +   +    S   D ++++W
Sbjct: 430 SSDNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 326 TIQEFKGHMDGVLTLQFN---YRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF 382
           +I   +GH   + ++ ++   Y +  TG  D  + IWD+       RL  H++ V  + F
Sbjct: 351 SIMNLQGHAKPIYSVDWSPDGYHIA-TGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRF 409

Query: 383 DDQK---LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVK 437
                  L++   DK IR+++      + T  GHTD ++ VD     ++IVS   D+++K
Sbjct: 410 QKSTGHCLVSCGYDKQIRIYSSDNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLK 469

Query: 438 VWHVE 442
           +W  E
Sbjct: 470 LWKQE 474

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 550 PYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIW 607
           P    + S + D T +LW++ S   ++ Q GH + V+ ++   D   + SG  D +  +W
Sbjct: 285 PSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVW 344

Query: 608 DLQSGKCMHTFHG 620
           D+++GK +    G
Sbjct: 345 DVRTGKSIMNLQG 357

>Kwal_27.11585
          Length = 823

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 66/135 (48%), Gaps = 5/135 (3%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWH 440
           +D    T S DKT ++WN  +GE   T   H   +  V    + K++ + S DKT+KVW 
Sbjct: 515 NDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWS 574

Query: 441 VESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
           +ES +   TL+GHT  V       ++    S   D  I++WD+ T  C+R    H  ++ 
Sbjct: 575 LESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIW 634

Query: 500 KVIPLTIIDAQNLVT 514
            +  L+  D +  VT
Sbjct: 635 ALSVLS--DGKEFVT 647

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/310 (22%), Positives = 121/310 (39%), Gaps = 74/310 (23%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTG----KLIRRLTGHSDGVKTL 380
           ++ ++GH D + +L    N   L T S D TV +W L       K   R TGH+  V  +
Sbjct: 393 VELYEGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAV 452

Query: 381 YFDD-------QKLITGSLDKTIRVWNYITGEC---------ISTY--RGHTDSV--MSV 420
              +       + +IT S D TI+ W+               +S Y  R H   +  +S+
Sbjct: 453 GLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSI 512

Query: 421 DSHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
             +  +  + S DKT K+W+V+S     TL  H   +  V          +CS D TI++
Sbjct: 513 SPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKV 572

Query: 480 WDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGV 539
           W + + + ++   GH   VQ+                                    + +
Sbjct: 573 WSLESMSVVKTLEGHTNAVQRC-----------------------------------SFI 597

Query: 540 NGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIIS 597
           N  ++          ++S   D  IK+W++ +G CIRT   H   +W ++  +D    ++
Sbjct: 598 NRNKQ----------IVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVT 647

Query: 598 GSHDGSIKIW 607
              DG  + W
Sbjct: 648 ADADGVFQFW 657

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 95/252 (37%), Gaps = 58/252 (23%)

Query: 407 ISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVES-----RTCYTLKGHTEWVNCV 459
           +  Y GHTD + S+DS +  + + + S D TV +W + +     +      GH   V  V
Sbjct: 393 VELYEGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAV 452

Query: 460 KLHPKSFS------CYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNL- 512
            L P            + S+D TI+ W +   T                    +D  N+ 
Sbjct: 453 GL-PNVMRNTWPEFIITASNDLTIKKWSVPKPTS-----------------NDVDMHNIK 494

Query: 513 VTHERKPGEEDDIASNGTGEDDPENGVNG-----------QRELDKKMP----------- 550
           V+   +   E DI +     +D                    EL+  +            
Sbjct: 495 VSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTF 554

Query: 551 --YPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKI 606
             Y   L +C+ D TIK+W + S   ++T  GH   V        N +I+S   DG IK+
Sbjct: 555 CQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKV 614

Query: 607 WDLQSGKCMHTF 618
           WDL +G+C+ T 
Sbjct: 615 WDLSTGECIRTL 626

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 74/190 (38%), Gaps = 19/190 (10%)

Query: 450 KGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT----CLRVFRGHVGQVQKV---- 501
           +GHT+ +N +          +CS D T+ +W +  ++        F GH G V  V    
Sbjct: 397 EGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGLPN 456

Query: 502 -----IPLTIIDAQNLVTHER----KPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYP 552
                 P  II A N +T ++    KP   D    N    D                P  
Sbjct: 457 VMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPND 516

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWDLQ 610
           +   + + D T K+W V SG    T   H  G+WD+    +   + + S D +IK+W L+
Sbjct: 517 SVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLE 576

Query: 611 SGKCMHTFHG 620
           S   + T  G
Sbjct: 577 SMSVVKTLEG 586

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 5/88 (5%)

Query: 417 VMSVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLH-PKSFSCYS-CSD 473
           VM  DS   ++  G  D +V V  +E+    ++ KGH   ++ VK H  +S S +   S 
Sbjct: 106 VMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASG 165

Query: 474 DTT--IRMWDIRTNTCLRVFRGHVGQVQ 499
           DT+  +++WD+    C+   + H   V+
Sbjct: 166 DTSGMVKVWDLVRRNCIHTIQEHAAAVR 193

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQ------KLITGSLDKTIRVW 399
           L+  G  D +V + D+  G +     GH   + ++ F  +      +L +G     ++VW
Sbjct: 115 LVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVW 174

Query: 400 NYITGECISTYRGHTDSVMSVD 421
           + +   CI T + H  +V  +D
Sbjct: 175 DLVRRNCIHTIQEHAAAVRGLD 196

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 44/106 (41%), Gaps = 18/106 (16%)

Query: 548 KMPYPTHLLSC----------ALDNTIKLWEVRSGRCIRTQFGHVEGVWDI------AAD 591
           K+  P +++ C            D ++ + ++ +G    +  GH   +  +      +  
Sbjct: 99  KVSSPVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGS 158

Query: 592 NFRIISGSHDGSIKIWDLQSGKCMHTF--HGRKLKGSDVNTSSNPD 635
            +R+ SG   G +K+WDL    C+HT   H   ++G D   S   D
Sbjct: 159 IWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGLDFRLSPADD 204

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 48/108 (44%), Gaps = 10/108 (9%)

Query: 358 IWDLFTGKLIRRLTGHSDGVKTLYFDDQKLIT--GSLDKTIRVWNYITGECISTYRGHTD 415
           I+ L + K+IR +   S  V  +  D    +   G  D ++ V +   G    +++GH  
Sbjct: 86  IYKLSSKKIIRSMKV-SSPVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGA 144

Query: 416 SVMSVDSHKKI------IVSGSADKTVKVWHVESRTC-YTLKGHTEWV 456
           ++ SV  H +       + SG     VKVW +  R C +T++ H   V
Sbjct: 145 TISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAV 192

>Scas_679.28
          Length = 815

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 65/121 (53%), Gaps = 7/121 (5%)

Query: 338 LTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKT 395
           L +  N  +  T SYD T  IWDL  G+L   L+ H  G+  + F   D+ + T S DKT
Sbjct: 497 LAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKT 556

Query: 396 IRVWNYITGECISTYRGHTDSV---MSVDSHKKIIVSGSADKTVKVWHVESRTCY-TLKG 451
           I++W+  T   + T  GHT++V   M ++   +++ SG AD  +K+W   +  C  TL G
Sbjct: 557 IKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSG-ADGLIKIWDCSTGDCLKTLDG 615

Query: 452 H 452
           H
Sbjct: 616 H 616

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 56/115 (48%), Gaps = 3/115 (2%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWH 440
           +D    T S DKT ++W+   GE  +T   H   +  V    + K+I + S DKT+K+W 
Sbjct: 502 NDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWS 561

Query: 441 VESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
           +++ +   TL+GHT  V       K     S   D  I++WD  T  CL+   GH
Sbjct: 562 LDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGH 616

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 119/311 (38%), Gaps = 75/311 (24%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLF--TGSYDTTVAIWD----LFTGKLIRRLTGHSDGVKTL 380
           ++ ++GH D + +L      L+  T S D T  +W     +   +   +  GHS  V  +
Sbjct: 379 VEMYEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAV 438

Query: 381 YFDD-------QKLITGSLDKTIRVWNY------ITGEC----ISTY--RGHTDSV--MS 419
              +       + L+T S D TI+ W        +  +C    +S Y  R H   +  ++
Sbjct: 439 GLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALA 498

Query: 420 VDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIR 478
           +  +  I  + S DKT K+W +E+     TL  H   +  V          +CS D TI+
Sbjct: 499 ISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIK 558

Query: 479 MWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENG 538
           +W + T + ++   GH   VQ+ +                                    
Sbjct: 559 IWSLDTFSVMKTLEGHTNAVQRCM-----------------------------------F 583

Query: 539 VNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA--DNFRII 596
           +N Q +          L+S   D  IK+W+  +G C++T  GH   +W +    D   I+
Sbjct: 584 INKQLQ----------LVSSGADGLIKIWDCSTGDCLKTLDGHDNRIWALTEINDGDMIV 633

Query: 597 SGSHDGSIKIW 607
           S   DG  + W
Sbjct: 634 SADADGVFQFW 644

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 105/279 (37%), Gaps = 77/279 (27%)

Query: 372 GHSDGVKTLYFDDQKL--ITGSLDKTIRVWNYITGECISTYR------GHTDSVMSVD-- 421
           GH D + +L   D  L   T S D T  VW Y     I+ ++      GH+ +V +V   
Sbjct: 384 GHEDLLNSLDTTDDGLWMATASKDHTAIVWKY--NSIINKFQPYVKFIGHSATVTAVGLP 441

Query: 422 -----SHKKIIVSGSADKTVKVWHVESRTC-------------YTLKGHTEWVNCVKLHP 463
                 + + +++ S D T+K W +   +              YT + H + +N + + P
Sbjct: 442 NVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISP 501

Query: 464 KSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEED 523
                 + S D T ++WD+             G++             L  H+R      
Sbjct: 502 NDSIFATASYDKTCKIWDLEN-----------GEL----------TATLSNHKRGLW--- 537

Query: 524 DIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVE 583
           D+A                        Y   + +C+ D TIK+W + +   ++T  GH  
Sbjct: 538 DVAF---------------------CQYDKLIATCSGDKTIKIWSLDTFSVMKTLEGHTN 576

Query: 584 GVWDIAADN--FRIISGSHDGSIKIWDLQSGKCMHTFHG 620
            V      N   +++S   DG IKIWD  +G C+ T  G
Sbjct: 577 AVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDG 615

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 88/210 (41%), Gaps = 30/210 (14%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK------LITGSLDKTIRVW 399
           L+  G  D ++ + D+  G +   L GH   +  L F  Q       L +G  +  ++VW
Sbjct: 120 LVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVW 179

Query: 400 NYITGECISTYRGHTDSVMSVDSHKK----IIVSGSADKTVKVWHVESRTCYTLKGHTEW 455
           + +  +C+ T + H+++V  +D  +      ++SG  D    +W+      + LK     
Sbjct: 180 DLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWN------FNLKKKCTL 233

Query: 456 VNCVKLHPKSFSC-----------YSCSDDTTIRMWDIRTNTCLRVFRGHVGQ--VQKVI 502
           +  + +H +  SC           Y+   D  ++   +   T ++  + H+ +  +  V+
Sbjct: 234 LKTIPVHQQVESCGFINHEHDDLIYTAGGDALLQFISLEKATMIKKTKKHIEELFIIGVL 293

Query: 503 PLTIIDAQNLVTHERKPGEEDDIASNGTGE 532
           P+   D   LV  ++   E  DI SN   E
Sbjct: 294 PILENDKMYLVMSDQTL-ELVDIKSNLLNE 322

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 80/390 (20%), Positives = 146/390 (37%), Gaps = 97/390 (24%)

Query: 330 FKGHMDGVLTLQF------NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL--- 380
            KGH   +  L+F      N  LL +G  +  V +WDL   K +  +  HS+ V+ L   
Sbjct: 144 LKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVR 203

Query: 381 -YFDDQKLITGSLDKTIRVWNY-ITGEC--ISTYRGH--TDSVMSVD-SHKKIIVSGSAD 433
              D+ +LI+G  D    +WN+ +  +C  + T   H   +S   ++  H  +I +   D
Sbjct: 204 EVGDEWQLISGGRDNVCTLWNFNLKKKCTLLKTIPVHQQVESCGFINHEHDDLIYTAGGD 263

Query: 434 KTVKVWHVESRTCY-TLKGHTEWVNCVKLHP--KSFSCYSCSDDTTIRMWDIRTN----- 485
             ++   +E  T     K H E +  + + P  ++   Y    D T+ + DI++N     
Sbjct: 264 ALLQFISLEKATMIKKTKKHIEELFIIGVLPILENDKMYLVMSDQTLELVDIKSNLLNES 323

Query: 486 -------TCLRVFRGHVGQVQ------------------KVIPLTIIDAQNL-VTHERKP 519
                  +C+    G +  ++                  ++IP+   + + L +  E   
Sbjct: 324 SDIIEIESCIAGNNGTIADMKFVGPNHDKLALATNSPTLRIIPVPSSEQEELPINVEMYE 383

Query: 520 GEEDDIASNGTGEDDPENGVNGQRE----------LDKKMP------------------- 550
           G ED + S  T +D        +            ++K  P                   
Sbjct: 384 GHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNV 443

Query: 551 ----YPTHLLSCALDNTIKLWEVRSGRCI------------RTQFGHVEGV--WDIAADN 592
               YP  LL+ + D TIK W++                   T+  H + +    I+ ++
Sbjct: 444 MLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPND 503

Query: 593 FRIISGSHDGSIKIWDLQSGKCMHTFHGRK 622
               + S+D + KIWDL++G+   T    K
Sbjct: 504 SIFATASYDKTCKIWDLENGELTATLSNHK 533

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 49/113 (43%), Gaps = 18/113 (15%)

Query: 534 DPENGVNGQRELDKKMPYPTHLLSC----------ALDNTIKLWEVRSGRCIRTQFGHVE 583
           D E    G+     KM  P +++ C            D +I + ++ +G    +  GH  
Sbjct: 90  DQEKKDQGKIIRSMKMSSPCYIMDCDSTSTLVALGGTDGSITVVDIENGFITHSLKGHGA 149

Query: 584 GVWDI-----AADNFRII-SGSHDGSIKIWDLQSGKCMHTF--HGRKLKGSDV 628
            +  +     A  N  ++ SG  +G +K+WDL   KC+HT   H   ++G DV
Sbjct: 150 TISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDV 202

>Kwal_23.6240
          Length = 913

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 88/201 (43%), Gaps = 22/201 (10%)

Query: 331 KGHMDG--VLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD--QK 386
           +GH D    +T   +   + T S D  + IWD+ +G  +     H+  V  L F    Q 
Sbjct: 338 QGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAFAKRGQV 397

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTD---SVMSVDSHKKIIVSGSADK-TVKVWHVE 442
           L + SLD T+R W+ +      T+        + ++ D   +++ +GS D   V VW V+
Sbjct: 398 LFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSVQ 457

Query: 443 S-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
           + +   TL GH   V+C+    ++    S S D TIR+W I             G+ Q+V
Sbjct: 458 TGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSI------------FGRSQQV 505

Query: 502 IPLTIIDAQNLVTHERKPGEE 522
            PL +  A  L    R  G E
Sbjct: 506 EPLEVY-ADVLSLSVRPDGNE 525

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/289 (21%), Positives = 113/289 (39%), Gaps = 60/289 (20%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYIT 403
           L F  S    + +++  +   I +  GH D    + +  D  +++T S D  I++W+ ++
Sbjct: 313 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVS 372

Query: 404 GECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWH-VESRTCYTLKGHTE-WVNCV 459
           G C+ T++ HT +V ++   K+  ++ S S D TV+ W  V  R   T         NC+
Sbjct: 373 GFCLVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCL 432

Query: 460 KLHPKS-FSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERK 518
              P     C    D   + +W ++T   +    GH G      P++ +           
Sbjct: 433 AADPSGEVVCAGSVDSFAVHVWSVQTGQLVETLDGHEG------PVSCLSFSQ------- 479

Query: 519 PGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQ 578
                            EN V               L S + D TI++W +  GR    Q
Sbjct: 480 -----------------ENSV---------------LASASWDKTIRIWSI-FGRS--QQ 504

Query: 579 FGHVEGVWDIAA-----DNFRIISGSHDGSIKIWDLQSGKCMHTFHGRK 622
              +E   D+ +     D   + + + DG I  +D+  GK ++   G+K
Sbjct: 505 VEPLEVYADVLSLSVRPDGNEVAAATLDGQILFFDVHEGKQVNAIDGKK 553

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 102/261 (39%), Gaps = 52/261 (19%)

Query: 379 TLYFDDQKLITGSLDKTIRVWNYIT-GECISTYRGHTDSVMSVDSHK--KIIVSGSADKT 435
            ++ D Q+L TG    +I+V +  T G   S    H   +  +D H     ++SG  D  
Sbjct: 179 AVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNL 238

Query: 436 VKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHV 495
           VK+W + S +   L+GH   V+ VK+HP      S S D T  +WD+     L++  GH 
Sbjct: 239 VKLWDMTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHS 298

Query: 496 GQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHL 555
             V  +                         S+G                         L
Sbjct: 299 KAVYTIA----------------------FQSDG-----------------------ALL 313

Query: 556 LSCALDNTIKLWEVRSGRCIRTQFGH---VEGVWDIAADNFRIISGSHDGSIKIWDLQSG 612
            S  LD    +W++RSG  I    GH   + GV D + + +++ +   DG++++WD+++ 
Sbjct: 314 ASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGV-DWSPNGYQLATAGADGTVRVWDIRNV 372

Query: 613 KCMHTFHGRKLKGSDVNTSSN 633
                    ++   DV    N
Sbjct: 373 GTESALLAHQVAALDVKFKKN 393

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 78/162 (48%), Gaps = 8/162 (4%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           +Q  +GH   V T+ F  +  LL +   D   AIWDL +G+ I +L GH+  +  + +  
Sbjct: 291 LQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSP 350

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK---IIVSGSADKTVKVW 439
           +  +L T   D T+RVW+       S    H  + + V   K     +VS   D+ V ++
Sbjct: 351 NGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIF 410

Query: 440 HVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
           + ++ +   +L+GHT+ V  V +     + YS   D +++ W
Sbjct: 411 NADNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 93/238 (39%), Gaps = 24/238 (10%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWH 440
           D   L++G  D  +++W+ +T       RGH   V  V  H   ++  S S D T  +W 
Sbjct: 226 DGNHLLSGGGDNLVKLWD-MTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWD 284

Query: 441 VESRTCYTLK-GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
           +E +    L+ GH++ V  +          S   D    +WD+R+   +    GH G + 
Sbjct: 285 LERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAIS 344

Query: 500 KV--------IPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPY 551
            V        +     D    V   R  G E  + ++     D          +  K   
Sbjct: 345 GVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALD----------VKFKKNN 394

Query: 552 PTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIW 607
            T L+SC  D  + ++   + + + +  GH + V+  DI  D   I SG  D S+K W
Sbjct: 395 GTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 80/184 (43%), Gaps = 8/184 (4%)

Query: 326 TIQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF- 382
           + +E +GH   V  + +  + RL  + S+D T  +WDL     ++   GHS  V T+ F 
Sbjct: 248 SFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQ 307

Query: 383 -DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVW 439
            D   L +  LD    +W+  +GE I    GH  ++  VD   +   + +  AD TV+VW
Sbjct: 308 SDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVW 367

Query: 440 HVES-RTCYTLKGHTEWVNCVKLHPKSFS-CYSCSDDTTIRMWDIRTNTCLRVFRGHVGQ 497
            + +  T   L  H      VK    + +   SC  D  + +++      L    GH  +
Sbjct: 368 DIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDR 427

Query: 498 VQKV 501
           V  V
Sbjct: 428 VFTV 431

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 66/143 (46%), Gaps = 9/143 (6%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYI 402
           R L     D TV ++   + K    L GH   V ++ F  D + LIT S DK I++W   
Sbjct: 535 RYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVD 594

Query: 403 TGECISTYRGHTDSVMSV----DSHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVN 457
            G+C  +   H DS+MSV    D+H     S   D  VK W  +   C   L GH   V 
Sbjct: 595 FGDCHKSIFAHQDSIMSVRFEADTHN--FFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVW 652

Query: 458 CVKLHPKSFSCYSCSDDTTIRMW 480
           C+ + P   +  S S D +IR+W
Sbjct: 653 CIAVSPDGRTVVSTSHDHSIRVW 675

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 63/122 (51%), Gaps = 5/122 (4%)

Query: 326 TIQEFKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD 383
            + +F GH  GV  L+ +     L +GS D+ + IWDL     + +L  H D +  ++ D
Sbjct: 107 VLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWID 166

Query: 384 DQK--LITGSLDKTIRVWNY-ITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWH 440
                LI+ + D  I+VW+    G+C+ T+  HT    S+   +++I++ S D   K+W 
Sbjct: 167 HNMDWLISVAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWE 226

Query: 441 VE 442
           ++
Sbjct: 227 LD 228

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 83/182 (45%), Gaps = 21/182 (11%)

Query: 338 LTLQFNYRLLFTGSYDTTVAIWD------LFTG---KLIRRLTGHSDGVKTLYFD----- 383
           L L  N + L TGS D +   WD      L  G   K I +L    D    L  D     
Sbjct: 470 LDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVK 529

Query: 384 ----DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH--KKIIVSGSADKTVK 437
               D+ L    LD T++V+ + + +   +  GH   V+S+D     K++++ SADK +K
Sbjct: 530 ISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIK 589

Query: 438 VWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVG 496
           +W V+   C+ ++  H + +  V+    + + +SC  D  ++ WD     C++   GH  
Sbjct: 590 IWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQS 649

Query: 497 QV 498
           +V
Sbjct: 650 EV 651

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 93/239 (38%), Gaps = 61/239 (25%)

Query: 386 KLITGSLDKTIRVWNYITGE-----------CISTYRGHTDSVMSVDSHKK--IIVSGSA 432
           KLITG+L+  I++W   T E            + T       V ++  HK+  ++  G  
Sbjct: 35  KLITGALE-NIQIWTLKTNEVEVLTDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYE 93

Query: 433 DKTVKVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVF 491
           D  +KVW + S++      GH   V  ++L  +     S S D+ + +WD+     L   
Sbjct: 94  DGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKL 153

Query: 492 RGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPY 551
           R H                                       D   G+     +D  M +
Sbjct: 154 RSH--------------------------------------KDAITGI----WIDHNMDW 171

Query: 552 PTHLLSCALDNTIKLWEVRSG-RCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDL 609
              L+S A D  IK+W++++G +C+ T   H    W +A D   II+ S D   KIW+L
Sbjct: 172 ---LISVAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWEL 227

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 131/308 (42%), Gaps = 39/308 (12%)

Query: 329 EFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK 386
           E +GH   + ++    + +LL T S +  + +W+L T K IR  +        +      
Sbjct: 378 ELQGHRTDIRSMDISDDGKLLSTAS-NGELKVWNLTTKKCIRTFSCGYALCSQMLPGGLL 436

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWHVESR 444
           ++ G+    +++++  +   +ST   HT ++ S+D  S+ K +V+GSADK+ K W  E  
Sbjct: 437 VVVGTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVV 496

Query: 445 TCYTLKGHTEWVNCVKL-HPKSFSC--------YSCSD--------DTTIRMWDIRTNTC 487
                    +++  +KL H  +            S  D        D T++++   +   
Sbjct: 497 EQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFDSLKF 556

Query: 488 LRVFRGHVGQVQKVIPLTI---IDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRE 544
                GH     K+  L+I   +D++ L+T       + +I   G    D    +   ++
Sbjct: 557 YLSLYGH-----KLPVLSIDFSVDSKMLIT----SSADKNIKIWGVDFGDCHKSIFAHQD 607

Query: 545 --LDKKMPYPTH-LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA--DNFRIISGS 599
             +  +    TH   SC  D  +K W+     CI+   GH   VW IA   D   ++S S
Sbjct: 608 SIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCIAVSPDGRTVVSTS 667

Query: 600 HDGSIKIW 607
           HD SI++W
Sbjct: 668 HDHSIRVW 675

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 68/144 (47%), Gaps = 8/144 (5%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQ--KLITGSLDKTIRVWNYI 402
            LL  G  D  + +WDL +  ++ +  GH  GV  L  D +  +L++GS D  + +W+ +
Sbjct: 86  ELLCVGYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLV 145

Query: 403 TGECISTYRGHTDSVMS--VDSHKKIIVSGSADKTVKVWHVES--RTCYTLKGHTEWVNC 458
               +   R H D++    +D +   ++S + D  +KVW +++  +   T   HT    C
Sbjct: 146 GEVGLMKLRSHKDAITGIWIDHNMDWLISVAKDGLIKVWDLKAGGQCVETHMAHTG--QC 203

Query: 459 VKLHPKSFSCYSCSDDTTIRMWDI 482
             +        + S D+  ++W++
Sbjct: 204 WSMAIDEEVIITTSMDSQAKIWEL 227

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 102/250 (40%), Gaps = 33/250 (13%)

Query: 369 RLTGHSDGVKTLYF-DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKII 427
            L GH   ++++   DD KL++ + +  ++VWN  T +CI T+         +     ++
Sbjct: 378 ELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKCIRTFSCGYALCSQMLPGGLLV 437

Query: 428 VSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
           V G+    ++++ + S T   T + HT  +  + L        + S D + + WD     
Sbjct: 438 VVGTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVVE 497

Query: 487 CLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELD 546
            L       G   K IP      Q  + H+      DDI +     +D            
Sbjct: 498 QLV-----PGTKDKYIP------QLKLVHDTTLELTDDILAVKISSED------------ 534

Query: 547 KKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSI 604
                  +L    LDNT+K++   S +   + +GH   V   D + D+  +I+ S D +I
Sbjct: 535 ------RYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNI 588

Query: 605 KIWDLQSGKC 614
           KIW +  G C
Sbjct: 589 KIWGVDFGDC 598

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 91/212 (42%), Gaps = 20/212 (9%)

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTD--SVMSVDSHKKIIVSGSADKTVKVWHVESR 444
           L  G  D  I+VW+ ++   +  + GH    +V+ +DS    +VSGS D  + +W +   
Sbjct: 88  LCVGYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGE 147

Query: 445 T-CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT-NTCLRVFRGHVGQV---- 498
                L+ H + +  + +        S + D  I++WD++    C+     H GQ     
Sbjct: 148 VGLMKLRSHKDAITGIWIDHNMDWLISVAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMA 207

Query: 499 --QKVIPLTIIDAQNLVTH---ERKPGEEDDIASNGTGE-DDPENGVNGQRELDKKMPYP 552
             ++VI  T +D+Q  +     E+  GE+  I+  GT E +  + GV+ +       P  
Sbjct: 208 IDEEVIITTSMDSQAKIWELDLEKSNGEK--ISERGTFETESKQRGVSTEF---ITAPNG 262

Query: 553 THLLSCA-LDNTIKLWEVRSGRCIRTQFGHVE 583
           T        D TI+++ +R    IR      E
Sbjct: 263 TRFFYIQNNDKTIEIFRIRPEEEIRKALNRRE 294

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 22/29 (75%)

Query: 590 ADNFRIISGSHDGSIKIWDLQSGKCMHTF 618
           +D+ +++S + +G +K+W+L + KC+ TF
Sbjct: 392 SDDGKLLSTASNGELKVWNLTTKKCIRTF 420

>Scas_658.1
          Length = 442

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 79/172 (45%), Gaps = 16/172 (9%)

Query: 332 GHMDGVLTLQF---NYRLLFTGSYDTTVAIWDLFTGK-LIRRLTGHSDGVKTLYFDDQ-- 385
           GH +G  +L F   +  LL +G  D  V +WD +  + L+R   GHS  + +L F+D   
Sbjct: 147 GHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGT 206

Query: 386 KLITGSLDKTIRVWNYITGECIST--YRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVES 443
             I+ S D TI++W+   G+  +   ++   + V     +    + G A+   K++H ++
Sbjct: 207 NFISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANS--KIYHYDT 264

Query: 444 RT------CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLR 489
           R             H   +  +K  P      S S+D T+R+WD + N  ++
Sbjct: 265 RISENDGRVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIWDNQVNVPIK 316

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 78/177 (44%), Gaps = 29/177 (16%)

Query: 327 IQEFKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKLIRRLTGHS--DGVKTLYF 382
           ++++KGH   + +L FN       + S+D T+ IWD   GK+  +L   S  + VK   F
Sbjct: 186 LRDYKGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPF 245

Query: 383 DDQKLITGSLDKTIRVWNYITGEC---ISTYRGHTDSVMSV----DSHKKIIVSGSADKT 435
           +  + I G  +  I  ++    E    +  Y  H  S++++    D  K   +S S DKT
Sbjct: 246 NSSEFIVGFANSKIYHYDTRISENDGRVQVYDHHMSSILALKFFPDGSK--FISSSEDKT 303

Query: 436 VKVW---------HVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIR 483
           V++W          +   T Y++         + +HP   +  + S D TI  + ++
Sbjct: 304 VRIWDNQVNVPIKQISDTTQYSMP-------SIDIHPDKKNFCAQSMDNTIYTYSMK 353

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 555 LLSCALDNTIKLWEVRSGR-CIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 611
           LLS   DN +K+W+    R  +R   GH + +   D   D    IS S D +IKIWD + 
Sbjct: 165 LLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQ 224

Query: 612 GKCMHTFH 619
           GK     H
Sbjct: 225 GKVKTKLH 232

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 63.2 bits (152), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 63/116 (54%), Gaps = 3/116 (2%)

Query: 330 FKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK- 386
           F GH   +  L+F+     L +GS D+ + IWDL     + +L  H D +  ++ +++  
Sbjct: 113 FNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDW 172

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVE 442
           LI+ S D  I++W+  T +C+ T+  HT     +  H  ++++ S +  +K+W+++
Sbjct: 173 LISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLD 228

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 69/141 (48%), Gaps = 6/141 (4%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWNYIT 403
           LL  G  D  + IWDL +  ++    GH   +  L FD    +LI+GS D  I +W+ + 
Sbjct: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVG 148

Query: 404 GECISTYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKL 461
              +   R H DS+  +   ++  ++S S D  +K+W ++++ C  T   HT    C  L
Sbjct: 149 EVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTS--ECWGL 206

Query: 462 HPKSFSCYSCSDDTTIRMWDI 482
              +    + S ++ I++W++
Sbjct: 207 AIHNDLVITTSTESQIKIWNL 227

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 71/191 (37%), Gaps = 47/191 (24%)

Query: 426 IIVSGSADKTVKVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
           ++  G AD  +K+W + S+T      GH   +  ++  P      S S D+ I +WD+  
Sbjct: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVG 148

Query: 485 NTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRE 544
              L   R H                                       D   G+  + E
Sbjct: 149 EVGLYKLRSH--------------------------------------KDSITGIWCENE 170

Query: 545 LDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSI 604
                     L+S + D  IK+W++++ +C+ T   H    W +A  N  +I+ S +  I
Sbjct: 171 --------DWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQI 222

Query: 605 KIWDLQSGKCM 615
           KIW+L   K M
Sbjct: 223 KIWNLDLDKDM 233

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 5/71 (7%)

Query: 550 PYPTHLLSCALDNTIKLWEVRSGRCI---RTQFGHVEGVWDIAADNFRIISGSHDGSIKI 606
           P  T L+S + D+ I +W++     +   R+    + G+W    +   +IS S DG IKI
Sbjct: 127 PTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIW--CENEDWLISTSKDGLIKI 184

Query: 607 WDLQSGKCMHT 617
           WDL++ +C+ T
Sbjct: 185 WDLKTQQCVET 195

>Kwal_26.8975
          Length = 445

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 77/332 (23%), Positives = 134/332 (40%), Gaps = 82/332 (24%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFDDQKLITGSLDKTIRVW------ 399
           + +GSYD  V  W+L +GK+ ++  GHS  V+ + Y    +L++G+ D+T+R+W      
Sbjct: 115 IVSGSYDGIVRTWNL-SGKVEKQYAGHSGAVRAVKYISSTRLVSGANDRTLRLWKTKNDE 173

Query: 400 ----------NYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVW---------- 439
                     +   G+ ++    H   V++VD     I+SGS D ++  W          
Sbjct: 174 LKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRIISGSYDNSIGFWSTNHKEMTAV 233

Query: 440 -------------------------HVESRTCYT-LKGHTEWVNCVKLHPKSFSC-YSCS 472
                                     V  R+    L+ HT  V  V       +  YS S
Sbjct: 234 DPMDALGSNVSSAAKKRRRLALKDGSVRRRSPLALLESHTAPVEEVLFDFADKTVGYSVS 293

Query: 473 DDTTIRMWDIRTNTCL--RVFRGHVGQVQKVIPLTII----DAQNLVTHERKPGEEDDIA 526
            D TI+ WD+ T  C+  +     +  + ++  L ++     A+++  H+ + G    I 
Sbjct: 294 QDHTIKTWDLVTARCVDTKSTSYSLLSLAQLPQLNLLACGSSARHITLHDPRVGSSTKIT 353

Query: 527 SNGTGEDDPENGVNGQRELDKKM---PYPTHLL-SCALDNTIKLWEVRSGRCIRTQFGHV 582
                    +  +NG +     +   P   ++L S + D T+K+W+VRS   + T     
Sbjct: 354 ---------QQQLNGHKNFVVALDTCPEMEYMLCSGSHDGTVKVWDVRSSAPMYTITREA 404

Query: 583 E-------GVWDIA-ADNFRIISGSHDGSIKI 606
           E        V+D+  A    IISG  D  I+I
Sbjct: 405 EVVKGINDKVFDVKWAKGLGIISGGQDKKIQI 436

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 85/216 (39%), Gaps = 20/216 (9%)

Query: 415 DSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDD 474
           D V ++D     IVSGS D  V+ W++  +      GH+  V  VK +  S    S ++D
Sbjct: 103 DWVSALDVGGDKIVSGSYDGIVRTWNLSGKVEKQYAGHSGAVRAVK-YISSTRLVSGAND 161

Query: 475 TTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDD 534
            T+R+W  + +            V++   L I++A       + P    D++ +      
Sbjct: 162 RTLRLWKTKNDELKNNLAAEEDDVEEGKTLAILEAH------KAPVVTVDVSGDRIISGS 215

Query: 535 PENGVNGQRELDKKMPY--PTHLLSCALDNTIK---LWEVRSGRCIR--------TQFGH 581
            +N +       K+M    P   L   + +  K      ++ G   R        +    
Sbjct: 216 YDNSIGFWSTNHKEMTAVDPMDALGSNVSSAAKKRRRLALKDGSVRRRSPLALLESHTAP 275

Query: 582 VEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHT 617
           VE V    AD     S S D +IK WDL + +C+ T
Sbjct: 276 VEEVLFDFADKTVGYSVSQDHTIKTWDLVTARCVDT 311

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 373 HSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKI-IVSGS 431
           + D V  L     K+++GS D  +R WN ++G+    Y GH+ +V +V       +VSG+
Sbjct: 101 NEDWVSALDVGGDKIVSGSYDGIVRTWN-LSGKVEKQYAGHSGAVRAVKYISSTRLVSGA 159

Query: 432 ADKTVKVW 439
            D+T+++W
Sbjct: 160 NDRTLRLW 167

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 77/160 (48%), Gaps = 7/160 (4%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYIT 403
           L F  S    + +++  +   I +  GH D   +L +  D  +++T + D  I+VW+  +
Sbjct: 313 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVAS 372

Query: 404 GECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVESRTCYTLKGHTEWVN--CV 459
           G C++T+  HT +V +V   KK  ++ S S D TV+ W +     + +   TE V   C+
Sbjct: 373 GFCLATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCL 432

Query: 460 KLHPKSFSCYSCSDDTT-IRMWDIRTNTCLRVFRGHVGQV 498
            + P      + S D+  + +W ++T   L    GH G V
Sbjct: 433 AVEPSGEVVSAGSTDSFDVFVWSVQTGQLLDTLSGHEGPV 472

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 86/187 (45%), Gaps = 23/187 (12%)

Query: 331 KGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQK 386
           +GH D   +L +  +   + T + D  + +WD+ +G  +     H+  V  + F    Q 
Sbjct: 338 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTSAVTAVQFAKKGQV 397

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSV----MSVDSHKKIIVSGSADKT-VKVWHV 441
           L + SLD T+R W+ I       +   T+ V    ++V+   +++ +GS D   V VW V
Sbjct: 398 LFSASLDGTVRAWDLIRYRNFRVFTA-TERVQFTCLAVEPSGEVVSAGSTDSFDVFVWSV 456

Query: 442 ES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQK 500
           ++ +   TL GH   V+C+    ++    S S D TIR+W I             G+ Q+
Sbjct: 457 QTGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSI------------FGRSQQ 504

Query: 501 VIPLTII 507
           V PL + 
Sbjct: 505 VEPLEVF 511

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 566 LWEVRSGRCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTFH 619
           ++E +S   I  Q GH +    +  + D  R+++ + DG IK+WD+ SG C+ TF 
Sbjct: 325 VYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFE 380

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 71/331 (21%), Positives = 119/331 (35%), Gaps = 90/331 (27%)

Query: 332 GHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFT-----------------GKLIRRLT- 371
           GH D VL   FN     ++T S D  V  W+  +                  KL  R+T 
Sbjct: 189 GHRDYVLGAYFNSTQEKIYTISKDGAVFTWEYISKAQKEGLDEEDLEDEDLSKLSWRITK 248

Query: 372 -----GHSDGVK--TLYFDDQKLITGSLDKTIRVWN---YITGECISTYRGHTDSVMSVD 421
                 +   VK  T + +   LI G  +   R++    ++  + +S  +   ++V SV+
Sbjct: 249 KNFFYANQAKVKCCTFHINSNLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVNTV-SVN 307

Query: 422 SHKKIIVSGSA---DKTVKVWHVESRTCYTLK--GHTEWVNCVKLHPKSFSCYSCSDDTT 476
           +  + +  GS+      V  W  ES   Y LK  GH +  N +   P      + ++D  
Sbjct: 308 NSGEWLAFGSSKLGQLLVYEWQSES---YILKQQGHFDATNSLTYSPDGSRVVTAAEDGK 364

Query: 477 IRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPE 536
           I++WD+ +  CL  F  H   V  V                K G+               
Sbjct: 365 IKVWDVASGFCLATFEEHTSAVTAV-------------QFAKKGQV-------------- 397

Query: 537 NGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGV----WDIAADN 592
                             L S +LD T++ W++   R  R  F   E V      +    
Sbjct: 398 ------------------LFSASLDGTVRAWDLIRYRNFRV-FTATERVQFTCLAVEPSG 438

Query: 593 FRIISGSHDG-SIKIWDLQSGKCMHTFHGRK 622
             + +GS D   + +W +Q+G+ + T  G +
Sbjct: 439 EVVSAGSTDSFDVFVWSVQTGQLLDTLSGHE 469

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 6/76 (7%)

Query: 412 GHTDSVMSVD-SH-KKIIVSGSADKTVKVWHVESR----TCYTLKGHTEWVNCVKLHPKS 465
           GH   + S   SH  + +++ S D T +VW + S        TL GH ++V     +   
Sbjct: 144 GHFQDITSFTWSHDSRFLLTTSKDLTSRVWSINSEDKELVATTLAGHRDYVLGAYFNSTQ 203

Query: 466 FSCYSCSDDTTIRMWD 481
              Y+ S D  +  W+
Sbjct: 204 EKIYTISKDGAVFTWE 219

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 113/278 (40%), Gaps = 39/278 (14%)

Query: 332 GHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LIT 389
           GH   V +L      + + S+D T  +W    G  I  L GHS  V    F  +K   +T
Sbjct: 97  GHKGNVCSLSSKNNFVISSSWDKTAKVWH--NGSAIYDLVGHSASVWDAKFLPEKDFFLT 154

Query: 390 GSLDKTIRVWNYITGECISTYRG-HTDSV--MSVDSHKKIIVSGSADKTVKVWHVESRTC 446
            S D TI++W+    + I T+ G H D +  + +    +   S S D TVK+  ++    
Sbjct: 155 ASADCTIKLWH--GNKLIKTFSGIHKDVIRHLDISPDGETFASCSNDGTVKINDMDGNIL 212

Query: 447 YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTI 506
            T  GH  +V  VK  P      SC +D ++R+W  +T        G V QV ++  ++I
Sbjct: 213 KTFTGHESFVYSVKFLPNG-DLVSCGEDRSVRVWS-KT--------GAVKQVLRLPAVSI 262

Query: 507 IDAQNLVTHERKPG-----------EEDDIASNGTGED---DPENGVNGQRELD----KK 548
            D   L   +   G           EE  IASN   E+     EN     + +D    K 
Sbjct: 263 WDLDILPNGDILVGSSDNMVRIFTVEESRIASNSKLEELQKQVENSSINSQTMDFDESKL 322

Query: 549 MPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW 586
            PY   L     +  + + +  SG     QF   +G W
Sbjct: 323 SPYEVILQPGKKEGQVAVVKAPSGAIEAHQFS--QGQW 358

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 107/252 (42%), Gaps = 33/252 (13%)

Query: 412 GHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSC 471
           GH  +V S+ S    ++S S DKT KVWH      Y L GH+  V   K  P+     + 
Sbjct: 97  GHKGNVCSLSSKNNFVISSSWDKTAKVWH-NGSAIYDLVGHSASVWDAKFLPEKDFFLTA 155

Query: 472 SDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIAS---N 528
           S D TI++W    N  ++ F G    + K          +++ H     + +  AS   +
Sbjct: 156 SADCTIKLW--HGNKLIKTFSG----IHK----------DVIRHLDISPDGETFASCSND 199

Query: 529 GTGEDDPENG-----VNGQRELDKKMPYPTH--LLSCALDNTIKLWEVRSGRCIRTQFGH 581
           GT + +  +G       G       + +  +  L+SC  D ++++W  ++G   +     
Sbjct: 200 GTVKINDMDGNILKTFTGHESFVYSVKFLPNGDLVSCGEDRSVRVWS-KTGAVKQVLRLP 258

Query: 582 VEGVWDI-AADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNP---DHD 637
              +WD+    N  I+ GS D  ++I+ ++  +        +L+    N+S N    D D
Sbjct: 259 AVSIWDLDILPNGDILVGSSDNMVRIFTVEESRIASNSKLEELQKQVENSSINSQTMDFD 318

Query: 638 ERTKSAPVACVC 649
           E +K +P   + 
Sbjct: 319 E-SKLSPYEVIL 329

>Scas_721.7
          Length = 325

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 62/129 (48%), Gaps = 16/129 (12%)

Query: 327 IQEFKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           +    GH   V++L +N    LLFT S D ++ IWD F G +++ ++ HS+ V +L    
Sbjct: 91  LHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTISAHSESVVSLSICP 150

Query: 383 --DDQKLITGSLDKTIRVWNYITGECISTYRGHTD----------SVMSVDSHKKIIVSG 430
             D   L +GS D  IR+++  TG C+ T     D          S +    + K ++  
Sbjct: 151 DRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVRFSPNGKFLLVS 210

Query: 431 SADKTVKVW 439
           S D  VK+W
Sbjct: 211 SFDGIVKIW 219

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 63/289 (21%), Positives = 115/289 (39%), Gaps = 63/289 (21%)

Query: 354 TTVAIWDLFTGKLIRRL-TGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTY 410
           T + I+DL T  +   + T H   +  + +  D+Q L + S D TI +  ++T  C+   
Sbjct: 36  TQILIYDLQTRAIHSIIPTSHVAPISEVAWSPDNQCLASASDDFTIEI-THLTHGCLHRL 94

Query: 411 RGHTDSVMSV--DSHKKIIVSGSADKTVKVWH-VESRTCYTLKGHTEWVNCVKLHPK--S 465
            GHT  V+S+  +    ++ + S D+++K+W         T+  H+E V  + + P   S
Sbjct: 95  MGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTISAHSESVVSLSICPDRDS 154

Query: 466 FSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDI 525
               S S D  IR++D RT  CL+                       +T+++    +D +
Sbjct: 155 SVLASGSFDGLIRLFDTRTGHCLKT----------------------LTYDKDWKSDDGV 192

Query: 526 ASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRT-------- 577
                    P    NG+            LL  + D  +K+W+   G  +RT        
Sbjct: 193 VPISQVRFSP----NGK-----------FLLVSSFDGIVKIWDCVRGYVVRTFKPSDGES 237

Query: 578 -QFGHVEGVWDIAADNFR--------IISGSHDGSIKIWDLQSGKCMHT 617
               H  G+  +A +           ++SG   G I  WD  + + +++
Sbjct: 238 VALKHCCGIDFLAQEGSNSEKLPTPLVVSGYETGQIYCWDSNTKELLYS 286

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 77/189 (40%), Gaps = 52/189 (27%)

Query: 436 VKVWHVESRTCYTL--KGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
           + ++ +++R  +++    H   ++ V   P +    S SDD TI +  + T+ CL    G
Sbjct: 38  ILIYDLQTRAIHSIIPTSHVAPISEVAWSPDNQCLASASDDFTIEITHL-THGCLHRLMG 96

Query: 494 HVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPT 553
           H      VI LT  D+ NL                                         
Sbjct: 97  HTA---PVISLTYNDSGNL----------------------------------------- 112

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA----DNFRIISGSHDGSIKIWDL 609
            L + ++D +IK+W+   G  ++T   H E V  ++     D+  + SGS DG I+++D 
Sbjct: 113 -LFTSSMDESIKIWDTFHGAILKTISAHSESVVSLSICPDRDSSVLASGSFDGLIRLFDT 171

Query: 610 QSGKCMHTF 618
           ++G C+ T 
Sbjct: 172 RTGHCLKTL 180

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 78/202 (38%), Gaps = 53/202 (26%)

Query: 427 IVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
           + S S D T+++ H+     + L GHT  V  +  +      ++ S D +I++WD     
Sbjct: 72  LASASDDFTIEITHLTHGCLHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGA 131

Query: 487 CLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELD 546
            L+    H    + V+ L+I            P  +  + ++G                 
Sbjct: 132 ILKTISAHS---ESVVSLSIC-----------PDRDSSVLASG----------------- 160

Query: 547 KKMPYPTHLLSCALDNTIKLWEVRSGRCIRT-----QFGHVEGVWDIAADNFR-----II 596
                       + D  I+L++ R+G C++T      +   +GV  I+   F      ++
Sbjct: 161 ------------SFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVRFSPNGKFLL 208

Query: 597 SGSHDGSIKIWDLQSGKCMHTF 618
             S DG +KIWD   G  + TF
Sbjct: 209 VSSFDGIVKIWDCVRGYVVRTF 230

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 87/179 (48%), Gaps = 20/179 (11%)

Query: 327 IQEFKGHMDGVLTLQF---NYRLLFTGSYDTTVAIWDLFTGK-LIRRLTGHSDGVKTLYF 382
           I  FKGH++G   L+F      L  +G  D  + IWD++  + L+R   GH   V+ + F
Sbjct: 171 IYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINF 230

Query: 383 --DDQKLITGSLDKTIRVWNYITGECISTYRGHT----DSVMSVDSHKKIIVSGSADKTV 436
             D  + ++ S D+T++VW+  TG+  S  + H+     +    ++++ I+  G ++  +
Sbjct: 231 NSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWHSVPNCATYHPTNNNEYIV--GLSNSEI 288

Query: 437 KVWHVESRTC------YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLR 489
           +  H +SR         T   H   +  +K  P      S S+D T+R+W+ + N  ++
Sbjct: 289 R--HYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSKFISSSEDKTVRIWENQVNIPIK 345

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 86/187 (45%), Gaps = 22/187 (11%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           +++++GH   V  + FN       + S+D T+ +WD  TGK+  RL  HS      Y   
Sbjct: 215 LRDYRGHRKAVRDINFNSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWHSVPNCATYHPT 274

Query: 383 DDQKLITGSLDKTIRVWNYITGE---CISTYRGHTDSVMSV----DSHKKIIVSGSADKT 435
           ++ + I G  +  IR ++         I TY  H  S++S+    D  K   +S S DKT
Sbjct: 275 NNNEYIVGLSNSEIRHYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSK--FISSSEDKT 332

Query: 436 VKVWHVESRTCYTLKGHTEW----VNCVKLHPKSFSCYSCSDDTTI---RMWDIRTNTCL 488
           V++W  E++    +K  ++     +  +++HP+     + S D  I    M         
Sbjct: 333 VRIW--ENQVNIPIKQISDTSQYSMPYLEIHPEQHYFSAQSMDNAIYSFSMKPKYKKNLK 390

Query: 489 RVFRGHV 495
           +VFRGH+
Sbjct: 391 KVFRGHL 397

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 44/80 (55%), Gaps = 5/80 (6%)

Query: 539 VNGQRELDKKMPYPTHL-LSCALDNTIKLWEVRSGR-CIRTQFGHVEGVWDIA--ADNFR 594
           VNG  +L K +P   HL LS   DN I +W++   R  +R   GH + V DI   +D   
Sbjct: 178 VNGTTKL-KFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINFNSDGTE 236

Query: 595 IISGSHDGSIKIWDLQSGKC 614
            +S S D ++K+WD ++GK 
Sbjct: 237 FLSVSFDQTLKVWDTETGKV 256

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 85/179 (47%), Gaps = 20/179 (11%)

Query: 327 IQEFKGHMDGVLTLQF---NYRLLFTGSYDTTVAIWDLFTG-KLIRRLTGHSDGVKTLYF 382
           I+ + GH +G   L+F      L+ +G  D T+ IWD +   + +R   GH+  +K L F
Sbjct: 155 IRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRF 214

Query: 383 --DDQKLITGSLDKTIRVWNYITGECISTYRGHTDS----VMSVDSHKKIIVSGSADKTV 436
             D Q  ++ S D+++++W+  TG+  +  R H +S    V S  ++    + G ++   
Sbjct: 215 TEDCQSFLSSSFDRSVKIWDTETGKVKT--RLHLNSTPADVESRPTNPHEFIVGLSNS-- 270

Query: 437 KVWHVESRT------CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLR 489
           K+ H + R         T   H   +  +K  P      S S+D T+R+W+ + N  ++
Sbjct: 271 KILHYDDRVSENQGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIK 329

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 43/92 (46%), Gaps = 7/92 (7%)

Query: 547 KKMPYPTHL-LSCALDNTIKLWEV-RSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDG 602
           K +P   HL LS   D+TIK+W+      C+R   GH + +       D    +S S D 
Sbjct: 169 KFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRFTEDCQSFLSSSFDR 228

Query: 603 SIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNP 634
           S+KIWD ++GK     H   L  +  +  S P
Sbjct: 229 SVKIWDTETGKVKTRLH---LNSTPADVESRP 257

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 71/153 (46%), Gaps = 6/153 (3%)

Query: 337 VLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDK 394
           V+T       + +GS D  + IW      +      H + V+ + F   DQK ++ S D 
Sbjct: 128 VMTYSHTGDWMVSGSADGELKIWQPNFNMVKVMDQAHMECVREISFSPTDQKFVSCSDDN 187

Query: 395 TIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVESRTCY-TLKG 451
            +++WN+  G+      GH   V S D H K  +IVSGS D  +K W   S +C  T+ G
Sbjct: 188 VLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFWDPRSGSCVSTMLG 247

Query: 452 HTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIR 483
               +   K  PK  +  S  S D T +++DIR
Sbjct: 248 FKHTIISTKFQPKQGNLLSVISKDKTCKVYDIR 280

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 74/201 (36%), Gaps = 48/201 (23%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWH 440
           + ++L+  + +    +W+  +    S  + H  +V  M+       +VSGSAD  +K+W 
Sbjct: 92  EGRRLVVATYNGEFSLWSGSSFNFESIMQAHDSAVTVMTYSHTGDWMVSGSADGELKIWQ 151

Query: 441 VESRTCYTL-KGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
                   + + H E V  +   P      SCSDD  +++W+       RV  GH   V+
Sbjct: 152 PNFNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHHWDVK 211

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCA 559
                                           +  P+ G+               ++S +
Sbjct: 212 SC------------------------------DWHPKMGL---------------IVSGS 226

Query: 560 LDNTIKLWEVRSGRCIRTQFG 580
            DN IK W+ RSG C+ T  G
Sbjct: 227 KDNLIKFWDPRSGSCVSTMLG 247

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 8/78 (10%)

Query: 550 PYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSI 604
           P     +SC+ DN +K+W   +G+  R   GH    WD+ + ++      I+SGS D  I
Sbjct: 175 PTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHH---WDVKSCDWHPKMGLIVSGSKDNLI 231

Query: 605 KIWDLQSGKCMHTFHGRK 622
           K WD +SG C+ T  G K
Sbjct: 232 KFWDPRSGSCVSTMLGFK 249

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 66/166 (39%), Gaps = 5/166 (3%)

Query: 333 HMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITG 390
           H+   LT     R L   +Y+   ++W   +      +  H   V  + +      +++G
Sbjct: 82  HVIPALTWTPEGRRLVVATYNGEFSLWSGSSFNFESIMQAHDSAVTVMTYSHTGDWMVSG 141

Query: 391 SLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVES-RTCY 447
           S D  +++W           + H + V  +S     +  VS S D  +K+W+  + +   
Sbjct: 142 SADGELKIWQPNFNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQER 201

Query: 448 TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
            L GH   V     HPK     S S D  I+ WD R+ +C+    G
Sbjct: 202 VLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFWDPRSGSCVSTMLG 247

>Kwal_56.23920
          Length = 937

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 347 LFTGSYDTTVAIWDL---------FTGKLIRRLTGHSDGVKTLYFD--------DQKLIT 389
           L TGS D TV  WD           T K   +L    D    L  D        D +L+ 
Sbjct: 482 LVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLA 541

Query: 390 GSL-DKTIRVWNYITGECISTYRGHTDSVMSVDSH--KKIIVSGSADKTVKVWHVESRTC 446
            SL D T++V+   + +   +  GH   V+S+D     K++++ SADK +K+W ++   C
Sbjct: 542 VSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDC 601

Query: 447 Y-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQV 498
           + +L  H + +  V   P+S + +SCS D  ++ WD     C++    H  +V
Sbjct: 602 HRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEV 654

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 61/115 (53%), Gaps = 3/115 (2%)

Query: 330 FKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK- 386
           F GH   +  L F+     L +GS D+ + +WDL     + +L  H D +  L+ + ++ 
Sbjct: 113 FNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEW 172

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHV 441
           LI+ S D  I+VW+    +C+ T+  H     S+  H+ ++++  AD  +K+W++
Sbjct: 173 LISTSKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNL 227

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/286 (22%), Positives = 112/286 (39%), Gaps = 69/286 (24%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTG-HSDGVKTLYF--DDQKLITGSLDKTIRVWNY- 401
           L+  G+    + ++DL +  L+  + G HS  + +L    D ++L+TGS DKT+  W++ 
Sbjct: 438 LVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQ 497

Query: 402 ITGECIS---------------TYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVESR 444
           +  E +                T     D V++V      +++     D TVKV+ ++S 
Sbjct: 498 VEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSM 557

Query: 445 TCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIP 503
             + +L GH   V  + +   S    + S D  I++W +    C R    H   + KV+ 
Sbjct: 558 KFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVF 617

Query: 504 LTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNT 563
                                                        +P   +  SC+ D  
Sbjct: 618 ---------------------------------------------VPESHNFFSCSKDAL 632

Query: 564 IKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIW 607
           +K W+     CI+    H + VW +A  +D   ++S SHD SI++W
Sbjct: 633 VKYWDGDKFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 71/155 (45%), Gaps = 11/155 (7%)

Query: 335 DGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL--YFDDQKLITG 390
           D VL ++   + RLL     D TV ++ + + K    L GH   V ++   FD + LIT 
Sbjct: 526 DDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITS 585

Query: 391 SLDKTIRVWNYITGECISTYRGHTDSVMSV----DSHKKIIVSGSADKTVKVWHVESRTC 446
           S DK I++W    G+C  +   H DS+M V    +SH     S S D  VK W  +   C
Sbjct: 586 SADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHN--FFSCSKDALVKYWDGDKFEC 643

Query: 447 Y-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
              L  H + V  + +        S S D +IR+W
Sbjct: 644 IQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 67/142 (47%), Gaps = 6/142 (4%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD--QKLITGSLDKTIRVWNYI 402
           RLL  G  D  + IWDL +  ++    GH   +  L FD    +LI+GS D  I VW+ +
Sbjct: 88  RLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLV 147

Query: 403 TGECISTYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWV-NCVK 460
               +   R H DS+  +    ++ ++S S D  +KVW ++ + C  ++ H   V  C  
Sbjct: 148 GEVGLYKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQC--VETHVAHVGECWS 205

Query: 461 LHPKSFSCYSCSDDTTIRMWDI 482
           +        +   D  I++W++
Sbjct: 206 MGVHEDLVITAGADNQIKLWNL 227

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 77/168 (45%), Gaps = 19/168 (11%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLT-----GHSDG-----VKTLYF----DDQKLITGSL 392
           + TG+ +  V  W + +G+LI  LT     G  D       +T Y     + + L  G  
Sbjct: 37  VLTGALEN-VNCWSMKSGELIGTLTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYN 95

Query: 393 DKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVESRT-CYTL 449
           D  I++W+ ++   + ++ GH  ++  ++ D     ++SGS D  + VW +      Y L
Sbjct: 96  DGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKL 155

Query: 450 KGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQ 497
           + H + +  +    + +   S S D  I++WD++   C+     HVG+
Sbjct: 156 RSHKDSITGLWCEGEEW-LISTSKDGLIKVWDLKVQQCVETHVAHVGE 202

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 94/223 (42%), Gaps = 22/223 (9%)

Query: 411 RGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCY 469
           RGH   V ++D S    +++ +++ T+K+W++++ +C         + C K  P      
Sbjct: 382 RGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALAC-KFLPGGALVV 440

Query: 470 SCSDDTTIRMWDIRTNTCLRVFRG-HVGQVQKVIPLTIIDAQNLVT-------------- 514
             +    + ++D+ ++T L    G H G +  +   T  D + LVT              
Sbjct: 441 LGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTT--DGKRLVTGSADKTVCFWDFQV 498

Query: 515 -HERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGR 573
             E  PG  D          D    +N      K  P    L    LDNT+K++ + S +
Sbjct: 499 EQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMK 558

Query: 574 CIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQSGKC 614
              + +GH   V   DI+ D+  +I+ S D +IKIW L  G C
Sbjct: 559 FFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDC 601

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/239 (20%), Positives = 87/239 (36%), Gaps = 62/239 (25%)

Query: 386 KLITGSLDKTIRVWNYITGECISTYR-----GHTD---------SVMSVDSHKKIIVSGS 431
           +++TG+L+  +  W+  +GE I T       G  D         S +      +++  G 
Sbjct: 36  QVLTGALE-NVNCWSMKSGELIGTLTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGY 94

Query: 432 ADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRV 490
            D  +K+W + S++   +  GH   +  +          S S D+ I +WD+     L  
Sbjct: 95  NDGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYK 154

Query: 491 FRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMP 550
            R H               ++ +T     GEE                            
Sbjct: 155 LRSH---------------KDSITGLWCEGEE---------------------------- 171

Query: 551 YPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDL 609
               L+S + D  IK+W+++  +C+ T   HV   W +      +I+   D  IK+W+L
Sbjct: 172 ---WLISTSKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNL 227

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/270 (20%), Positives = 108/270 (40%), Gaps = 32/270 (11%)

Query: 372 GHSDGVKTLYFD-DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSG 430
           GH   V+ +    D KL+  + + T+++WN  T  CI T+               ++V G
Sbjct: 383 GHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALACKFLPGGALVVLG 442

Query: 431 SADKTVKVWHVESRTCY-TLKG-HTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT---- 484
           +    + ++ + S T   T++G H+  +  + +        + S D T+  WD +     
Sbjct: 443 TKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEP 502

Query: 485 --------NTCLRVFRGHVGQVQ------KVIPLTIIDAQNLVTHERKPGEEDDIAS--N 528
                   N  L++F     ++       K+ P   + A +L+ +  K    D +    +
Sbjct: 503 VPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLS 562

Query: 529 GTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI 588
             G   P   ++     D K+     L++ + D  IK+W +  G C R+ F H + +  +
Sbjct: 563 LYGHKLPVLSID--ISFDSKL-----LITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKV 615

Query: 589 --AADNFRIISGSHDGSIKIWDLQSGKCMH 616
               ++    S S D  +K WD    +C+ 
Sbjct: 616 VFVPESHNFFSCSKDALVKYWDGDKFECIQ 645

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 32/66 (48%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKC 614
           LL+ A + T+K+W +++  CIRT                 ++ G+  G + ++DL S   
Sbjct: 399 LLATASNGTLKIWNIKTNSCIRTFECGYALACKFLPGGALVVLGTKTGDLHLYDLASSTL 458

Query: 615 MHTFHG 620
           ++T  G
Sbjct: 459 LNTIEG 464

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 57/288 (19%), Positives = 106/288 (36%), Gaps = 52/288 (18%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYI---- 402
           L + S D  + +WDL   + +     H     ++   +  +IT   D  I++WN      
Sbjct: 173 LISTSKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFEES 232

Query: 403 ---------TGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHT 453
                    T E  S  RG      +V          +AD++V+         + L+   
Sbjct: 233 AGSMLIEKGTHEKQSRQRGVAIQFTTVSDETTFFFIQNADRSVE--------TFRLRKQD 284

Query: 454 EWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT--CLRVFRGHVGQVQKVIPLTIIDAQN 511
           E    +K   K  +    S+D      +I+ N       F  H  Q+ +    +I   ++
Sbjct: 285 EIAKALKKREKRLTEKGLSED------EIQQNLKDSFTSFIMHPFQIVR----SIYKVRS 334

Query: 512 LVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRS 571
           +        + D + +      D  +    +RE    MP P  L S              
Sbjct: 335 VCWATTTTSKLDLVVTTANNTVDYYSIKYQKRE--PTMPSPPKLHSID------------ 380

Query: 572 GRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFH 619
              IR     V  + DI+ DN ++++ + +G++KIW++++  C+ TF 
Sbjct: 381 ---IRGHRSDVRAI-DISGDN-KLLATASNGTLKIWNIKTNSCIRTFE 423

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 64/163 (39%), Gaps = 52/163 (31%)

Query: 459 VKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERK 518
           ++ HP++       +D  I++WD+ + + L  F GH    +  I +   D          
Sbjct: 81  LQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGH----KSAITILTFDQ--------- 127

Query: 519 PGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRC---- 574
                      TG                     T L+S + D+ I +W++  G      
Sbjct: 128 -----------TG---------------------TRLISGSRDSDIIVWDL-VGEVGLYK 154

Query: 575 IRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHT 617
           +R+    + G+W    +   +IS S DG IK+WDL+  +C+ T
Sbjct: 155 LRSHKDSITGLWCEGEE--WLISTSKDGLIKVWDLKVQQCVET 195

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 15/83 (18%)

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQF-GHVEGVWDIAA------------DNFRIIS-GS 599
            +L+ AL+N +  W ++SG  I T   G   G  D  +               R+++ G 
Sbjct: 36  QVLTGALEN-VNCWSMKSGELIGTLTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGY 94

Query: 600 HDGSIKIWDLQSGKCMHTFHGRK 622
           +DG+IKIWDL S   + +F+G K
Sbjct: 95  NDGAIKIWDLLSKSVLISFNGHK 117

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 79/334 (23%), Positives = 135/334 (40%), Gaps = 82/334 (24%)

Query: 337 VLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFDDQKLITGSLDKT 395
            L +  ++R +++GSYD  V  W++ +GK+ ++ +GH+  VK + Y  + ++++   D++
Sbjct: 108 ALDVSDDFRHIYSGSYDGVVRTWNM-SGKVEKQYSGHTGAVKAVKYISNTRIVSAGNDRS 166

Query: 396 IRVW--------------------NYITGECISTYRGHTDSVMSVD-SHKKIIVSGSADK 434
           +R+W                    N   G+ ++   GH   V+S+D +    I+S S D 
Sbjct: 167 LRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILEGHKAPVVSLDVASNSRILSASYDN 226

Query: 435 TVKVWHVESRTCYTLKGHTEWV----NCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRV 490
           TV +W    +   T   H E +    N +    K     +  D T      IR    L +
Sbjct: 227 TVALWSTIYKEM-TAIDHLEEIQNPNNKISTAAKKRRKLTLKDGT------IRRRAPLSL 279

Query: 491 FRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQREL----- 545
              H G V++VI                     D   N  G    ++      +L     
Sbjct: 280 LESHTGPVEQVIF--------------------DHGDNTVGYSVSQDHTIKTWDLVTARC 319

Query: 546 --DKKMPYPTHLLSCALDNTIKLW----EVR-----------SGRCIRTQF-GH---VEG 584
              K   YP  LLS A   T+ L      VR           S +  + Q  GH   V G
Sbjct: 320 IDTKTTSYP--LLSIAQMPTLNLLACGSSVRHITLHDPRVSSSAKITQKQLVGHKNFVVG 377

Query: 585 VWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTF 618
           +   + + + + S SHDG++K+WD++S   M+T 
Sbjct: 378 LDTCSENEYLLCSASHDGTVKVWDVRSTSPMYTI 411

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 83/220 (37%), Gaps = 57/220 (25%)

Query: 454 EWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLT---IIDAQ 510
           +WV+ + +       YS S D  +R W++ +    + + GH G V+ V  ++   I+ A 
Sbjct: 104 DWVSALDVSDDFRHIYSGSYDGVVRTWNM-SGKVEKQYSGHTGAVKAVKYISNTRIVSAG 162

Query: 511 NLVTHER-KPGEEDDIASNGTGEDDPENGVNGQREL----DKKMPYPT-------HLLSC 558
           N  +    K   +D   SN TG+++ E  +   + L      K P  +        +LS 
Sbjct: 163 NDRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILEGHKAPVVSLDVASNSRILSA 222

Query: 559 ALDNTIKLWE---------------------------------VRSG--------RCIRT 577
           + DNT+ LW                                  ++ G          + +
Sbjct: 223 SYDNTVALWSTIYKEMTAIDHLEEIQNPNNKISTAAKKRRKLTLKDGTIRRRAPLSLLES 282

Query: 578 QFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHT 617
             G VE V     DN    S S D +IK WDL + +C+ T
Sbjct: 283 HTGPVEQVIFDHGDNTVGYSVSQDHTIKTWDLVTARCIDT 322

>Kwal_26.8953
          Length = 458

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/304 (24%), Positives = 127/304 (41%), Gaps = 61/304 (20%)

Query: 346 LLFTGSYDTTVAIWDLFTGKL-IRRLTGHSDGVKTL--YFDDQK---LITGSLDKTIRVW 399
           L+F  +    +  +DL    + +  +  H  G+ ++  + DD     + T S D   +V+
Sbjct: 142 LVFAATDSGKLLCYDLMNYTMPVASVQAHMRGITSIDVHIDDDSQCFVATASKDLHCKVF 201

Query: 400 NYITGEC--ISTYRGHTDSVMSV----DSHKKIIVSGSADKTVKVWHVESRTCYTLKG-- 451
             I  E   + T+ GH   V  +    ++   ++ S S D T K+  V +   Y LK   
Sbjct: 202 RLINSELQLVRTFSGHEHIVSHIKIWKNATDTLVASCSRDLTCKIGDVSN--GYFLKSFQ 259

Query: 452 -HTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ--KVIPLTIID 508
            H EWV  + +  +     + S+D T+R+    T   L    GH   V+  K+IP+ + +
Sbjct: 260 PHAEWVRSLDIMGEYI--ITGSNDCTVRVSHWPTGRALSFGIGHDFPVEQVKIIPMELSE 317

Query: 509 AQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWE 568
           +                       DDP+N        D      +H++SC+ DNT+++W+
Sbjct: 318 S-----------------------DDPQNNTYSAFNKDYLPLGFSHVVSCSRDNTLRIWQ 354

Query: 569 VRSGRCI----------RTQF-------GHVEGVWDIAADNFRIISGSHDGSIKIWDLQS 611
           V   R I          R  F       GH   V DI      IIS S D S+++WDL++
Sbjct: 355 VPIPRLIAHRAPQPNPARAHFTLVKTLKGHSSWVRDIRVRGNFIISCSDDRSVRVWDLET 414

Query: 612 GKCM 615
           G+ +
Sbjct: 415 GETV 418

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 83/191 (43%), Gaps = 52/191 (27%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGE 405
           L+ + S D T  I D+  G  ++    H++ V++L    + +ITGS D T+RV ++ TG 
Sbjct: 234 LVASCSRDLTCKIGDVSNGYFLKSFQPHAEWVRSLDIMGEYIITGSNDCTVRVSHWPTGR 293

Query: 406 CISTYRGHTDSVMSVD-----------------------------SHKKIIVSGSADKTV 436
            +S   GH   V  V                              SH   +VS S D T+
Sbjct: 294 ALSFGIGHDFPVEQVKIIPMELSESDDPQNNTYSAFNKDYLPLGFSH---VVSCSRDNTL 350

Query: 437 KVWHVE--------------SRTCYTL----KGHTEWVNCVKLHPKSFSCYSCSDDTTIR 478
           ++W V               +R  +TL    KGH+ WV  +++  +     SCSDD ++R
Sbjct: 351 RIWQVPIPRLIAHRAPQPNPARAHFTLVKTLKGHSSWVRDIRV--RGNFIISCSDDRSVR 408

Query: 479 MWDIRTNTCLR 489
           +WD+ T   +R
Sbjct: 409 VWDLETGETVR 419

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/264 (21%), Positives = 113/264 (42%), Gaps = 22/264 (8%)

Query: 327 IQEFKGHMDGVLTLQFNYR-----LLFTGSYDTTVAIWDLFTG--KLIRRLTGHSDGVKT 379
           +   + HM G+ ++  +        + T S D    ++ L     +L+R  +GH   V  
Sbjct: 164 VASVQAHMRGITSIDVHIDDDSQCFVATASKDLHCKVFRLINSELQLVRTFSGHEHIVSH 223

Query: 380 LYF----DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKT 435
           +       D  + + S D T ++ +   G  + +++ H + V S+D   + I++GS D T
Sbjct: 224 IKIWKNATDTLVASCSRDLTCKIGDVSNGYFLKSFQPHAEWVRSLDIMGEYIITGSNDCT 283

Query: 436 VKVWHVESRTCYTLK-GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
           V+V H  +    +   GH   V  VK+ P   S    SDD     +       L +   H
Sbjct: 284 VRVSHWPTGRALSFGIGHDFPVEQVKIIPMELSE---SDDPQNNTYSAFNKDYLPLGFSH 340

Query: 495 VGQVQKVIPLTI--IDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYP 552
           V    +   L I  +    L+ H R P + +   ++ T     +   +  R++  +  + 
Sbjct: 341 VVSCSRDNTLRIWQVPIPRLIAH-RAP-QPNPARAHFTLVKTLKGHSSWVRDIRVRGNF- 397

Query: 553 THLLSCALDNTIKLWEVRSGRCIR 576
             ++SC+ D ++++W++ +G  +R
Sbjct: 398 --IISCSDDRSVRVWDLETGETVR 419

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 56/123 (45%), Gaps = 23/123 (18%)

Query: 340 LQFNYRLLFTGSYDTTVAIWDLFTGKLI-----------------RRLTGHSDGVKTLYF 382
           L   +  + + S D T+ IW +   +LI                 + L GHS  V+ +  
Sbjct: 334 LPLGFSHVVSCSRDNTLRIWQVPIPRLIAHRAPQPNPARAHFTLVKTLKGHSSWVRDIRV 393

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYR-GHTDSVMSVDS-----HKKIIVSGSADKTV 436
               +I+ S D+++RVW+  TGE +      HT     +D+     +++++VSG AD  V
Sbjct: 394 RGNFIISCSDDRSVRVWDLETGETVREITDSHTGFANCIDTDCGGLNRQLLVSGGADGKV 453

Query: 437 KVW 439
            V+
Sbjct: 454 IVY 456

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 6/85 (7%)

Query: 321 RKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL 380
           R     ++  KGH   V  ++     + + S D +V +WDL TG+ +R +T    G    
Sbjct: 372 RAHFTLVKTLKGHSSWVRDIRVRGNFIISCSDDRSVRVWDLETGETVREITDSHTGFANC 431

Query: 381 YFDD------QKLITGSLDKTIRVW 399
              D      Q L++G  D  + V+
Sbjct: 432 IDTDCGGLNRQLLVSGGADGKVIVY 456

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 5/96 (5%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSG 612
           T + SC+ D T K+ +V +G  +++   H E V  +      II+GS+D ++++    +G
Sbjct: 233 TLVASCSRDLTCKIGDVSNGYFLKSFQPHAEWVRSLDIMGEYIITGSNDCTVRVSHWPTG 292

Query: 613 KCM-----HTFHGRKLKGSDVNTSSNPDHDERTKSA 643
           + +     H F   ++K   +  S + D    T SA
Sbjct: 293 RALSFGIGHDFPVEQVKIIPMELSESDDPQNNTYSA 328

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 15/128 (11%)

Query: 327 IQEFKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           +  F GH   V++L FN +  LLFT S D ++ IWD   G L++ ++ HS+ V ++    
Sbjct: 89  LHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPM 148

Query: 383 -DDQKLITGSLDKTIRVWNYITGECISTYRGHTD----------SVMSVDSHKKIIVSGS 431
            D   L +GS D  IR+++  TG C+ T     D          S +    + + ++  S
Sbjct: 149 NDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKS 208

Query: 432 ADKTVKVW 439
            D  VK+W
Sbjct: 209 LDGVVKIW 216

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIIS-GSHDGSIKIWDLQS 611
           L + ++D +IK+W+  +G  ++T   H E V   D+  ++  I+S GS+DG I+I+D ++
Sbjct: 111 LFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFDAET 170

Query: 612 GKCMHTF 618
           G C+ T 
Sbjct: 171 GHCLKTL 177

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 51/246 (20%), Positives = 91/246 (36%), Gaps = 57/246 (23%)

Query: 427 IVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
           I + S D +V++ H+     +T  GHT  V  +  + K    ++ S D +I++WD    +
Sbjct: 70  IATASDDFSVEIIHLSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGS 129

Query: 487 CLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELD 546
            ++    H   V  V                 P  +  I S+G                 
Sbjct: 130 LMKTISAHSEAVVSV---------------DVPMNDSSILSSG----------------- 157

Query: 547 KKMPYPTHLLSCALDNTIKLWEVRSGRCIRT-----QFGHVEGVWDIAADNFR-----II 596
                       + D  I++++  +G C++T      +    GV  I+   F      ++
Sbjct: 158 ------------SYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLL 205

Query: 597 SGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDH-DERTKSAPVACVCI--GDS 653
             S DG +KIWD   G  + TF  + L+   ++ S   D  +    S P+       GD 
Sbjct: 206 VKSLDGVVKIWDCIGGCVVRTFQVQPLEKGVLHHSCGMDFLNPEDGSTPLVISGYENGDI 265

Query: 654 ECFSGD 659
            C++ D
Sbjct: 266 YCWNSD 271

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 91/194 (46%), Gaps = 23/194 (11%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITG 404
           + T S++  + IWD+ +G  +     H+ GV  + F    Q L + SLD T++ W+ I  
Sbjct: 356 IVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRY 415

Query: 405 ECISTYRGHTDSV----MSVDSHKKIIVSGSADKT-VKVWHVES-RTCYTLKGHTEWVNC 458
               T+   T+ +    ++VD   +++ +GS D   + VW V++ +   TL GH   ++C
Sbjct: 416 RNFRTFTA-TERIQFNSLAVDPSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPISC 474

Query: 459 VKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERK 518
           +    ++    S S D TIR+W +             G+ Q+V P  +    ++++   K
Sbjct: 475 LSFSNENGVLASASWDKTIRVWSL------------FGRSQQVEPFEVF--SDVLSISMK 520

Query: 519 PGEEDDIASNGTGE 532
           P  +   AS   G+
Sbjct: 521 PDGQQIAASTLAGQ 534

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 71/312 (22%), Positives = 123/312 (39%), Gaps = 59/312 (18%)

Query: 324 LCTIQEFKGHMDGVLTLQFNYR---LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL 380
              IQ+     + V T+  N     L F  S    + +++  +   I +  GH D +  L
Sbjct: 288 FIMIQQLSMGQNAVNTVAINSSGEWLAFGSSKLGQLIVYEWQSESYILKQQGHFDTLNGL 347

Query: 381 YF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTV 436
            +  D  K++T S +  I++W+  +G C++T+  H   V +V+  KK  ++ S S D TV
Sbjct: 348 CYSPDGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQVLFSASLDGTV 407

Query: 437 KVWHVESRTCYTLKGHTEWV--NCVKLHPKS-FSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
           K W +     +     TE +  N + + P     C    D   I +W ++T   +    G
Sbjct: 408 KAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSG 467

Query: 494 HVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPT 553
           H G      P++ +   N                        ENGV              
Sbjct: 468 HEG------PISCLSFSN------------------------ENGV-------------- 483

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQ-FGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQ 610
            L S + D TI++W +  GR  + + F     V  I+   D  +I + +  G I  +D+ 
Sbjct: 484 -LASASWDKTIRVWSLF-GRSQQVEPFEVFSDVLSISMKPDGQQIAASTLAGQILFFDVA 541

Query: 611 SGKCMHTFHGRK 622
            GK +    G++
Sbjct: 542 EGKQVGNIDGKR 553

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 80/163 (49%), Gaps = 15/163 (9%)

Query: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWNYITGEC 406
           +GS D TV I  L  G+L  +L GHS  V ++ F+     L T S+D++I+ W+ ++G  
Sbjct: 72  SGSEDFTVEITHLEYGRL-HKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTL 130

Query: 407 ISTYRGHTDSVMSVDS---HKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEW------- 455
           + T   H+D V+S+D+      I+ SGS D  ++++  ES  C  TL    +W       
Sbjct: 131 LKTMSAHSDPVVSIDTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVV 190

Query: 456 -VNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQ 497
            ++ VK           S D  +++WD      +R F+   G+
Sbjct: 191 PISQVKFSRNGKFLLVRSLDGVVKLWDFIRGCVVRTFKDASGE 233

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 64/128 (50%), Gaps = 15/128 (11%)

Query: 327 IQEFKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384
           + + +GH   VL++ FN +  LL T S D ++  WD+ +G L++ ++ HSD V ++   D
Sbjct: 89  LHKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTLLKTMSAHSDPVVSIDTPD 148

Query: 385 ---QKLITGSLDKTIRVWNYITGECISTYRGHTD----------SVMSVDSHKKIIVSGS 431
                L +GS D  IR+++  +G C+ T     D          S +    + K ++  S
Sbjct: 149 CDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVVPISQVKFSRNGKFLLVRS 208

Query: 432 ADKTVKVW 439
            D  VK+W
Sbjct: 209 LDGVVKLW 216

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 98/257 (38%), Gaps = 40/257 (15%)

Query: 395 TIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVESRTCYTLKGH 452
            I V++   G C      HT+ +  +        + SGS D TV++ H+E    + L+GH
Sbjct: 36  AICVYSVGDGGCARYETTHTEPINDICWSPDSACVASGSEDFTVEITHLEYGRLHKLRGH 95

Query: 453 TEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNL 512
           +  V  V  + K     + S D +I+ WD+ + T L+    H        P+  ID  + 
Sbjct: 96  SAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTLLKTMSAHSD------PVVSIDTPDC 149

Query: 513 VTHERKPGEEDDIASNGTGED-------------DPENGVN--GQRELDKKMPYPTHLLS 557
                  G  D +      E                ++GV    Q +  +   +   LL 
Sbjct: 150 DATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVVPISQVKFSRNGKF---LLV 206

Query: 558 CALDNTIKLWEVRSGRCIRTQFGHVEG-------------VWDIAADNFRIISGSHDGSI 604
            +LD  +KLW+   G  +RT F    G               D  A +  ++ G  DG+I
Sbjct: 207 RSLDGVVKLWDFIRGCVVRT-FKDASGESRMKYSCGMDFLYPDSEAADVMVVVGGEDGNI 265

Query: 605 KIWDLQSGKCMHTFHGR 621
            +W+ QS     T  G+
Sbjct: 266 CVWNAQSKAVAQTLKGQ 282

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 81/164 (49%), Gaps = 12/164 (7%)

Query: 330 FKGHMDGVLTLQFNYR--LLFTGSYDTTVAIW--DLFTGKLIRRLTGHSDGVKTLYFD-- 383
            + H   V  +Q+++    L +G  D T+ IW  +    K++ R   H++ ++ + F   
Sbjct: 117 MQAHDSAVTVMQYSHAGDWLISGDADGTIKIWQPNFNMVKVLDR--AHTECMRDISFSYS 174

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHV 441
           DQK +T S D  +++WN+  G+      GH   V S D H K  +IVSGS D  +K+W  
Sbjct: 175 DQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLWDP 234

Query: 442 ES-RTCYTLKGHTEWVNCVKLHPKSFSCYS-CSDDTTIRMWDIR 483
            + R   T+ G    V   K  P   +  +  S D +I+++D+R
Sbjct: 235 RTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMR 278

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/237 (21%), Positives = 87/237 (36%), Gaps = 57/237 (24%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWH 440
           + ++L+  +      +WN  +    S  + H  +V  M        ++SG AD T+K+W 
Sbjct: 90  EGRRLVVATYSGEFSLWNGSSFNFESIMQAHDSAVTVMQYSHAGDWLISGDADGTIKIWQ 149

Query: 441 VESRTCYTL-KGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
                   L + HTE +  +          +CSDD  +++W+       RV  GH   V+
Sbjct: 150 PNFNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDVK 209

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCA 559
                                           +  P+ G+               ++S +
Sbjct: 210 SC------------------------------DWHPKMGL---------------IVSGS 224

Query: 560 LDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISG------SHDGSIKIWDLQ 610
            DN IKLW+ R+GR + T  G    V       F+   G      S D SIKI+D++
Sbjct: 225 KDNLIKLWDPRTGRNVSTILGLKHTV---IKTKFQPTQGNLLAVVSKDKSIKIYDMR 278

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 8/73 (10%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIWDL 609
            ++C+ DN +K+W   +G+  R   GH    WD+ + ++      I+SGS D  IK+WD 
Sbjct: 178 FVTCSDDNVLKIWNFSNGQQERVLSGHH---WDVKSCDWHPKMGLIVSGSKDNLIKLWDP 234

Query: 610 QSGKCMHTFHGRK 622
           ++G+ + T  G K
Sbjct: 235 RTGRNVSTILGLK 247

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 117/317 (36%), Gaps = 85/317 (26%)

Query: 331 KGHMDGVLTLQF-----NYRLLFTGSYDTTVAIW---DLFTGKLIRRLTGHSDGVKTLYF 382
           + HM GV +L          L+ T S D    IW   D    +L+R L+ H   V    F
Sbjct: 160 QAHMKGVTSLAVMEAENGSLLISTTSKDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCF 219

Query: 383 ----DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKV 438
                D  L T S D T++VW+  +G CI +++ H   V +++ H   +++GS D T+++
Sbjct: 220 LRSGSDLLLATCSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLELHGDYVITGSNDATIRL 279

Query: 439 WHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQV 498
            H                                       W       + V      + 
Sbjct: 280 SH---------------------------------------WPSGNGLSMAVMHEFPIER 300

Query: 499 QKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSC 558
             +IP+    AQ       K   +DD       + DP+    G +          + +SC
Sbjct: 301 VLIIPMRANTAQ-------KTEADDDQVELEYRKYDPDYSPLGFK----------YCISC 343

Query: 559 ALDNTIKLWEVRSGRCI----------RTQF-------GHVEGVWDIAADNFRIISGSHD 601
           + DN I LW++   + I          +T F       GH   V DI      + S S D
Sbjct: 344 SRDNLIVLWKIPLPKFIPHRPPQPNLLQTNFEKVHVFKGHTSWVRDIKVRGRHLFSCSDD 403

Query: 602 GSIKIWDLQSGKCMHTF 618
            SI+ WDL +G+C+  +
Sbjct: 404 RSIRCWDLVTGQCLKVW 420

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKI--WDLQSG 612
           L +C+ D T+K+W+ +SG CI++   H + V  +      +I+GS+D +I++  W   +G
Sbjct: 228 LATCSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLELHGDYVITGSNDATIRLSHWPSGNG 287

Query: 613 KCMHTFH 619
             M   H
Sbjct: 288 LSMAVMH 294

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 10/83 (12%)

Query: 367 IRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV---MSVDSH 423
           +    GH+  V+ +    + L + S D++IR W+ +TG+C+  +   +      +SVDS 
Sbjct: 377 VHVFKGHTSWVRDIKVRGRHLFSCSDDRSIRCWDLVTGQCLKVWPEASHGFINCLSVDSD 436

Query: 424 -------KKIIVSGSADKTVKVW 439
                  +++ +SGS D    V+
Sbjct: 437 VSNDKLLRELFLSGSIDGKCNVF 459

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 4/91 (4%)

Query: 316 VESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSD 375
           +++N+ K    +  FKGH   V  ++   R LF+ S D ++  WDL TG+ ++     S 
Sbjct: 370 LQTNFEK----VHVFKGHTSWVRDIKVRGRHLFSCSDDRSIRCWDLVTGQCLKVWPEASH 425

Query: 376 GVKTLYFDDQKLITGSLDKTIRVWNYITGEC 406
           G       D  +    L + + +   I G+C
Sbjct: 426 GFINCLSVDSDVSNDKLLRELFLSGSIDGKC 456

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 68/137 (49%), Gaps = 15/137 (10%)

Query: 361 LFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV 420
           LFT   I     HS  VK L    + L++GS D+ IR+++    + + T  GH  S+ ++
Sbjct: 30  LFTP--IFHFQAHSLSVKCLDISKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNL 87

Query: 421 DSHK------------KIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFS 467
              +            K ++S S D  + VW V+    + TLKGHT  +N   +HP +  
Sbjct: 88  RFSRGKDADGQDIQLNKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRV 147

Query: 468 CYSCSDDTTIRMWDIRT 484
             S S+D +IR+W++ T
Sbjct: 148 AVSVSEDHSIRLWNLMT 164

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 57/132 (43%), Gaps = 14/132 (10%)

Query: 324 LCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD 383
              I  F+ H   V  L  + R L +GS D  + I+DL   K +  L GH   +  L F 
Sbjct: 31  FTPIFHFQAHSLSVKCLDISKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFS 90

Query: 384 DQK------------LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH--KKIIVS 429
             K            L++ S D  I VW     E   T +GHT  +   D H   ++ VS
Sbjct: 91  RGKDADGQDIQLNKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRVAVS 150

Query: 430 GSADKTVKVWHV 441
            S D ++++W++
Sbjct: 151 VSEDHSIRLWNL 162

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 66/179 (36%), Gaps = 39/179 (21%)

Query: 446 CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLT 505
            +  + H+  V C+ +  +     S S+D  IR++D++    L    GH G +       
Sbjct: 34  IFHFQAHSLSVKCLDISKRYL--VSGSNDENIRIYDLQKRKELGTLLGHQGSIT------ 85

Query: 506 IIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIK 565
                NL     K  +  DI  N                          LLS + D+ I 
Sbjct: 86  -----NLRFSRGKDADGQDIQLN------------------------KWLLSASEDHKII 116

Query: 566 LWEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRK 622
           +W V+      T  GH   +  +DI   N   +S S D SI++W+L + K       RK
Sbjct: 117 VWRVKDWENFGTLKGHTARINDFDIHPSNRVAVSVSEDHSIRLWNLMTVKKAGVLKLRK 175

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 595 IISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHD 637
           ++SGS+D +I+I+DLQ  K + T  G +   +++  S   D D
Sbjct: 54  LVSGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFSRGKDAD 96

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 66/136 (48%), Gaps = 18/136 (13%)

Query: 367 IRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-SH-- 423
           I     HS  +K L    + L++GS D+ IR+++    + + T   H  S+ ++  SH  
Sbjct: 99  IFHFQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPA 158

Query: 424 --------------KKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSC 468
                          K ++S S D  + VW V+   T  TLKGHT  VN V +HP +   
Sbjct: 159 SSSEDAAVSKGSKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTNRIA 218

Query: 469 YSCSDDTTIRMWDIRT 484
            S SDD +IR+W++ T
Sbjct: 219 ISVSDDHSIRLWNLMT 234

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 63/144 (43%), Gaps = 20/144 (13%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF---- 382
           I  F+ H   +  L  + R L +GS D  + I+DL   K +  L  H   +  L F    
Sbjct: 99  IFHFQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPA 158

Query: 383 -------------DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH--KKII 427
                        + + L++ S D  I VW     E + T +GHT  V  VD H   +I 
Sbjct: 159 SSSEDAAVSKGSKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTNRIA 218

Query: 428 VSGSADKTVKVWHVES-RTCYTLK 450
           +S S D ++++W++ + R    LK
Sbjct: 219 ISVSDDHSIRLWNLMTLRNAAVLK 242

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 50/111 (45%), Gaps = 16/111 (14%)

Query: 407 ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRT-CYTLKGHTEWVNCVKL-HPK 464
           I  ++ H+ S+  +   ++ +VSGS D+ ++++ ++ R    TL  H   +  ++  HP 
Sbjct: 99  IFHFQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPA 158

Query: 465 SFS--------------CYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
           S S                S S+D  I +W ++    +   +GH  +V  V
Sbjct: 159 SSSEDAAVSKGSKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDV 209

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSG 612
           LLS + D+ I +W V+    + T  GH   V   DI   N   IS S D SI++W+L + 
Sbjct: 176 LLSASEDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTNRIAISVSDDHSIRLWNLMTL 235

Query: 613 KCMHTFHGRK 622
           +       RK
Sbjct: 236 RNAAVLKLRK 245

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 85/204 (41%), Gaps = 31/204 (15%)

Query: 327 IQEFKGHMDGVLTLQFNYR---LLFTGSYDTTVAIWDLFTGK-LIRRLTGHSDGVKTLYF 382
           I E+ GH +G  +L+F  +   LL +G  D  + +WD +  + L+R   GHS  +K L F
Sbjct: 128 IAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNF 187

Query: 383 DD--QKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWH 440
            D      + S DK +++WN        T +G  D  +  +S    I     DK   V  
Sbjct: 188 TDNGHSFASASFDKWVKIWN--------TEKGIIDKRLRFNSVPNCITFHPKDKNQLVVG 239

Query: 441 VESRTC--YTLK------------GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
           + +     Y L+             H   +  +K  P      S S+D T+R+W+ R N 
Sbjct: 240 LSNSEIRHYDLRLSENHGEVQKYDHHQGSILALKYFPDGKKLISSSEDKTVRIWENRINI 299

Query: 487 CLRVFRGHVGQVQKVIPLTIIDAQ 510
            ++      G  Q  +P   I+ Q
Sbjct: 300 PIKQIS---GTAQHSMPWIDINPQ 320

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/282 (23%), Positives = 105/282 (37%), Gaps = 55/282 (19%)

Query: 367 IRRLTGHSDGVKTLYFDDQK---LITGSLDKTIRVWN-YITGECISTYRGHTDSV--MSV 420
           I    GH +G  +L F  +    L++G  D  I++W+ Y   E + TY GH+ ++  ++ 
Sbjct: 128 IAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNF 187

Query: 421 DSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCS-DDTTIRM 479
             +     S S DK VK+W+ E              NC+  HPK  +       ++ IR 
Sbjct: 188 TDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEIRH 247

Query: 480 WDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGV 539
           +D      LR+   H G+VQK              H +                      
Sbjct: 248 YD------LRLSENH-GEVQKY------------DHHQ---------------------- 266

Query: 540 NGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFG---HVEGVWDIAADNFRII 596
            G     K  P    L+S + D T+++WE R    I+   G   H     DI        
Sbjct: 267 -GSILALKYFPDGKKLISSSEDKTVRIWENRINIPIKQISGTAQHSMPWIDINPQGQSFC 325

Query: 597 SGSHDGSIKIWDLQSGKCMH---TFHGRKLKGSDVNTSSNPD 635
           + S D +I  + +      H   TF G    G  ++ + +PD
Sbjct: 326 TQSMDNTIYTYSMLPKYKRHPNKTFKGHNTTGYGIHFAFSPD 367

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 120/280 (42%), Gaps = 23/280 (8%)

Query: 343 NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWN 400
           N   + +GS++  V+I D  T ++ + L  H   V  + +  +D  LITG  D  I V N
Sbjct: 223 NGNYVASGSWNGEVSIIDSNTLEVTQTLQNHDGKVGGIAWTSNDSVLITGGEDHLITVSN 282

Query: 401 YITGECISTYR--GHTDSVMSVDSHK--KIIVSGSADKTVKVWHVESRTCYTLK-GHTEW 455
              GE I++    GH   +  +  H   K I + S D T ++W +E +    L+ GH++ 
Sbjct: 283 RSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKE 342

Query: 456 VNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLT--IIDAQNLV 513
           + C+          +   D T  +WD+R+   +   +GH     K I      ID   L 
Sbjct: 343 LYCLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHA----KTIYCMDWSIDGHTLA 398

Query: 514 THERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPT----HLLSCALDNTIKLWEV 569
           T     G +  I      + D    +   + +   + +      +L+S   D +I ++  
Sbjct: 399 T----GGGDGVITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIFVYSK 454

Query: 570 RSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIW 607
            +   + +  GH + V  +DI  +N  +ISG  D S+K W
Sbjct: 455 DNYLKVSSLIGHADKVLTFDIDKNNKNLISGGWDRSVKHW 494

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 64/153 (41%), Gaps = 47/153 (30%)

Query: 338 LTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHS--------------------DGV 377
           L  Q +  L+ T   D T  IWDL +GK + +L GH+                    DGV
Sbjct: 346 LAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGV 405

Query: 378 KTLY----------------------FD---DQKLITGSLDKTIRVWNYITGECISTYRG 412
            T++                      FD   D  LI+   D++I V++      +S+  G
Sbjct: 406 ITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIFVYSKDNYLKVSSLIG 465

Query: 413 HTDSVMS--VDSHKKIIVSGSADKTVKVWHVES 443
           H D V++  +D + K ++SG  D++VK W   S
Sbjct: 466 HADKVLTFDIDKNNKNLISGGWDRSVKHWSTVS 498

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 550 PYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIW 607
           P    + + + D+T +LW++   + +  Q GH + ++ +A  AD   + +   D +  IW
Sbjct: 308 PSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIW 367

Query: 608 DLQSGKCMHTFHG 620
           DL+SGK +    G
Sbjct: 368 DLRSGKAVSQLQG 380

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 126/308 (40%), Gaps = 36/308 (11%)

Query: 335 DGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-DDQKLITGSLD 393
           D V  L      + +GSYD  V  W+L +GK+ ++ +GH+  V+ + F    +L++G  D
Sbjct: 104 DWVSALDVGAERIVSGSYDGVVRTWNL-SGKIEKQYSGHTGAVRAVKFISSTRLVSGGND 162

Query: 394 KTIRVW----------NYITG----ECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVW 439
           +T+R+W          + + G      ++   GH   V+SVD     I+S S D ++  W
Sbjct: 163 RTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGDRILSASYDNSIGFW 222

Query: 440 HVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
               +    +           L  K+ S        T++   +R    L +   H   V+
Sbjct: 223 STNHKDMTAVDPMDS------LGDKASSAAKKRRKLTMKDGSVRRRAPLSLLESHKAPVE 276

Query: 500 KVIPLTIIDAQNL-VTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSC 558
           +VI  +        V+ +      D + S           +    EL K       LL+C
Sbjct: 277 QVIFASNDSTVAYSVSQDHTIKTWDLVTSRCVDTKSTSYSLLSMVELPK-----LRLLAC 331

Query: 559 ALDNT-IKLWEVR---SGRCIRTQ-FGHVEGV--WDIAADN-FRIISGSHDGSIKIWDLQ 610
                 I L + R   S +  + Q  GH   V   D   +N + + S SHDG++K+WD++
Sbjct: 332 GSSARHITLHDPRADSSAKITQQQLLGHKNFVVALDTCPENEYMLCSASHDGTVKVWDIR 391

Query: 611 SGKCMHTF 618
           S   ++T 
Sbjct: 392 SSSSIYTI 399

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 86/228 (37%), Gaps = 57/228 (25%)

Query: 326 TIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWD------------------------- 360
           T+   +GH   V+++      + + SYD ++  W                          
Sbjct: 189 TLAILEGHQAPVVSVDVQGDRILSASYDNSIGFWSTNHKDMTAVDPMDSLGDKASSAAKK 248

Query: 361 -----LFTGKLIRR-----LTGHSDGVKTLYF---DDQKLITGSLDKTIRVWNYITGECI 407
                +  G + RR     L  H   V+ + F   D     + S D TI+ W+ +T  C+
Sbjct: 249 RRKLTMKDGSVRRRAPLSLLESHKAPVEQVIFASNDSTVAYSVSQDHTIKTWDLVTSRCV 308

Query: 408 STYRGHTDSVMSVDSHK-KIIVSGS-----------ADKTVKVWHVESRTCYTLKGHTEW 455
            T       +  V+  K +++  GS           AD + K+      T   L GH  +
Sbjct: 309 DTKSTSYSLLSMVELPKLRLLACGSSARHITLHDPRADSSAKI------TQQQLLGHKNF 362

Query: 456 VNCVKLHPKS-FSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVI 502
           V  +   P++ +   S S D T+++WDIR+++ +         V+K I
Sbjct: 363 VVALDTCPENEYMLCSASHDGTVKVWDIRSSSSIYTITREDQSVEKGI 410

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 3/34 (8%)

Query: 587 DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
           D+ A+  RI+SGS+DG ++ W+L SGK    + G
Sbjct: 110 DVGAE--RIVSGSYDGVVRTWNL-SGKIEKQYSG 140

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 68/131 (51%), Gaps = 15/131 (11%)

Query: 324 LCTIQEFKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLY 381
           L  +    GH   V++L +N +  LLFT S D ++ +WD+ TG +++ ++ HS+ V ++ 
Sbjct: 86  LGLLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSID 145

Query: 382 FDDQK---LITGSLDKTIRVWNYITGECIST------YRGHTDSV----MSVDSHKKIIV 428
             D     L +GS D  IR+++  TG C+ T      ++  T  V    +   ++ K ++
Sbjct: 146 LSDNDGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLL 205

Query: 429 SGSADKTVKVW 439
             S D  VK+W
Sbjct: 206 VKSYDGVVKIW 216

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA---DNFRIISGSHDGSIKIWDLQS 611
           L + ++D +IK+W+V +G  ++T   H E V  I     D   + SGSHDG I+I+D  +
Sbjct: 111 LFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDGLIRIFDTAT 170

Query: 612 GKCMHTF 618
           G C+ T 
Sbjct: 171 GHCLKTL 177

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 80/204 (39%), Gaps = 54/204 (26%)

Query: 425 KIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
           K I S S D TV V H +    + L GHT  V  +  + K    ++ S D +I++WD+ T
Sbjct: 68  KCIASCSDDFTVVVTHRQLGLLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLT 127

Query: 485 NTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRE 544
            T ++    H        P+  ID  +          +  I S+G+              
Sbjct: 128 GTVMKTMSAHSE------PVVSIDLSD---------NDGSILSSGSH------------- 159

Query: 545 LDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRT-----QFGHVEGVWDIAADNFR----- 594
                           D  I++++  +G C++T      +    GV  IA   F      
Sbjct: 160 ----------------DGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKY 203

Query: 595 IISGSHDGSIKIWDLQSGKCMHTF 618
           ++  S+DG +KIWD  SG  + TF
Sbjct: 204 LLVKSYDGVVKIWDSVSGDVVRTF 227

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 46/116 (39%), Gaps = 13/116 (11%)

Query: 343 NYRLLFTGSYDTTVAIWDLFTGKLIRRL--------TGHSDGVKTLYFDDQK---LITGS 391
           N + L   SYD  V IWD  +G ++R            H  G+  +Y    +   +++G 
Sbjct: 200 NTKYLLVKSYDGVVKIWDSVSGDVVRTFKPSNKKYNLTHCCGMDFMYPQSTQSPLILSGY 259

Query: 392 LDKTIRVWNYITGECISTYRGHT--DSVMSVDSHKKIIVSGSADKTVKVWHVESRT 445
               I  W+  T   +   +      +++S+D H  ++ S S      +W   + T
Sbjct: 260 EKGEIYCWDSNTKAELQVLKIEECDSAIISIDCHNNLMCSLSLAGNCTIWKYVTET 315

>Kwal_55.22067
          Length = 451

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (45%), Gaps = 9/172 (5%)

Query: 330 FKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQ 385
            + H   V  +++++    L +G  D T+ IW      +      H+  ++ + F   D 
Sbjct: 121 MQAHDSAVAVMKYSHAGDWLISGDSDGTIKIWQPNFNMVKVLDEAHTQCIRGISFSGTDS 180

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVES 443
           K +T S D  +++WN+  G+  ST  GH   V S D H    +I SGS D  VK+W   +
Sbjct: 181 KFVTCSDDNILKIWNFSNGQQESTLSGHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRA 240

Query: 444 RTCY-TLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIRTNTC-LRVFR 492
             C  T+ G    +   K  P   +  +  S D + R++DIR N   L V+R
Sbjct: 241 GQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIRQNMKELAVYR 292

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 59/154 (38%), Gaps = 5/154 (3%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYI 402
           R L   +Y    ++W+  T      +  H   V  + +      LI+G  D TI++W   
Sbjct: 96  RRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVAVMKYSHAGDWLISGDSDGTIKIWQPN 155

Query: 403 TGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCV 459
                     HT  +  +S        V+ S D  +K+W+  + +   TL GH   V   
Sbjct: 156 FNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQESTLSGHHWDVRSC 215

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
             HP      S S D  +++WD R   C+    G
Sbjct: 216 DWHPTMGLIASGSKDNLVKLWDPRAGQCISTILG 249

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIW 607
           +  ++C+ DN +K+W   +G+   T  GH    WD+ + ++      I SGS D  +K+W
Sbjct: 180 SKFVTCSDDNILKIWNFSNGQQESTLSGHH---WDVRSCDWHPTMGLIASGSKDNLVKLW 236

Query: 608 DLQSGKCMHTFHGRK 622
           D ++G+C+ T  G K
Sbjct: 237 DPRAGQCISTILGCK 251

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/201 (19%), Positives = 70/201 (34%), Gaps = 48/201 (23%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWH 440
           + ++L+  +      +WN  T    S  + H  +V  M        ++SG +D T+K+W 
Sbjct: 94  EGRRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVAVMKYSHAGDWLISGDSDGTIKIWQ 153

Query: 441 VESRTCYTL-KGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
                   L + HT+ +  +          +CSDD  +++W+           GH   V+
Sbjct: 154 PNFNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQESTLSGHHWDVR 213

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCA 559
                                           +  P  G+               + S +
Sbjct: 214 SC------------------------------DWHPTMGL---------------IASGS 228

Query: 560 LDNTIKLWEVRSGRCIRTQFG 580
            DN +KLW+ R+G+CI T  G
Sbjct: 229 KDNLVKLWDPRAGQCISTILG 249

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 78/156 (50%), Gaps = 11/156 (7%)

Query: 332 GHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIR-RLTGHSDGV-KTLYFDDQKLIT 389
           GH   + +L  ++  L + S+D T  +W   T  +++  L GHS  V      +D  ++T
Sbjct: 98  GHEGNICSLSGDFESLVSSSWDKTAKVW---TNGIVKWELKGHSASVWDAKLLNDGSVLT 154

Query: 390 GSLDKTIRVWNYITGECISTY-RGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVESRTC 446
            S D T+++W    G    T+ + H+D V  + +    K  VS S D T+K+ ++E    
Sbjct: 155 ASADTTVKLWK--NGTLAKTFDKLHSDVVRNICILDDGKHFVSCSNDGTLKLSNLEGGIL 212

Query: 447 YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
           +   GH  +V  VK  P S    SC +D T+R+W++
Sbjct: 213 HEFIGHESFVYAVKQLP-SGDIVSCGEDRTVRIWNM 247

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 97/220 (44%), Gaps = 25/220 (11%)

Query: 320 WRKGLCTIQEFKGHMDGVLTLQF-NYRLLFTGSYDTTVAIWDLFTGKLIRRLTG-HSDGV 377
           W  G+    E KGH   V   +  N   + T S DTTV +W    G L +     HSD V
Sbjct: 125 WTNGIVK-WELKGHSASVWDAKLLNDGSVLTASADTTVKLWK--NGTLAKTFDKLHSDVV 181

Query: 378 KTL-YFDDQK-LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK-IIVSGSADK 434
           + +   DD K  ++ S D T+++ N + G  +  + GH   V +V       IVS   D+
Sbjct: 182 RNICILDDGKHFVSCSNDGTLKLSN-LEGGILHEFIGHESFVYAVKQLPSGDIVSCGEDR 240

Query: 435 TVKVWHVES--RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFR 492
           TV++W+++   +   TL   + W   V + P        S D  IR++    N      +
Sbjct: 241 TVRIWNMDGTIKQVITLPAISIW--TVDVLPNG-DIVVGSSDKIIRIF--TENEQRLASQ 295

Query: 493 GHVGQVQKVIPLTIIDAQNLVTHE---------RKPGEED 523
             +  +QK +  + ++AQ +   E         +KPGE++
Sbjct: 296 EEITSLQKQVEESAVNAQTMGFDESKLKPSSVLQKPGEKE 335

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 126/294 (42%), Gaps = 30/294 (10%)

Query: 329 EFKGHMDGVLTL-QFNYRLLFTGSYDTTVAIWDL-FTGKLIRRLTGHSDG-VKTLYFDDQ 385
           + +GH   V ++   +   + + S D TV IW+L   G     +   S+  V +L +D +
Sbjct: 7   QLRGHTQDVRSVVSLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNSLTYDAK 66

Query: 386 K--LITGSLDKTIRVWNYITG---ECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWH 440
           +  L  G  +K I   + +     E + T  GH  ++ S+    + +VS S DKT KVW 
Sbjct: 67  QCVLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEGNICSLSGDFESLVSSSWDKTAKVW- 125

Query: 441 VESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVF-RGHVGQVQ 499
                 + LKGH+  V   KL     S  + S DTT+++W  +  T  + F + H   V+
Sbjct: 126 TNGIVKWELKGHSASVWDAKLLNDG-SVLTASADTTVKLW--KNGTLAKTFDKLHSDVVR 182

Query: 500 KVIPLTIIDAQNLVT-----HERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTH 554
            +  L   D ++ V+       +    E  I     G +     V       K++P    
Sbjct: 183 NICILD--DGKHFVSCSNDGTLKLSNLEGGILHEFIGHESFVYAV-------KQLP-SGD 232

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI-AADNFRIISGSHDGSIKIW 607
           ++SC  D T+++W +  G   +        +W +    N  I+ GS D  I+I+
Sbjct: 233 IVSCGEDRTVRIWNM-DGTIKQVITLPAISIWTVDVLPNGDIVVGSSDKIIRIF 285

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 59/273 (21%), Positives = 106/273 (38%), Gaps = 71/273 (26%)

Query: 365 KLIRRLTGHSDGVKTLY-FDDQKLITGSLDKTIRVWNYIT-----GECISTYRGHTDSVM 418
           +L  +L GH+  V+++      ++ + S D T+R+WN        G    +     +S +
Sbjct: 3   QLSAQLRGHTQDVRSVVSLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNS-L 61

Query: 419 SVDSHKKIIVSGSADKTV----KVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDD 474
           + D+ + ++  G  +K +     +  +     YTL GH    N   L     S  S S D
Sbjct: 62  TYDAKQCVLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEG--NICSLSGDFESLVSSSWD 119

Query: 475 TTIRMWDIRTNTCLR-VFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGED 533
            T ++W   TN  ++   +GH   V                                   
Sbjct: 120 KTAKVW---TNGIVKWELKGHSASV----------------------------------- 141

Query: 534 DPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFG--HVEGVWDIAA- 590
                       D K+     +L+ + D T+KLW  ++G   +T F   H + V +I   
Sbjct: 142 -----------WDAKLLNDGSVLTASADTTVKLW--KNGTLAKT-FDKLHSDVVRNICIL 187

Query: 591 -DNFRIISGSHDGSIKIWDLQSGKCMHTFHGRK 622
            D    +S S+DG++K+ +L+ G  +H F G +
Sbjct: 188 DDGKHFVSCSNDGTLKLSNLEGG-ILHEFIGHE 219

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 82/165 (49%), Gaps = 12/165 (7%)

Query: 331 KGHMDGVLTLQFNYR--LLFTGSYDTTVAIW--DLFTGKLIRRLTGHSDGVKTLYF--DD 384
           + H   V T+++++    + +G  D T+ IW  +    K + R+  H++G++ + F  +D
Sbjct: 121 QAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPNFNMVKELDRI--HTEGIRDVAFSNND 178

Query: 385 QKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVE 442
            K +T S D  +++WN+  G+      GH   V S D H +  +IVSGS D  VK+W   
Sbjct: 179 SKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHPELGLIVSGSKDNLVKLWDPR 238

Query: 443 SRTCY-TLKGHTEWVNCVKLHP-KSFSCYSCSDDTTIRMWDIRTN 485
           S  C  TL      V   +  P K     + S D + R++D+R +
Sbjct: 239 SGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRAS 283

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 93/240 (38%), Gaps = 61/240 (25%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-SHK-KIIVSGSADKTVKVWH 440
           + ++LI  +      +WN  +    +  + H  SV ++  SH    ++SG AD T+K+W 
Sbjct: 93  EGRRLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQ 152

Query: 441 VESRTCYTL-KGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
                   L + HTE +  V          +CSDD  +++W+       RV  GH   V+
Sbjct: 153 PNFNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVR 212

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCA 559
                                           +  PE G+               ++S +
Sbjct: 213 SC------------------------------DWHPELGL---------------IVSGS 227

Query: 560 LDNTIKLWEVRSGRCIRT--QFGHVEGVWDIAADNFRIISG------SHDGSIKIWDLQS 611
            DN +KLW+ RSG+C+ T  +F H      +    F+   G      S D S +++DL++
Sbjct: 228 KDNLVKLWDPRSGQCVSTLLKFKHT-----VLKTRFQPTKGNLLAAISKDKSCRVFDLRA 282

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 8/71 (11%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIW 607
           +  ++C+ DN +K+W   +G+  R   GH    WD+ + ++      I+SGS D  +K+W
Sbjct: 179 SKFVTCSDDNILKIWNFSNGQQERVLSGHH---WDVRSCDWHPELGLIVSGSKDNLVKLW 235

Query: 608 DLQSGKCMHTF 618
           D +SG+C+ T 
Sbjct: 236 DPRSGQCVSTL 246

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 64/149 (42%), Gaps = 5/149 (3%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYI 402
           R L   ++    ++W+  +      +  H   V T+ +      +I+G  D TI++W   
Sbjct: 95  RRLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPN 154

Query: 403 TGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCV 459
                   R HT+ +  ++  ++    V+ S D  +K+W+  + +    L GH   V   
Sbjct: 155 FNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSC 214

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCL 488
             HP+     S S D  +++WD R+  C+
Sbjct: 215 DWHPELGLIVSGSKDNLVKLWDPRSGQCV 243

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKIWDLQSG 612
           ++S   D TIK+W+            H EG+ D+A  N   + ++ S D  +KIW+  +G
Sbjct: 139 MISGDADGTIKIWQPNFNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNG 198

Query: 613 KCMHTFHG 620
           +      G
Sbjct: 199 QQERVLSG 206

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 82/174 (47%), Gaps = 16/174 (9%)

Query: 330 FKGHMDGVLTLQFNYR---LLFTGSYDTTVAIWDLFTGKLIRR-LTGHSDGVKTLYF--D 383
           + GH  G   L+F  +   L  +G  D  + IWD++  +L+ R   GH   +    F  D
Sbjct: 170 YDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSHD 229

Query: 384 DQKLITGSLDKTIRVWNYITGECIS--TYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHV 441
           + +  + S DKT+++W+  TG+ I+  +++   + +     +K+ ++ G +D  ++  H 
Sbjct: 230 NVQFASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQNKEQLLVGFSDSKIR--HF 287

Query: 442 ESR------TCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLR 489
           + R             H   +N ++  P      S SDD +IR+W+ + N  ++
Sbjct: 288 DLRVDKKDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIWENQINIPIK 341

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 82/185 (44%), Gaps = 20/185 (10%)

Query: 327 IQEFKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384
           ++++ GH   +    F++      + SYD TV IWD  TG +I RL+  +     + F  
Sbjct: 211 LRDYCGHRKAISATSFSHDNVQFASSSYDKTVKIWDTETGDIINRLSFKAT-PNCMTFHP 269

Query: 385 Q---KLITGSLDKTIRVWNYITGE---CISTYRGHTDSVMSV----DSHKKIIVSGSADK 434
           Q   +L+ G  D  IR ++    +    I  Y  H  ++ ++    D  K   +S S DK
Sbjct: 270 QNKEQLLVGFSDSKIRHFDLRVDKKDGVIQIYDHHLAAINALRYFPDGSK--FISSSDDK 327

Query: 435 TVKVWHVESRTCYTLKGHTEWVNC--VKLHPKSFSCYSCSDDTTIRMWDIRTNT---CLR 489
           ++++W  +          T+      ++LHP+     + S D +I ++ ++        +
Sbjct: 328 SIRIWENQINIPIKQISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPRK 387

Query: 490 VFRGH 494
            FRGH
Sbjct: 388 AFRGH 392

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQF-GHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 611
            LS   D  +K+W++   R +   + GH + +     + DN +  S S+D ++KIWD ++
Sbjct: 190 FLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSHDNVQFASSSYDKTVKIWDTET 249

Query: 612 GKCMH 616
           G  ++
Sbjct: 250 GDIIN 254

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 65/130 (50%), Gaps = 12/130 (9%)

Query: 367 IRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK-- 424
           I     HS  VK L    + L++GS D+ IR+++    + + T   H  S+ ++   K  
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVS 93

Query: 425 ---------KIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDD 474
                    K ++S S D  + VW V+    + TLKGHT  +N + +HP +    S S+D
Sbjct: 94  DQEPKSTSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSED 153

Query: 475 TTIRMWDIRT 484
            +IR+W++ T
Sbjct: 154 HSIRLWNLMT 163

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 59/128 (46%), Gaps = 13/128 (10%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF---D 383
           I  F+ H   V  L  + R L +GS D  + I+DL   K +  L  H   +  L F    
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVS 93

Query: 384 DQK--------LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH--KKIIVSGSAD 433
           DQ+        L++ S D  I VW     E   T +GHT  +  +D H   +++ S S D
Sbjct: 94  DQEPKSTSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSED 153

Query: 434 KTVKVWHV 441
            ++++W++
Sbjct: 154 HSIRLWNL 161

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 611
           LLS + DN I +W V+      T  GH   +   DI   N  + S S D SI++W+L +
Sbjct: 105 LLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRLWNLMT 163

>Scas_685.11
          Length = 384

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 68/138 (49%), Gaps = 16/138 (11%)

Query: 361 LFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV 420
           LFT   I     H+  VK L    + L++GS D+ IR+++    + + T   H  S+ ++
Sbjct: 30  LFTP--IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNL 87

Query: 421 D-------------SHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSF 466
                         S+ K ++S S D  + +W V+    + TLKGH   +N V +HP + 
Sbjct: 88  KFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNR 147

Query: 467 SCYSCSDDTTIRMWDIRT 484
              S S+D +IR+W++ T
Sbjct: 148 VAISVSEDHSIRLWNLMT 165

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 56/130 (43%), Gaps = 15/130 (11%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK 386
           I  F+ H   V  L  + R L +GS D  + I+DL   K +  L  H   +  L F   K
Sbjct: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93

Query: 387 -------------LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH--KKIIVSGS 431
                        L++ S D  I +W     E   T +GH   +  VD H   ++ +S S
Sbjct: 94  TENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153

Query: 432 ADKTVKVWHV 441
            D ++++W++
Sbjct: 154 EDHSIRLWNL 163

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 66/169 (39%), Gaps = 38/169 (22%)

Query: 447 YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTI 506
           +  + H   V C+ +  +     S S+D  IR++D++    L     H G +        
Sbjct: 35  FHFQAHALSVKCLDVSKRYL--VSGSNDEHIRIYDLQKRKELGTLLAHQGSIT------- 85

Query: 507 IDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKL 566
               NL   + K         NG GE     G N +            LLS + DN I +
Sbjct: 86  ----NLKFSKSK-------TENGDGE-----GSNNK-----------WLLSASEDNKIII 118

Query: 567 WEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGK 613
           W V+      T  GH+  +   DI   N   IS S D SI++W+L + K
Sbjct: 119 WRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167

>Scas_692.25
          Length = 488

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 82/200 (41%), Gaps = 50/200 (25%)

Query: 338 LTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIR 397
           L  + N   L + S DT++ IW    G ++     H++ V+ L      +++GS D ++R
Sbjct: 243 LFRKLNNIYLASCSRDTSIRIWTAEDGMILNSFHPHNEWVRCLDVSGDFVLSGSQDASLR 302

Query: 398 VWNYITGECISTYRGHTDSVMSV---------------------------DSHK---KII 427
           + ++ +G  +S   GH   + SV                           D  K   K  
Sbjct: 303 LTHWPSGNGLSIGIGHEFPIESVKFILPLSTNEKASPTINYLRKPLEIDSDYEKMSFKYC 362

Query: 428 VSGSADKTVKVWHVES------------------RTCYTLKGHTEWVNCVKLHPKSFSCY 469
            S S D+ +K+W + +                  +   TLKGH  WV  +++  +    +
Sbjct: 363 ASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRI--RGNYLF 420

Query: 470 SCSDDTTIRMWDIRTNTCLR 489
           SCSDD TIR W++    C++
Sbjct: 421 SCSDDKTIRCWNLENGECVK 440

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/323 (21%), Positives = 129/323 (39%), Gaps = 66/323 (20%)

Query: 336 GVLTLQFNYRLLFTGSYDTTVAIWDLFTGKL-IRRLTGHSDGVKTL-----YFDDQK--- 386
             + L     ++F G+ +  +  +D+F   L +     H  G+ ++     + ++ K   
Sbjct: 140 SAIKLHPQLPIIFIGTDNGKLYAYDIFNYSLPLDSTQAHIKGITSIDAIMEFKNNNKTEE 199

Query: 387 ----LITGSLDKTIRVWNYITGE----CISTYRGHTDSVMSVDSHKKI----IVSGSADK 434
               + T S D +I+++ +   E           H   V  V   +K+    + S S D 
Sbjct: 200 PSAIIATSSKDLSIKLFRWSAKENKFLLFRVLMNHEHIVSEVKLFRKLNNIYLASCSRDT 259

Query: 435 TVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
           ++++W  E      +   H EWV C+ +        S S D ++R+    +   L +  G
Sbjct: 260 SIRIWTAEDGMILNSFHPHNEWVRCLDVSGDF--VLSGSQDASLRLTHWPSGNGLSIGIG 317

Query: 494 H---VGQVQKVIPLTIID-AQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKM 549
           H   +  V+ ++PL+  + A   + + RKP E D          D E           KM
Sbjct: 318 HEFPIESVKFILPLSTNEKASPTINYLRKPLEIDS---------DYE-----------KM 357

Query: 550 PYPTHLLSCALDNTIKLWEVRSGR-----------------CIRTQFGHVEGVWDIAADN 592
            +  +  S + D  IK+WE+ + R                 CI T  GH   V D+    
Sbjct: 358 SF-KYCASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRIRG 416

Query: 593 FRIISGSHDGSIKIWDLQSGKCM 615
             + S S D +I+ W+L++G+C+
Sbjct: 417 NYLFSCSDDKTIRCWNLENGECV 439

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 17/87 (19%)

Query: 341 QFNYRLLFTGSYDTTVAIWDLFTGKL-----------------IRRLTGHSDGVKTLYFD 383
           + +++   + S D  + IW++ T +                  I  L GH+  VK L   
Sbjct: 356 KMSFKYCASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRIR 415

Query: 384 DQKLITGSLDKTIRVWNYITGECISTY 410
              L + S DKTIR WN   GEC+  +
Sbjct: 416 GNYLFSCSDDKTIRCWNLENGECVKQW 442

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKT 379
           I   KGH   V  L+     LF+ S D T+  W+L  G+ +++ T    G  T
Sbjct: 399 IMTLKGHASWVKDLRIRGNYLFSCSDDKTIRCWNLENGECVKQWTDLHSGFVT 451

>Kwal_55.21559
          Length = 351

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 81/174 (46%), Gaps = 25/174 (14%)

Query: 333 HMDGVLTLQF--NYRLLFTGSYDTTVAIW----------DLFTGKLIRRLTGHSDGVKTL 380
           H   V ++ F  +  +L  GS+D+T++IW          D    +L+  + GH + VK +
Sbjct: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135

Query: 381 YFDDQK--LITGSLDKTIRVWNY----ITGECISTYRGHTDSVMSVDSHKK--IIVSGSA 432
            +      L + S DK++ +W         EC+S  + H   V  V  H +  ++ S S 
Sbjct: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195

Query: 433 DKTVKVWHVES---RTCYTLKGH--TEWVNCVKLHPKSFSCYSCSDDTTIRMWD 481
           D T+++W  ++        L GH  T W +  +    S    SCSDD+T+R+W+
Sbjct: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 97/260 (37%), Gaps = 68/260 (26%)

Query: 333 HMDGVLTLQFNYRLLFTGSYDTTVAIWDL--FTGKLIRRL--TGHSDGVKTLYFDDQK-- 386
           H D + ++  +  L+ T S D  + + +L     +L+  L  + H   V+++ F      
Sbjct: 32  HTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSI 91

Query: 387 LITGSLDKTIRVW----------NYITGECISTYRGHTDSVMSVD-SHKKI-IVSGSADK 434
           L  GS D TI +W          ++   E ++   GH + V +V  SH    + S S DK
Sbjct: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151

Query: 435 TVKVWHV----ESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW--DIRTNTC 487
           +V +W      E   C + L+ H + V  V  H +     S S D TIR+W  D     C
Sbjct: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWEC 211

Query: 488 LRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDK 547
             V  GH G V                                   D E   +  R    
Sbjct: 212 AAVLNGHKGTVWC--------------------------------SDFEKSESSLR---- 235

Query: 548 KMPYPTHLLSCALDNTIKLW 567
                  L SC+ D+T+++W
Sbjct: 236 -------LASCSDDSTVRVW 248

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 91/226 (40%), Gaps = 38/226 (16%)

Query: 413 HTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLK-----GHTEWVNCVKLHPKSFS 467
           HTD + S+D  K ++ + S+D+ +K+ ++++     ++      H + V  V   P S  
Sbjct: 32  HTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSI 91

Query: 468 CYSCSDDTTIRMW----------DIRTNTCLRVFRGHVGQVQKV--------IPLTIIDA 509
             + S D+TI +W          D      L +  GH  +V+ V        +     D 
Sbjct: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151

Query: 510 QNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLL-SCALDNTIKLW- 567
              +    + GEE +  S           V    E+        HLL S + D+TI+LW 
Sbjct: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEM--------HLLASSSYDDTIRLWK 203

Query: 568 -EVRSGRCIRTQFGHVEGVW----DIAADNFRIISGSHDGSIKIWD 608
            +     C     GH   VW    + +  + R+ S S D ++++W+
Sbjct: 204 EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 6/66 (9%)

Query: 346 LLFTGSYDTTVAIW--DLFTGKLIRRLTGHSDGVKTLYFDDQ----KLITGSLDKTIRVW 399
           LL + SYD T+ +W  D    +    L GH   V    F+      +L + S D T+RVW
Sbjct: 189 LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248

Query: 400 NYITGE 405
           NY+  E
Sbjct: 249 NYVEEE 254

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 78/187 (41%), Gaps = 19/187 (10%)

Query: 345 RLLFTGSYDTTVAIW-----------DLF---TGKLIRRLTGHSDGVKTLYFDDQKLITG 390
             + T S D T+  W           DL    T +  RR         ++  +D    T 
Sbjct: 454 EFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDSLFATA 513

Query: 391 SLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWHVESRTCY- 447
           S DKT ++WN   GE  +T   H   +  V    + K++ + S DKT+K+W +ES     
Sbjct: 514 SYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVK 573

Query: 448 TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTII 507
           TL+GHT  V       K+    S   D  + +WD+ T   ++    H  ++  +  +   
Sbjct: 574 TLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMN-- 631

Query: 508 DAQNLVT 514
           D ++ VT
Sbjct: 632 DGESFVT 638

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (45%), Gaps = 5/148 (3%)

Query: 338 LTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKT 395
           +++  N  L  T SYD T  IW+L  G+    L  H  G+  + F   D+ L T S DKT
Sbjct: 501 ISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKT 560

Query: 396 IRVWNYITGECISTYRGHTDSVM--SVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGH 452
           I++W+  +   + T  GHT++V   S  +  K ++S  AD  V +W + +  +  TL  H
Sbjct: 561 IKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAH 620

Query: 453 TEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
              +  + +     S  +   D     W
Sbjct: 621 NNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 105/280 (37%), Gaps = 73/280 (26%)

Query: 367 IRRLTGHSDGVKTL--YFDDQKLITGSLDKTIRVWNYITGE----CISTYRGHTDSVMSV 420
           ++   GH+D + +L    D   + T S D ++ +W Y          + + GH  SV +V
Sbjct: 383 VKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAV 442

Query: 421 D-------SHKKIIVSGSADKTVKVWHVESRTC-------------YTLKGHTEWVNCVK 460
                   S  + I++ S D T+K W V   T              YT + H + +N + 
Sbjct: 443 GLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAIS 502

Query: 461 LHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPG 520
           + P      + S D T ++W++             G+ Q            L  H+R   
Sbjct: 503 ISPNDSLFATASYDKTCKIWNLDD-----------GEFQA----------TLANHKRGLW 541

Query: 521 EEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFG 580
              D+A                        Y   L +C+ D TIK+W + S   ++T  G
Sbjct: 542 ---DVAF---------------------CQYDKLLATCSGDKTIKIWSLESYAVVKTLEG 577

Query: 581 HVEGVW--DIAADNFRIISGSHDGSIKIWDLQSGKCMHTF 618
           H   V        N ++IS   DG + IWDL +G+ + T 
Sbjct: 578 HTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTL 617

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 92/232 (39%), Gaps = 55/232 (23%)

Query: 407 ISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVW--HVESRTCYT---LKGHTEWVNCV 459
           +  Y GHTD + S+D+      + + S D +V +W  H +    Y      GH   VN V
Sbjct: 383 VKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAV 442

Query: 460 KL---HPKSFSCY--SCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLV- 513
            L    P+S+  +  + S+D TI+ W                   KV  +T  + ++L+ 
Sbjct: 443 GLPNVMPRSWPEFIITASNDLTIKKW-------------------KVPKVTSDEPEDLIL 483

Query: 514 ---THERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVR 570
              +   +   E DI +     +D                  +   + + D T K+W + 
Sbjct: 484 VKTSEYTRRAHEKDINAISISPND------------------SLFATASYDKTCKIWNLD 525

Query: 571 SGRCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWDLQSGKCMHTFHG 620
            G    T   H  G+WD+A   +   + + S D +IKIW L+S   + T  G
Sbjct: 526 DGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEG 577

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 62/330 (18%), Positives = 116/330 (35%), Gaps = 81/330 (24%)

Query: 311 RERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLF--TGSYDTTVAIW-------DL 361
            E F+   N       ++ ++GH D + +L      L+  T S D +V +W       D 
Sbjct: 367 EEEFENGENKETFPIEVKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDF 426

Query: 362 FTGKLIRRLTGHSDGVKTLYFDD-------QKLITGSLDKTIRVWNY------------I 402
           +      +  GH   V  +   +       + +IT S D TI+ W              +
Sbjct: 427 YP---YTKFVGHVGSVNAVGLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLIL 483

Query: 403 TGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVE-SRTCYTLKGHTEWVNCV 459
                 T R H   +  +S+  +  +  + S DKT K+W+++      TL  H   +  V
Sbjct: 484 VKTSEYTRRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDV 543

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKP 519
                     +CS D TI++W + +   ++   GH   VQ+                   
Sbjct: 544 AFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRC------------------ 585

Query: 520 GEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQF 579
                            + +N  ++          L+S   D  + +W++ +G  ++T  
Sbjct: 586 -----------------SFINKNKQ----------LISTGADGLVIIWDLSTGESVKTLD 618

Query: 580 GHVEGVWDIAA--DNFRIISGSHDGSIKIW 607
            H   +W +A   D    ++   DG  + W
Sbjct: 619 AHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 51/117 (43%), Gaps = 13/117 (11%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQ------KLITGSLDKTIRVW 399
           LL  G  D +V++ D+  G +   L GH   + ++ F  +      KL +G  +  I+VW
Sbjct: 115 LLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVW 174

Query: 400 NYITGECISTYRGHTDSVMSVDSHKK-------IIVSGSADKTVKVWHVESRTCYTL 449
           + +   C  T + HT +V  +D            ++SG  D  + ++   S   Y L
Sbjct: 175 DLVKRNCQCTIQEHTTAVRGLDFRVTDEEKGTLQLLSGGRDNILNLFEFNSTKKYKL 231

 Score = 32.7 bits (73), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 5/88 (5%)

Query: 417 VMSVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLH----PKSFSCYSC 471
           VM+ D    ++  G  D +V V  +E+    ++LKGH   ++ VK H     + +   S 
Sbjct: 106 VMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASG 165

Query: 472 SDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
             +  I++WD+    C    + H   V+
Sbjct: 166 DTNGMIKVWDLVKRNCQCTIQEHTTAVR 193

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 45/98 (45%), Gaps = 18/98 (18%)

Query: 548 KMPYPTHLLSC----------ALDNTIKLWEVRSGRCIRTQFGH------VEGVWDIAAD 591
           K+  P ++++C            D ++ + ++ +G    +  GH      V+   ++ ++
Sbjct: 99  KISSPVYVMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSE 158

Query: 592 NFRIISGSHDGSIKIWDLQSGKCMHTF--HGRKLKGSD 627
            +++ SG  +G IK+WDL    C  T   H   ++G D
Sbjct: 159 IWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLD 196

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 103/251 (41%), Gaps = 48/251 (19%)

Query: 365 KLIRRLTGHSDGVKTL-YFDDQKLI-TGSLDKTIRVWNYITGECISTYRGHTDSVMSVDS 422
           +L+  L GH   +  + Y    K I + S D T R+W+  T + +    GH   V S+  
Sbjct: 256 RLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSF 315

Query: 423 H--KKIIVSGSADKTVKVWHVESRT-CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
                ++ SG  D    +W + S +   TL GH++ +  V   P  +   +   D  I +
Sbjct: 316 QCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINV 375

Query: 480 WDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGV 539
           WDIR         G + Q        I+  +N+VT  R   E+                 
Sbjct: 376 WDIRKRD-----EGQLNQ--------ILAHRNIVTQVRFSKED----------------- 405

Query: 540 NGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGV--WDIAADNFRIIS 597
            G++           L+SC  DN I ++   +   + +  GH + +   DI+ ++  ++S
Sbjct: 406 GGKK-----------LVSCGYDNLINVYSSDTWLKMGSLAGHTDKIISLDISNNSHFLVS 454

Query: 598 GSHDGSIKIWD 608
           G  D SIK+W+
Sbjct: 455 GGWDRSIKLWN 465

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 82/200 (41%), Gaps = 14/200 (7%)

Query: 318 SNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGS--YDTTVAIWDLFTGKLIRRLTGHSD 375
           SN   GL  + +  GH   +  ++++    F GS  +D T  +WD  T + +    GH  
Sbjct: 249 SNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDK 308

Query: 376 GVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGS 431
           GV +L F  D   + +G +D    +W+  +G  + T  GH+  + +V    +   + +G 
Sbjct: 309 GVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGG 368

Query: 432 ADKTVKVWHVESRTCYTLK---GHTEWVNCVKLHPKSFS--CYSCSDDTTIRMWDIRTNT 486
            D  + VW +  R    L     H   V  V+   +       SC  D  I ++   T  
Sbjct: 369 GDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSSDTWL 428

Query: 487 CLRVFRGHVGQVQKVIPLTI 506
            +    GH     K+I L I
Sbjct: 429 KMGSLAGH---TDKIISLDI 445

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 95/243 (39%), Gaps = 56/243 (23%)

Query: 379 TLYFDDQKLITGSLDKTIRVWNYITGECIST-YRGHTDSVMSVDSH---KKIIVSGSADK 434
           +L  DD  + TGS    ++V N  T + ++     H   + ++D H      ++S + D 
Sbjct: 182 SLSTDDMVVATGSWAGDLQVLNSQTLQPLTQKLDSHVGKIGAIDWHPDSNNQMISCAEDG 241

Query: 435 TVKVWHVES-----RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLR 489
            +K +   +     R    L GH   ++ VK HP      S S D T R+WD  T+  L 
Sbjct: 242 LIKNFQYSNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELL 301

Query: 490 VFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKM 549
           +     G  + V  L+     +LV                                    
Sbjct: 302 L---QEGHDKGVFSLSFQCDGSLVC----------------------------------- 323

Query: 550 PYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIW 607
                  S  +D+   LW++RSG  + T  GH + ++ +A   + +++ +G  DG I +W
Sbjct: 324 -------SGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVW 376

Query: 608 DLQ 610
           D++
Sbjct: 377 DIR 379

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 77/163 (47%), Gaps = 13/163 (7%)

Query: 331 KGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQK 386
           +GH  GV +L F  +  L+ +G  D+   +WD+ +G  +  L GHS  + T+ +  +  +
Sbjct: 304 EGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQ 363

Query: 387 LITGSLDKTIRVWNYITGE--CISTYRGHTDSVMSV-----DSHKKIIVSGSADKTVKVW 439
           + TG  D  I VW+    +   ++    H + V  V     D  KK++  G  D  + V+
Sbjct: 364 VATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCG-YDNLINVY 422

Query: 440 HVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWD 481
             ++     +L GHT+ +  + +   S    S   D +I++W+
Sbjct: 423 SSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN 465

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 2/76 (2%)

Query: 547 KKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSI 604
           K  P    + S + D T +LW+  + + +  Q GH +GV+ ++   D   + SG  D   
Sbjct: 272 KYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLS 331

Query: 605 KIWDLQSGKCMHTFHG 620
            +WD++SG  + T  G
Sbjct: 332 MLWDIRSGSKVMTLAG 347

>Scas_717.68
          Length = 908

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 112/286 (39%), Gaps = 63/286 (22%)

Query: 377 VKTLYFDDQKLI-TGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-SHKKIIVSGSADK 434
            +TL   DQK+  T  L+    V+N     C   ++ HT  V+ +D S    +++ S D+
Sbjct: 293 AQTLEKLDQKISSTNELNLYAPVFN---PSCFKIFKEHTADVLDLDWSKNNFLITSSMDR 349

Query: 435 TVKVWHVESRTCYTLKGHTEWVNCVKLHPKS--FSCYSCSDDTTIRMWDIRTNTCLRVFR 492
           TVK+WH+E +T      H ++V CV+ HP    F    C D   +R+W I  N     F 
Sbjct: 350 TVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDH-KVRLWSILENEITFEF- 407

Query: 493 GHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYP 552
                          D Q+L+T            S G G+       NG         Y 
Sbjct: 408 ---------------DCQDLITSL--------TLSPGDGKYTIVGTFNG---------YV 435

Query: 553 THLLSCALDNTIKLWEV------RSGRCIRTQFG-HVEGV--WDIAADN-FRIISGSHDG 602
             LL+  L+       V      R+    +   G  V G+  +    DN  RI+  S D 
Sbjct: 436 HVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDS 495

Query: 603 SIKIWDLQSGKCMHTFHGRK------------LKGSDVNTSSNPDH 636
            I+I+DL+  K +    G +            +KG  V  SS+ DH
Sbjct: 496 RIRIFDLEKKKLLEYLKGFQSGASQHKACLATVKGQQVVLSSSDDH 541

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 85/213 (39%), Gaps = 31/213 (14%)

Query: 330 FKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF---DDQ 385
           FK H   VL L ++    L T S D TV +W L     ++    H D V  + F   DD+
Sbjct: 324 FKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDR 382

Query: 386 KLITGSLDKTIRVW--------------NYITGECISTYRGHTDSVMSVDSHKKIIVSGS 431
             I+G LD  +R+W              + IT   +S   G    V + + +  ++++  
Sbjct: 383 FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKG 442

Query: 432 ADKTVKVWHV-----ESRTCYTLKGH----TEWVNCVKLHP-KSFSCYSCSDDTTIRMWD 481
            ++ V  +HV     + R   + K H       + C K  P  S      S D+ IR++D
Sbjct: 443 LEQ-VSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501

Query: 482 IRTNTCLRVFRG-HVGQVQKVIPLTIIDAQNLV 513
           +     L   +G   G  Q    L  +  Q +V
Sbjct: 502 LEKKKLLEYLKGFQSGASQHKACLATVKGQQVV 534

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 76/154 (49%), Gaps = 19/154 (12%)

Query: 346 LLFTGSYDTTVAIW----DLFTGK--LIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIR 397
           +L  GS+DTTV+IW    D ++G+  L+  + GH + VK++ +  D   L T S DK++ 
Sbjct: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129

Query: 398 VWNY----ITGECISTYRGHTDSVMSVDSH--KKIIVSGSADKTVKVWHVES---RTCYT 448
           +W         EC S  + H+  V  +  H  + ++ S S D TV++W  +         
Sbjct: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189

Query: 449 LKGH--TEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
           L GH  T W +  +         S SDDTT+R+W
Sbjct: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 87/194 (44%), Gaps = 19/194 (9%)

Query: 324 LCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRL--TGHSDGVKTLY 381
           L  ++  K H D   ++  +  LL TGS D  + + D+   KL+  L  T H   V+++ 
Sbjct: 4   LHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVA 63

Query: 382 FDDQ--KLITGSLDKTIRVWNY----ITG--ECISTYRGHTDSVMSVD-SHK-KIIVSGS 431
           +      L  GS D T+ +W       +G  E ++   GH + V SV  SH    + + S
Sbjct: 64  WRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCS 123

Query: 432 ADKTVKVWHV----ESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN- 485
            DK+V +W      E   C + L+ H++ V  +  H       S S D T+R+W  + + 
Sbjct: 124 RDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDD 183

Query: 486 -TCLRVFRGHVGQV 498
             C  V  GH G V
Sbjct: 184 WECAAVLSGHGGTV 197

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 97/226 (42%), Gaps = 34/226 (15%)

Query: 407 ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLK-----GHTEWVNCVKL 461
           + + + H D   SVD  K ++ +GSAD+ +K+  V+ R    ++      H + V  V  
Sbjct: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAHKKAVRSVAW 64

Query: 462 HPKSFSCYSCSDDTTIRMW-----DIRTNT-CLRVFRGHVGQVQKVIPLTIIDAQNLVTH 515
            P      + S DTT+ +W     D    T  L V  GH  +V+ V      D   L T 
Sbjct: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH--DGAYLATC 122

Query: 516 ERKPG----EEDDIASNGTGEDDPENGVNGQRELDKK--MPYPTHLL--SCALDNTIKLW 567
            R       E D+++     E+   N V  +   D K  + + + LL  S + D+T+++W
Sbjct: 123 SRDKSVWIWEADELS-----EEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177

Query: 568 EVRSG--RCIRTQFGHVEGVW----DIAADNFRIISGSHDGSIKIW 607
             +     C     GH   VW    + A    R+ SGS D +++IW
Sbjct: 178 AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223

>Kwal_56.24163
          Length = 729

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 62/128 (48%), Gaps = 8/128 (6%)

Query: 353 DTTVAIWDLFTGKLIRRLTGH-SDGVKTL-YF---DDQKLITGSLDKTIRVWNYITGECI 407
           D TV IW L        L  H + GV  + Y+   D   LIT S D+T+++W+Y T  C+
Sbjct: 19  DHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCV 78

Query: 408 STYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPK 464
           +T  GH  +V     H    II+SGS D T+KVW+  + +   TL    E   C+  HP 
Sbjct: 79  ATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNTYKLEKTLNLGLERSWCIATHPT 138

Query: 465 SFSCYSCS 472
               Y  S
Sbjct: 139 GKRNYIAS 146

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 55/108 (50%), Gaps = 6/108 (5%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGH-TDSVMSVDSH----KKIIVSGSADKTVK 437
           D     +  LD T+++W+        T + H T  V  VD +    K  +++ S D+TVK
Sbjct: 9   DPSTFASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVK 68

Query: 438 VWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
           +W  ++++C  TL+GH   V+    HP      S S+D T+++W+  T
Sbjct: 69  IWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNT 116

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 427 IVSGSADKTVKVWHVESRTC-YTLKGH-TEWVNCVKLHPKSFSCY--SCSDDTTIRMWDI 482
             S   D TVK+W +   T  +TL+ H T  VN V  +P     Y  + SDD T+++WD 
Sbjct: 13  FASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDY 72

Query: 483 RTNTCLRVFRGHVGQVQKVI 502
           +T +C+    GH+  V   +
Sbjct: 73  QTKSCVATLEGHMANVSYAV 92

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGV-WDIAADNFRII-SGSHDGSIKIWDLQS 611
           +L++ + D T+K+W+ ++  C+ T  GH+  V + +   +  II SGS DG++K+W+  +
Sbjct: 57  YLITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNT 116

Query: 612 GKCMHTFH 619
            K   T +
Sbjct: 117 YKLEKTLN 124

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 552 PTHLLSCALDNTIKLWEVRSGRCIRTQFGH-VEGV----WDIAADNFRIISGSHDGSIKI 606
           P+   S  LD+T+K+W +       T   H   GV    +    D   +I+ S D ++KI
Sbjct: 10  PSTFASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKI 69

Query: 607 WDLQSGKCMHTFHG 620
           WD Q+  C+ T  G
Sbjct: 70  WDYQTKSCVATLEG 83

 Score = 36.2 bits (82), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWN 400
           L T S D TV IWD  T   +  L GH   V    F      +++GS D T++VWN
Sbjct: 58  LITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWN 113

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 79/158 (50%), Gaps = 15/158 (9%)

Query: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGEC 406
           T S D T+ I  +  G+L  RL GH+  V +L +  +   L + S+D++I++W+ +TG  
Sbjct: 73  TASDDFTIEINHITYGRL-HRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTL 131

Query: 407 ISTYRGHTDSVMSVD---SHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLH 462
           + T   H++ V+S+D       I+ SGS D  ++++   +  C  TL    +W +   + 
Sbjct: 132 LKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVV 191

Query: 463 PKSFSCYSC--------SDDTTIRMWDIRTNTCLRVFR 492
           P S   +S         S D  +++WD    + +R F+
Sbjct: 192 PISQVKFSVNGKYLLVKSLDGVLKIWDFIRGSVVRTFK 229

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 15/128 (11%)

Query: 327 IQEFKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           +    GH   VL+L +  +  LL + S D ++ IWD+ TG L++ ++ HS+ V ++    
Sbjct: 90  LHRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTISAHSEPVVSIDMPV 149

Query: 383 -DDQKLITGSLDKTIRVWNYITGECISTYRGHTD----------SVMSVDSHKKIIVSGS 431
            D   L +GS D  IR+++  TG C+ T     D          S +    + K ++  S
Sbjct: 150 CDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVKS 209

Query: 432 ADKTVKVW 439
            D  +K+W
Sbjct: 210 LDGVLKIW 217

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI---AADNFRIISGSHDGSIKIWDLQS 611
           L S ++D +IK+W+V +G  ++T   H E V  I     D   + SGS+DG I+I+D  +
Sbjct: 112 LCSASMDESIKIWDVLTGTLLKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTT 171

Query: 612 GKCMHTF 618
           G C+ T 
Sbjct: 172 GHCLKTL 178

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 91/249 (36%), Gaps = 60/249 (24%)

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHV 441
           D K I  S   +  ++N   G        H +S+  +      + I + S D T+++ H+
Sbjct: 26  DGKFIAVSQGTSYLLYNVSDGLSAFIPTSHVESMSDICWSPDSQCIATASDDFTIEINHI 85

Query: 442 ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
                + L GHT  V  +    K     S S D +I++WD+ T T L+    H       
Sbjct: 86  TYGRLHRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTISAHSE----- 140

Query: 502 IPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPY--PTHLLSCA 559
            P+  ID                                        MP   P+ L S +
Sbjct: 141 -PVVSID----------------------------------------MPVCDPSILSSGS 159

Query: 560 LDNTIKLWEVRSGRCIRT-----QFGHVEGVWDIAADNFRI-----ISGSHDGSIKIWDL 609
            D  I++++  +G C++T      +    GV  I+   F +     +  S DG +KIWD 
Sbjct: 160 YDGLIRIFDTTTGHCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVKSLDGVLKIWDF 219

Query: 610 QSGKCMHTF 618
             G  + TF
Sbjct: 220 IRGSVVRTF 228

>Scas_720.45
          Length = 755

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 63/134 (47%), Gaps = 12/134 (8%)

Query: 349 TGSYDTTVAIWDLFTGKLIRRLT---GHSDGVKTL-YF---DDQKLITGSLDKTIRVWNY 401
           +G  D TV +W L  G+     T   G   GV  + Y+   D   LIT S D T +VW+Y
Sbjct: 15  SGCLDRTVKVWSL--GQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCKVWDY 72

Query: 402 ITGECISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNC 458
            T  C++T  GH  +V     H    II+SGS D T+K+W+  + +   TL    E   C
Sbjct: 73  QTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSATYKVEKTLSLGLERSWC 132

Query: 459 VKLHPKSFSCYSCS 472
           +  HP     Y  S
Sbjct: 133 IATHPTGKKNYIAS 146

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTY---RGHTDSVMSVDSH----KKIIVSGSADKT 435
           D     +G LD+T++VW+   G+    +    G    V  VD +    K  +++ S D T
Sbjct: 9   DPNTFASGCLDRTVKVWS--LGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLT 66

Query: 436 VKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
            KVW  ++++C  TL+GH   V+    HP      S S+D T+++W+  T
Sbjct: 67  CKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSAT 116

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 427 IVSGSADKTVKVWHVESRTC-YTL-KGHTEWVNCVKLHPKSFSCY--SCSDDTTIRMWDI 482
             SG  D+TVKVW +   T  +TL  G  + VN V  +P     Y  + SDD T ++WD 
Sbjct: 13  FASGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCKVWDY 72

Query: 483 RTNTCLRVFRGHVGQVQKVI 502
           +T +C+    GH+  V   +
Sbjct: 73  QTKSCVATLEGHMANVSFAV 92

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 549 MPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGV-WDIAADNFR-IISGSHDGSIKI 606
           +P   +L++ + D T K+W+ ++  C+ T  GH+  V + +       IISGS DG++KI
Sbjct: 52  LPDKPYLITSSDDLTCKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKI 111

Query: 607 WDLQSGKCMHTF 618
           W+  + K   T 
Sbjct: 112 WNSATYKVEKTL 123

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYIT 403
           L T S D T  +WD  T   +  L GH   V    F      +I+GS D T+++WN  T
Sbjct: 58  LITSSDDLTCKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSAT 116

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 552 PTHLLSCALDNTIKLWEV-RSGRCIRTQFGHVEGV----WDIAADNFRIISGSHDGSIKI 606
           P    S  LD T+K+W + ++        G  +GV    +    D   +I+ S D + K+
Sbjct: 10  PNTFASGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCKV 69

Query: 607 WDLQSGKCMHTFHG 620
           WD Q+  C+ T  G
Sbjct: 70  WDYQTKSCVATLEG 83

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 76/158 (48%), Gaps = 23/158 (14%)

Query: 346 LLFTGSYDTTVAIW-----DLFTG-----KLIRRLTGHSDGVKTLYF--DDQKLITGSLD 393
           LL  GS+D+T++IW     DL  G     +L+  + GH + VK + +  D   L T S D
Sbjct: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132

Query: 394 KTIRVWNYITG----ECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVW--HVESRT 445
           K++ +W         ECIS  + H+  V  V  H K  ++ S S D TV++W  + +   
Sbjct: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192

Query: 446 CYT-LKGH--TEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
           C   L GH  T W +            S SDD+T+R+W
Sbjct: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 57/272 (20%), Positives = 100/272 (36%), Gaps = 74/272 (27%)

Query: 365 KLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGEC----ISTYRGHTDSVM 418
           +L + L  H+D V ++ F+  +  L TGS D+ I+V     G+     +     H  +V 
Sbjct: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63

Query: 419 SVD--SHKKIIVSGSADKTVKVW-----------HVESRTCYTLKGHTEWVNCVKLHPKS 465
           SV    H  ++ +GS D T+ +W            +E      ++GH   V  +      
Sbjct: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123

Query: 466 FSCYSCSDDTTIRMWDI----RTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGE 521
               +CS D ++ +W+         C+ V + H   V+ V+  T     NL         
Sbjct: 124 CLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT---KHNL--------- 171

Query: 522 EDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSG--RCIRTQF 579
                                            L S + D+T+++W+       C     
Sbjct: 172 ---------------------------------LASSSYDDTVRIWKDYDDDWECAAVLT 198

Query: 580 GHVEGVW--DIA--ADNFRIISGSHDGSIKIW 607
           GH   +W  D +   D  R+ SGS D ++++W
Sbjct: 199 GHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 344 YRLLFTGSYDTTVAIWDLFTG--KLIRRLTGHSDGVKTLYF----DDQKLITGSLDKTIR 397
           + LL + SYD TV IW  +    +    LTGH   +    F    D  +L +GS D T+R
Sbjct: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228

Query: 398 VWNYI 402
           VW YI
Sbjct: 229 VWKYI 233

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 83/198 (41%), Gaps = 16/198 (8%)

Query: 427 IVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
           +++G     +++W VE +    L  H   + C+K +       +C  D    +W++ + T
Sbjct: 209 LLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGT 268

Query: 487 CLRVFRGHVGQVQKVIPL--TIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRE 544
            ++ F       ++ + +  T ID          PG +  I     G   P   + G  +
Sbjct: 269 AVQHFSFKEAGTEESLGVDATWIDQDKFAI----PGIQGSILVFNIGISKPIGKLRGHSK 324

Query: 545 LDKKMPYPTH---LLSCALDNTIKLWEVRSGRCIRTQFGHVEGV----WDIAADNFRIIS 597
               + Y  H   LLS + DNT+++W   +       +GH + +    W    D+  IIS
Sbjct: 325 TLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW---VDDDTIIS 381

Query: 598 GSHDGSIKIWDLQSGKCM 615
            S DGSI++W L S   +
Sbjct: 382 TSMDGSIRVWSLASNSTV 399

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 67/145 (46%), Gaps = 10/145 (6%)

Query: 353 DTTVAIWDLFTGKLIRRL------TGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGEC 406
           D    +W++ +G  ++        T  S GV   + D  K     +  +I V+N    + 
Sbjct: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKP 315

Query: 407 ISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHP 463
           I   RGH+ ++ ++  + H K+++S S D T++VW   +    +   GH++ +       
Sbjct: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375

Query: 464 KSFSCYSCSDDTTIRMWDIRTNTCL 488
              +  S S D +IR+W + +N+ +
Sbjct: 376 DD-TIISTSMDGSIRVWSLASNSTV 399

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 59/121 (48%), Gaps = 5/121 (4%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-D 383
           I + +GH   + T+ +N   +LL + S D T+ +W            GHS  + + ++ D
Sbjct: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375

Query: 384 DQKLITGSLDKTIRVWNYITGECI--STYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHV 441
           D  +I+ S+D +IRVW+  +   +  +T  G  +   ++   +    +G+ D  V V+ +
Sbjct: 376 DDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435

Query: 442 E 442
           +
Sbjct: 436 Q 436

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/278 (19%), Positives = 110/278 (39%), Gaps = 64/278 (23%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITG 404
           L TG     + +W +  GKL   L+ H   +  + +  D+  ++T   D    VWN ++G
Sbjct: 209 LLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267

Query: 405 ECISTY---RGHTDSVMSVDS----HKKIIVSGSADKTVKVWHVE-SRTCYTLKGHTEWV 456
             +  +      T+  + VD+      K  + G    ++ V+++  S+    L+GH++ +
Sbjct: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG-IQGSILVFNIGISKPIGKLRGHSKTL 326

Query: 457 NCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHE 516
             +  +  +    S SDD T+R+W         VF GH                      
Sbjct: 327 TTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGH---------------------- 364

Query: 517 RKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIR 576
                   I S    +DD                    ++S ++D +I++W + S   + 
Sbjct: 365 -----SQSITSAHWVDDDT-------------------IISTSMDGSIRVWSLASNSTVA 400

Query: 577 TQFGHVEGVWD----IAADNFRIISGSHDGSIKIWDLQ 610
           +    V+GV +    ++ D  +  +G+ DG + ++D+Q
Sbjct: 401 S--ATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436

>Kwal_27.12239
          Length = 316

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 67/140 (47%), Gaps = 16/140 (11%)

Query: 327 IQEFKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL---Y 381
           +    GH   V ++++  +  LL + S D ++ IWD+ +G L+R L+ HS+ V ++    
Sbjct: 92  LHRLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDLPP 151

Query: 382 FDDQKLITGSLDKTIRVWNYITGECISTYRGHTD----------SVMSVDSHKKIIVSGS 431
           FD   L +GS D  IR+++  TG C+ T     D          S +    + K ++  S
Sbjct: 152 FDPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYLLVKS 211

Query: 432 ADKTVKVW-HVESRTCYTLK 450
            D  +K+W  V  +   T K
Sbjct: 212 LDGILKIWDFVRGKVVRTFK 231

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 87/218 (39%), Gaps = 56/218 (25%)

Query: 411 RGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYS 470
           R  +D   S DS  + I + S D T+ + H+     + L GHT  V  VK   K     S
Sbjct: 59  RPLSDLCWSPDS--QCIATASDDFTIIITHIVFGELHRLVGHTAPVTSVKYTMKGNLLCS 116

Query: 471 CSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGT 530
           CS D +I++WDI + T LR    H              ++ +V+ +  P +         
Sbjct: 117 CSMDESIKIWDILSGTLLRTLSAH--------------SEPVVSIDLPPFD--------- 153

Query: 531 GEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRT-----QFGHVEGV 585
                                P+ L S + D  I++++  +G C++T      +    GV
Sbjct: 154 ---------------------PSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGV 192

Query: 586 WDIAADNFR-----IISGSHDGSIKIWDLQSGKCMHTF 618
             I+   F      ++  S DG +KIWD   GK + TF
Sbjct: 193 VPISQVKFSRNGKYLLVKSLDGILKIWDFVRGKVVRTF 230

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 65/142 (45%), Gaps = 24/142 (16%)

Query: 327 IQEFKGHMDGVLTLQ---FNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSD-------- 375
           ++    H + V+++    F+  +L +GSYD  + I+D  TG  ++ LT   D        
Sbjct: 134 LRTLSAHSEPVVSIDLPPFDPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVV 193

Query: 376 GVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-----------S 422
            +  + F  + + L+  SLD  +++W+++ G+ + T++    S +              +
Sbjct: 194 PISQVKFSRNGKYLLVKSLDGILKIWDFVRGKVVRTFKSGESSSLRYSCGMDFLYPQDQT 253

Query: 423 HKKIIVSGSADKTVKVWHVESR 444
              I+VSG+    +  W  +++
Sbjct: 254 VDPIVVSGTESGQIVCWDSQTK 275

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 77/159 (48%), Gaps = 25/159 (15%)

Query: 346 LLFTGSYDTTVAIW-----------DLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSL 392
           +L  GS+D+TV+IW           DL T +L+  + GH + +K + +  D + L T S 
Sbjct: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATCSR 129

Query: 393 DKTIRVWNY----ITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWH---VES 443
           DK++ +W         ECIS  + H+  V  V  H+   ++ S S D TV++W     + 
Sbjct: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDW 189

Query: 444 RTCYTLKGH--TEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
             C  L GH  T W +  +    +    S SDD T+R+W
Sbjct: 190 ECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/272 (22%), Positives = 105/272 (38%), Gaps = 71/272 (26%)

Query: 365 KLIRRLTGHSDGVKTLYFDDQKLI-TGSLDKTIRVWNYITGECISTY--RGHTDSVMSVD 421
           KL++ L  H D   ++  ++  ++ TGS D+ I++ +  + + I       H  +V SV 
Sbjct: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64

Query: 422 --SHKKIIVSGSADKTVKVW-----------HVESRTCYTLKGHTEWVNCVKLHPKSFSC 468
              H  I+ +GS D TV +W            +E+     ++GH   + CV         
Sbjct: 65  WRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124

Query: 469 YSCSDDTTIRMWDI----RTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDD 524
            +CS D ++ +W+         C+ V + H   V+ VI            H+  P     
Sbjct: 125 ATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI-----------WHQSLP----- 168

Query: 525 IASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWE--VRSGRCIRTQFGHV 582
                                         L S + D+T+++W+       C     GH 
Sbjct: 169 -----------------------------LLASSSYDDTVRIWKDCDDDWECCAVLNGHE 199

Query: 583 EGVW----DIAADNFRIISGSHDGSIKIWDLQ 610
             VW    + +  N R+ SGS DG+++IW L+
Sbjct: 200 GTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLE 231

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 71/168 (42%), Gaps = 24/168 (14%)

Query: 330 FKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDL----FTGKLIRRLTGHSDGVKTLYFD 383
            +GH + +  + +++   LL T S D +V IW+        + I  L  HS  VK + + 
Sbjct: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164

Query: 384 DQK--LITGSLDKTIRVWNYITG--ECISTYRGHTDSVMSVDSHKK----IIVSGSADKT 435
                L + S D T+R+W       EC +   GH  +V S D  K      + SGS D T
Sbjct: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGT 224

Query: 436 VKVWHVES----------RTCYTLKGHTEWVNCVKLHPKSFSCYSCSD 473
           V++W +E           +     K HT  V  V   PK +   + SD
Sbjct: 225 VRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSD 272

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 78/172 (45%), Gaps = 9/172 (5%)

Query: 330 FKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQ 385
            + H   V T+++++    L +G  D  + IW      +      H + V+ + F   D 
Sbjct: 119 MQAHDSAVTTMEYSHAGDWLISGDSDGIIKIWQPNFNMVKVLDQAHMECVRDVSFSGTDS 178

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVES 443
           K +T S D  +++WN+  G+      GH   V S D H    +IVSGS D  +K+W   S
Sbjct: 179 KFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHPTMGLIVSGSKDNLIKLWDPRS 238

Query: 444 RTCY-TLKGHTEWVNCVKLHPKSFSCYS-CSDDTTIRMWDIRTNTC-LRVFR 492
             C  T+ G    +   K  P   +  +  + D + +++DIR N   L+ FR
Sbjct: 239 GQCISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQNMKELKSFR 290

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 75/201 (37%), Gaps = 48/201 (23%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-SHK-KIIVSGSADKTVKVWH 440
           + ++L+  +      +WN  T    S  + H  +V +++ SH    ++SG +D  +K+W 
Sbjct: 92  EGRRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDWLISGDSDGIIKIWQ 151

Query: 441 VESRTCYTL-KGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
                   L + H E V  V          +CSDD  +++W+       RV  GH   V+
Sbjct: 152 PNFNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVK 211

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCA 559
                                           +  P  G+               ++S +
Sbjct: 212 SC------------------------------DWHPTMGL---------------IVSGS 226

Query: 560 LDNTIKLWEVRSGRCIRTQFG 580
            DN IKLW+ RSG+CI T  G
Sbjct: 227 KDNLIKLWDPRSGQCISTILG 247

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 8/73 (10%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIWDL 609
            ++C+ DN +K+W   +G+  R   GH    WD+ + ++      I+SGS D  IK+WD 
Sbjct: 180 FVTCSDDNILKIWNFSNGQQERVLSGHH---WDVKSCDWHPTMGLIVSGSKDNLIKLWDP 236

Query: 610 QSGKCMHTFHGRK 622
           +SG+C+ T  G K
Sbjct: 237 RSGQCISTILGFK 249

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 60/154 (38%), Gaps = 5/154 (3%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYI 402
           R L   +Y    ++W+  T      +  H   V T+ +      LI+G  D  I++W   
Sbjct: 94  RRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDWLISGDSDGIIKIWQPN 153

Query: 403 TGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCV 459
                   + H + V  +S        V+ S D  +K+W+  + +    L GH   V   
Sbjct: 154 FNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSC 213

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
             HP      S S D  I++WD R+  C+    G
Sbjct: 214 DWHPTMGLIVSGSKDNLIKLWDPRSGQCISTILG 247

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 11/131 (8%)

Query: 327 IQEFKGHMDGVL--TLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           I   +GH   +   T   N +LL + S D ++ IWD+ +GKL+ R  GH+  +  L F  
Sbjct: 174 IHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRAWGHTARIWNLKFFN 233

Query: 383 DDQKLITGSLDKTIRVWNYITGECI--STYRGH-TDSVMSVDSHKK--IIVSGSADKTVK 437
           DD +LI+ S D T RVWNY   E      +  H T +V  VD  +   I +SG  D  +K
Sbjct: 234 DDTQLISVSEDCTCRVWNYKNDELTIKDIFESHLTKNVWGVDVEETNLIAISGGNDGRLK 293

Query: 438 VWHV--ESRTC 446
           V  +   +R+C
Sbjct: 294 VTELVPHNRSC 304

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 54/113 (47%), Gaps = 5/113 (4%)

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRT- 445
           LI    + T++  +++ GE    Y G     + V  HK ++ +G+    + VW ++S+  
Sbjct: 118 LIIDPDNFTVKSTHFVEGERSILYSGS----IKVLRHKVLVNAGTIMNGIIVWELDSKKK 173

Query: 446 CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQV 498
            +TL+GH   +  V          SCSDD +I +WD+ +   L    GH  ++
Sbjct: 174 IHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRAWGHTARI 226

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 53/112 (47%), Gaps = 5/112 (4%)

Query: 389 TGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVW-HVESRT 445
            G++   I VW   + + I T RGH  S+  V   ++ K++ S S D+++ +W  V  + 
Sbjct: 156 AGTIMNGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKL 215

Query: 446 CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN--TCLRVFRGHV 495
                GHT  +  +K         S S+D T R+W+ + +  T   +F  H+
Sbjct: 216 LSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKNDELTIKDIFESHL 267

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWDLQS 611
           L SC+ D +I +W++ SG+ +   +GH   +W++    D+ ++IS S D + ++W+ ++
Sbjct: 196 LASCSDDRSIIIWDMVSGKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKN 254

 Score = 36.6 bits (83), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 51/99 (51%), Gaps = 4/99 (4%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGV--KTLYFDDQKLITGSLDKTIRVWNYIT 403
           L+  G+    + +W+L + K I  L GH   +   T   + + L + S D++I +W+ ++
Sbjct: 153 LVNAGTIMNGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVS 212

Query: 404 GECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWH 440
           G+ +S   GHT  +  +   +    ++S S D T +VW+
Sbjct: 213 GKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWN 251

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 562 NTIKLWEVRSGRCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWDLQSGKCM 615
           N I +WE+ S + I T  GH   ++ +   N    + S S D SI IWD+ SGK +
Sbjct: 161 NGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLL 216

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 84/206 (40%), Gaps = 44/206 (21%)

Query: 324 LCTIQEFKGHMDGVLTLQFNYR----LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKT 379
           L  I+   GH   V   QF  R    LL T S D  + IWD+  G  I+    H+  +++
Sbjct: 191 LSHIKTLAGHEHTVSDCQFFERGADLLLATCSRDLYLKIWDISNGWCIKSFQPHTQWIRS 250

Query: 380 LYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV-----------DSHKKI-- 426
           L+   + ++TGS D  IR+ ++ +G  +S   GH   V  V             ++ +  
Sbjct: 251 LHVHGEFVLTGSNDSAIRLTHWPSGNGLSMGIGHDFPVEKVLILIPDPQHLQPQYQPLGF 310

Query: 427 --IVSGSADKTVKVWHVE------------------SRTCYTLKGHTEWVNCVKLHPKSF 466
             + S S D T+++W V                    +    L  H  WV    L   + 
Sbjct: 311 QHVASASRDGTIRLWKVSLPKFIPHRPPRPNPLDTTFKVIAVLTDHNSWVR--DLRQFND 368

Query: 467 SCYSCSDDTTIRMW-----DIRTNTC 487
             +SCSDD +++ W     ++ T TC
Sbjct: 369 MLFSCSDDGSVKCWSLDWTNLSTTTC 394

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/241 (21%), Positives = 89/241 (36%), Gaps = 38/241 (15%)

Query: 407 ISTYRGHTDSVMSV-------DSHKKIIVSGSADKTVKVWHVESRTCY----TLKGHTEW 455
           + +   H D + S+       +     + + S D   K+W +E  +      TL GH   
Sbjct: 144 LQSTMAHMDGITSISISLPNENGRPAYLATTSKDLNTKIWELELDSTLSHIKTLAGHEHT 203

Query: 456 VNCVKLHPKS--FSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQK--VIPLTIIDAQN 511
           V+  +   +       +CS D  +++WDI    C++ F+ H   ++   V    ++   N
Sbjct: 204 VSDCQFFERGADLLLATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSN 263

Query: 512 LVTHERKPGEEDDIASNGTGEDDPENGV-----NGQRELDKKMPYP-THLLSCALDNTIK 565
                       +  S G G D P   V     + Q    +  P    H+ S + D TI+
Sbjct: 264 DSAIRLTHWPSGNGLSMGIGHDFPVEKVLILIPDPQHLQPQYQPLGFQHVASASRDGTIR 323

Query: 566 LWEVR-----------------SGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWD 608
           LW+V                  + + I     H   V D+   N  + S S DGS+K W 
Sbjct: 324 LWKVSLPKFIPHRPPRPNPLDTTFKVIAVLTDHNSWVRDLRQFNDMLFSCSDDGSVKCWS 383

Query: 609 L 609
           L
Sbjct: 384 L 384

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKI--WDLQSG 612
           L +C+ D  +K+W++ +G CI++   H + +  +      +++GS+D +I++  W   +G
Sbjct: 218 LATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSNDSAIRLTHWPSGNG 277

Query: 613 KCMHTFH 619
             M   H
Sbjct: 278 LSMGIGH 284

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 552 PTHLLSCALDNTIKLWEVRSGRC---IRTQFGHVEGVWDIA----ADNFRIISGSHDGSI 604
           P +L + + D   K+WE+        I+T  GH   V D        +  + + S D  +
Sbjct: 168 PAYLATTSKDLNTKIWELELDSTLSHIKTLAGHEHTVSDCQFFERGADLLLATCSRDLYL 227

Query: 605 KIWDLQSGKCMHTFH 619
           KIWD+ +G C+ +F 
Sbjct: 228 KIWDISNGWCIKSFQ 242

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 15/117 (12%)

Query: 529 GTGEDDP---ENGVNGQRELD----------KKMPYPTHLLSCALDNTIKLWEVRSGRCI 575
           GT E D    ++  N QRE+D          K  P    L+S + D  +K+W V+ G   
Sbjct: 112 GTTEGDIKVLDSNFNLQREIDQAHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNP 171

Query: 576 RTQFGHVEGVWDIAA-DNFR-IISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNT 630
           RT  GH   V DIA  D  R ++S S DG+I++W+  +G  +HTF+ ++     VN+
Sbjct: 172 RTLIGHRATVTDIAIIDRGRNVLSASLDGTIRLWECGTGTTIHTFNRKENPHDGVNS 228

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 78/195 (40%), Gaps = 43/195 (22%)

Query: 331 KGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQ--K 386
           + H+  +  L+F  +   L + S D  + IW +  G   R L GH   V  +   D+   
Sbjct: 133 QAHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRN 192

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADK------TVKVWH 440
           +++ SLD TIR+W   TG  I T+    +    V+S   I +    D+      T K  +
Sbjct: 193 VLSASLDGTIRLWECGTGTTIHTFNRKENPHDGVNS---IALFVGTDRQLHEISTSKKNN 249

Query: 441 VESRTC--YTLKGHTEWVNCVKLH-----------PKSFSC---------------YSCS 472
           +E  T   Y + GH   V  + +H           P  F+C               Y+  
Sbjct: 250 LEFGTYGKYVIAGHVSGV--ITVHNVFSKEQTIQLPSKFTCSCNSLTVDGNNANYIYAGY 307

Query: 473 DDTTIRMWDIRTNTC 487
           ++  +  WD+R+  C
Sbjct: 308 ENGMLAQWDLRSPEC 322

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 427 IVSGSADKTVKVWHV-ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN 485
           ++S S D  +K+W V +     TL GH   V  + +  +  +  S S D TIR+W+  T 
Sbjct: 151 LISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGTIRLWECGTG 210

Query: 486 TCLRVF 491
           T +  F
Sbjct: 211 TTIHTF 216

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 68/137 (49%), Gaps = 16/137 (11%)

Query: 361 LFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV 420
           LFT   I     H+  VKTL    + L++GS D+ IR+++    + + T   H  S+ S+
Sbjct: 30  LFTP--IFHFQAHALSVKTLDISRRYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSL 87

Query: 421 DSHK------------KIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFS 467
              +            K ++S S D T+ +W V+    +  LKGH   +N + +HP S  
Sbjct: 88  RFSRATTDKDGKQQGNKWLLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHP-SNR 146

Query: 468 CYSCSDDTTIRMWDIRT 484
             S S+D +IR+W++ T
Sbjct: 147 VASVSEDHSIRLWNLMT 163

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 58/128 (45%), Gaps = 13/128 (10%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--- 383
           I  F+ H   V TL  + R L +GS D  + I+DL   K +  L  H+  + +L F    
Sbjct: 34  IFHFQAHALSVKTLDISRRYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSLRFSRAT 93

Query: 384 ---------DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH-KKIIVSGSAD 433
                    ++ L++ S D TI +W     E     +GH   +  +D H    + S S D
Sbjct: 94  TDKDGKQQGNKWLLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHPSNRVASVSED 153

Query: 434 KTVKVWHV 441
            ++++W++
Sbjct: 154 HSIRLWNL 161

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 611
           LLS + D+TI +W V+         GH   +   DI   N R+ S S D SI++W+L +
Sbjct: 106 LLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHPSN-RVASVSEDHSIRLWNLMT 163

>Kwal_14.884
          Length = 395

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 72/163 (44%), Gaps = 22/163 (13%)

Query: 324 LCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD 383
              I  F+ H   V  L  + R L +GS D  + I+DL   K +  L  H   +  L F 
Sbjct: 31  FTPIFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90

Query: 384 D-QKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVE 442
              K+   + D T           ++T RG++          K ++S S D  + +W V+
Sbjct: 91  KGTKIEDKNEDDT----------GLTTGRGNS----------KWLISASDDHNLVIWRVK 130

Query: 443 SRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
               + TLKGH   +N   +HP +    S S+D +IR+W++ T
Sbjct: 131 DWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 68/172 (39%), Gaps = 34/172 (19%)

Query: 446 CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ--KVIP 503
            +  + H+  V C+ +  +     S S+D  IR++D++    L     H G +   K   
Sbjct: 34  IFHFQAHSLSVKCLDISKRYL--VSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK 91

Query: 504 LTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNT 563
            T I+ +N         E+D   + G G                       L+S + D+ 
Sbjct: 92  GTKIEDKN---------EDDTGLTTGRGN-------------------SKWLISASDDHN 123

Query: 564 IKLWEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGK 613
           + +W V+      T  GH   +  +DI   N   IS S D SI++W+L + K
Sbjct: 124 LVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 75/347 (21%), Positives = 125/347 (36%), Gaps = 125/347 (36%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFDDQKLITGSLDKTIRVW------ 399
           + +GSYD  V  WDL +G + ++ +GHS  ++ + Y  + +L++   D+T+R+W      
Sbjct: 118 IISGSYDGIVRTWDL-SGNVQKQYSGHSGPIRAVKYISNTRLVSAGNDRTLRLWKTKNDD 176

Query: 400 -----------------NYITGECISTYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHV 441
                            N   G+ ++   GH   V+S+D S    I+S S D ++  W  
Sbjct: 177 LKLTSQQQAQEDDDDEVNIEDGKTLAILEGHKAPVVSIDVSDNSRILSASYDNSIGFWST 236

Query: 442 ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWD--IRTNTCLRVFRGHVGQVQ 499
             +   T+    E +N    +P +    +      + M D  IR    L +   H   V+
Sbjct: 237 IYKEM-TVVDPLEDIN----NPNNKISTAARKRRKLTMKDGTIRRRAPLSLLESHTAPVE 291

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCA 559
           +VI                              D  +N V                 S +
Sbjct: 292 QVI-----------------------------FDSTDNTVG---------------YSVS 307

Query: 560 LDNTIKLWEVRSGRCIRTQ----------------------------------------- 578
            D+TIK W++ + RCI T+                                         
Sbjct: 308 QDHTIKTWDLVTARCIDTRTTSYSLLSIAQLSTLNLLACGSSARHITLHDPRVGASSKVT 367

Query: 579 ----FGHVEGV--WDIAADNFRII-SGSHDGSIKIWDLQSGKCMHTF 618
                GH   V   D   +N  I+ SGSHDG++K+WD++S   M+T 
Sbjct: 368 QQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVWDVRSTSPMYTI 414

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 87/223 (39%), Gaps = 25/223 (11%)

Query: 416 SVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDT 475
           S + V    K I+SGS D  V+ W +         GH+  +  VK +  +    S  +D 
Sbjct: 107 SSLDVGDGSKHIISGSYDGIVRTWDLSGNVQKQYSGHSGPIRAVK-YISNTRLVSAGNDR 165

Query: 476 TIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHE--RKPGEEDDIASNG-TGE 532
           T+R+W  + N  L++      Q      + I D + L   E  + P    D++ N     
Sbjct: 166 TLRLWKTK-NDDLKLTSQQQAQEDDDDEVNIEDGKTLAILEGHKAPVVSIDVSDNSRILS 224

Query: 533 DDPENGVNGQRELDKKMPY---------PTHLLSCAL---------DNTIKLWEVRSGRC 574
              +N +     + K+M           P + +S A          D TI+     S   
Sbjct: 225 ASYDNSIGFWSTIYKEMTVVDPLEDINNPNNKISTAARKRRKLTMKDGTIRRRAPLS--L 282

Query: 575 IRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHT 617
           + +    VE V   + DN    S S D +IK WDL + +C+ T
Sbjct: 283 LESHTAPVEQVIFDSTDNTVGYSVSQDHTIKTWDLVTARCIDT 325

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 587 DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
           D+   +  IISGS+DG ++ WDL SG     + G
Sbjct: 110 DVGDGSKHIISGSYDGIVRTWDL-SGNVQKQYSG 142

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 64/149 (42%), Gaps = 5/149 (3%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYI 402
           R L   +Y    ++W+  +      +  H   V T+ +  D   +I+G  D  I++W   
Sbjct: 106 RRLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPN 165

Query: 403 TGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCV 459
                     HT+S+  M+  S+    V+ S D  +K+W+  + +    L GH   V   
Sbjct: 166 FSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSC 225

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCL 488
             HP+     S S D  +++WD R+  C+
Sbjct: 226 DWHPEMGLIASASKDNLVKLWDPRSGNCI 254

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 80/177 (45%), Gaps = 13/177 (7%)

Query: 318 SNWRKGLCTIQEF-KGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHS 374
           S W     T +   + H   V T+++++    + +G  D  + IW      +      H+
Sbjct: 118 SLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPNFSMVKEIDAAHT 177

Query: 375 DGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSG 430
           + ++ + F  +D K +T S D  +++WN+  G+      GH   V S D H +  +I S 
Sbjct: 178 ESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSCDWHPEMGLIASA 237

Query: 431 SADKTVKVWHVESRTCYT--LK-GHTEWVNCVKLHP-KSFSCYSCSDDTTIRMWDIR 483
           S D  VK+W   S  C +  LK  HT  V   +  P K     + S D + R++DIR
Sbjct: 238 SKDNLVKLWDPRSGNCISSILKFKHT--VLKTRFQPTKGNLLMAISKDKSCRVFDIR 292

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/202 (20%), Positives = 72/202 (35%), Gaps = 50/202 (24%)

Query: 385 QKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVE 442
           ++L+  +      +WN  +    +  + H  +V  M        ++SG AD  +K+W   
Sbjct: 106 RRLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPN 165

Query: 443 SRTCYTL-KGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
                 +   HTE +  +          +CSDD  +++W+       RV  GH   V+  
Sbjct: 166 FSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVK-- 223

Query: 502 IPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALD 561
                                       + +  PE G+               + S + D
Sbjct: 224 ----------------------------SCDWHPEMGL---------------IASASKD 240

Query: 562 NTIKLWEVRSGRCIRT--QFGH 581
           N +KLW+ RSG CI +  +F H
Sbjct: 241 NLVKLWDPRSGNCISSILKFKH 262

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIW 607
           +  ++C+ DN +K+W   +G+  R   GH    WD+ + ++      I S S D  +K+W
Sbjct: 190 SKFVTCSDDNILKIWNFSNGKQERVLSGHH---WDVKSCDWHPEMGLIASASKDNLVKLW 246

Query: 608 DLQSGKCM 615
           D +SG C+
Sbjct: 247 DPRSGNCI 254

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSG 612
           ++S   D  IK+W+            H E + D+A  +++ + ++ S D  +KIW+  +G
Sbjct: 150 MISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNG 209

Query: 613 KCMHTFHG 620
           K      G
Sbjct: 210 KQERVLSG 217

>Scas_700.27*
          Length = 433

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 117/293 (39%), Gaps = 40/293 (13%)

Query: 354 TTVAIWDLFTGKLIRRLTGH-SDGVKTLYFDDQKLITGSLDKTIRVWN-------YITGE 405
           TT+ I DL  GKL+  L  H  D  +TL F +  + T      IR+++       ++   
Sbjct: 143 TTIKICDLAKGKLLVTLACHIHDRNETLPFPND-IPTYFQPLNIRLYHAGTWKKIWLLEI 201

Query: 406 CISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTC-YTLKGHTEWVNCVKLHPK 464
            ++TY  +   +  +     +I +   D  V++W + +R    TL GH   +N V   P 
Sbjct: 202 TMATYHEYIQMIFIL--LLNLIATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPV 259

Query: 465 SFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDD 524
                SCS D TIR+WDI     ++V   H   V+           N+  H  +      
Sbjct: 260 DPQIVSCSTDATIRLWDIVAGKSMKVITHHKKSVR-----------NIAFHPTEFSMSSC 308

Query: 525 IASNGTGEDDPENGV------NGQRELDKKMPYPTHLLSCALDN-TIKLWEVRSGRCIRT 577
            A++      PE G+      +G   ++        +L    DN  +  ++ +SG   ++
Sbjct: 309 SANDIRSWKLPEGGLLTNFNSDGLGIINTLSINQDDVLFAGSDNGMLSFYDYKSGHKYQS 368

Query: 578 QF-----GHVEGVWDIAADNF-----RIISGSHDGSIKIWDLQSGKCMHTFHG 620
                  G +E    I    F     R+++G  D SIKIW + S     T  G
Sbjct: 369 MMTKEIPGSLESERGILCSTFDRTGLRLLTGETDKSIKIWSMDSDATPETDPG 421

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 49/101 (48%), Gaps = 4/101 (3%)

Query: 325 CTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLY--F 382
            T+  +  ++  +  L  N  L+ T   D+ V +WD+     +  L GH + +  ++   
Sbjct: 201 ITMATYHEYIQMIFILLLN--LIATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLP 258

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH 423
            D ++++ S D TIR+W+ + G+ +     H  SV ++  H
Sbjct: 259 VDPQIVSCSTDATIRLWDIVAGKSMKVITHHKKSVRNIAFH 299

>Scas_692.29
          Length = 456

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 81/338 (23%), Positives = 139/338 (41%), Gaps = 82/338 (24%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-DDQKLITGSLDKTIRVW---- 399
           + + T SYD  +  W+L +GK+ ++ +GHS  ++ + F  D +L++   D+T+R+W    
Sbjct: 116 KAIITASYDGVIRTWNL-SGKVQKQYSGHSGPIRAVKFISDTRLVSAGNDRTLRLWKTKN 174

Query: 400 ---------------NYITGECISTYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWH--- 440
                          N   G+ ++   GH   V+S+D S+   I+S S D ++ +W    
Sbjct: 175 NDSVVQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTSRILSSSYDNSIGLWSTIY 234

Query: 441 ----------------------VESRTCYTLKGHT----EWVNCVKLHPK-----SFSC- 468
                                    R   TLK  T      ++ ++ H       SF   
Sbjct: 235 KEMTVVDPMEEINNADNKISTAARKRRKLTLKDGTIRRRAPLSLLESHTAPVEQASFDIN 294

Query: 469 -----YSCSDDTTIRMWDIRTNTCL--RVFRGHVGQVQKVIPLTII----DAQNLVTHER 517
                YS S D TI+ WD+ T  C+  +     +  + ++  L ++     A+++  H+ 
Sbjct: 295 DDTVGYSVSQDHTIKTWDLVTARCIDTKTTSYSLLSLTQLPTLNLLACGSSARHITLHDP 354

Query: 518 KPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRT 577
           + G     AS+   +       N    LD        L S + D T+K+W+VRS   + T
Sbjct: 355 RMG-----ASSKVTQHQLIGHKNFVVSLDTCPENEYILCSGSHDGTVKVWDVRSTAPMYT 409

Query: 578 ---QFGHVE-GVWDIA-----ADNFRIISGSHDGSIKI 606
              +  +VE GV D       A+   IISG  D  I+I
Sbjct: 410 ITREDKNVEKGVNDKVFAVRWAEKIGIISGGQDKKIQI 447

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 121/300 (40%), Gaps = 67/300 (22%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWH 440
           D + +IT S D  IR WN ++G+    Y GH+  + +V   S  +++ +G+ D+T+++W 
Sbjct: 114 DKKAIITASYDGVIRTWN-LSGKVQKQYSGHSGPIRAVKFISDTRLVSAGN-DRTLRLWK 171

Query: 441 VES--------------------RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
            ++                    +T   L+GH   V  + +   S    S S D +I +W
Sbjct: 172 TKNNDSVVQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTS-RILSSSYDNSIGLW 230

Query: 481 -------------------DIRTNTCLRVFRGHV---GQVQKVIPLTIIDAQNLVTHERK 518
                              D + +T  R  R      G +++  PL+++++      +  
Sbjct: 231 STIYKEMTVVDPMEEINNADNKISTAARKRRKLTLKDGTIRRRAPLSLLESHTAPVEQAS 290

Query: 519 PGEEDDIASNGTGEDDPEN--GVNGQRELDKKMP---------YPT-HLLSCALDNT-IK 565
               DD       +D       +   R +D K            PT +LL+C      I 
Sbjct: 291 FDINDDTVGYSVSQDHTIKTWDLVTARCIDTKTTSYSLLSLTQLPTLNLLACGSSARHIT 350

Query: 566 LWEVRSGRCIRTQ----FGHVEGV--WDIAADNFRII-SGSHDGSIKIWDLQSGKCMHTF 618
           L + R G   +       GH   V   D   +N  I+ SGSHDG++K+WD++S   M+T 
Sbjct: 351 LHDPRMGASSKVTQHQLIGHKNFVVSLDTCPENEYILCSGSHDGTVKVWDVRSTAPMYTI 410

 Score = 36.2 bits (82), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 416 SVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDT 475
           S + V   KK I++ S D  ++ W++  +      GH+  +  VK    +    S  +D 
Sbjct: 107 SSIDVSQDKKAIITASYDGVIRTWNLSGKVQKQYSGHSGPIRAVKFISDT-RLVSAGNDR 165

Query: 476 TIRMWDIRTN 485
           T+R+W  + N
Sbjct: 166 TLRLWKTKNN 175

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 587 DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
           D++ D   II+ S+DG I+ W+L SGK    + G
Sbjct: 110 DVSQDKKAIITASYDGVIRTWNL-SGKVQKQYSG 142

>Scas_659.9
          Length = 475

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 124/294 (42%), Gaps = 33/294 (11%)

Query: 361 LFTGKLIRRL-TGHSDGVKTL---YFDDQKLITGSLDKTIRVWNYITGECISTYRGH--- 413
           +F    + +L  GH DGV  +   Y +  KL TGS D  ++ WN  T E + +++ H   
Sbjct: 53  MFAKPFVGQLGYGHRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKAHYGL 112

Query: 414 ------TDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFS 467
                 T   +S   ++  ++S S DKTVK+W V S     LK + E +N      K++ 
Sbjct: 113 ITGLCVTPEHLSKQKNENFMLSCSDDKTVKLWSVNSEDYANLK-NAEDINTASGLLKTY- 170

Query: 468 CYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIID--AQNLVTHERKPGEEDDI 525
            YS      I     ++N      +  +    +  PLT +   A N+ T +    E D +
Sbjct: 171 -YSDFAFQGIDHHRSKSNFVTGGAKIQLWDSNRSKPLTDLSWGADNISTVKFNQNETDIL 229

Query: 526 ASNGTGE---------DDPENGVNGQRELDKKMPYPTHLLSCAL---DNTIKLWEVRS-G 572
           AS G+           + P   +      +     P    +  +   D+    +++R+  
Sbjct: 230 ASAGSDNSLVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVVANEDHNAYYYDMRNMS 289

Query: 573 RCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLK 624
           R +     HV  V D+  +     I++GS+D +I+I++   G     +H ++++
Sbjct: 290 RALNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQ 343

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 71/157 (45%), Gaps = 12/157 (7%)

Query: 335 DGVLTLQFNYR---LLFTGSYDTTVAIWDLFTGKLIRRL--TGHSDGVKTLYFDDQKLIT 389
           D + T++FN     +L +   D ++ ++DL T    +++  T  ++ +     +    + 
Sbjct: 214 DNISTVKFNQNETDILASAGSDNSLVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVV 273

Query: 390 GSLDKTIRVWNYIT-GECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVW---HVES 443
            + D     ++       ++ ++ H  +VM VD       IV+GS DKT++++   H  S
Sbjct: 274 ANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHS 333

Query: 444 RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
           R  Y  K   + V  VK    +    S SDD  +R+W
Sbjct: 334 REIYHTK-RMQHVFQVKFSMDAKYIVSGSDDGNVRLW 369

 Score = 29.6 bits (65), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 579 FGHVEGVWDIAADNFR----IISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNP 634
           +GH +GV+ + A N++    + +GS DG +K W++ + + + +F      G        P
Sbjct: 64  YGHRDGVY-VIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKAH--YGLITGLCVTP 120

Query: 635 DHDERTKSAPVACVCIGD 652
           +H  + K+      C  D
Sbjct: 121 EHLSKQKNENFMLSCSDD 138

>KLLA0F16038g complement(1487475..1490063) weakly similar to
           ca|CA1657|IPF16022 Candida albicans unknown function,
           hypothetical start
          Length = 862

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%), Gaps = 10/105 (9%)

Query: 338 LTLQFNYRLLFTGSYDTTVAIWDLF---TGKLIRRLTGHSDGVKTLYF-----DDQKLIT 389
           L LQ     +     D T+ I+D     T +L+R L    DG+   +F      DQ L +
Sbjct: 607 LRLQLTNSDIIVSRSDKTMQIFDKTSNSTPRLLRLLDDQGDGILVNHFYVNADSDQILCS 666

Query: 390 GSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSA 432
            SLDKTIR ++Y TG+C++ Y  H D V  M+  ++K + V+G+ 
Sbjct: 667 SSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNG 711

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 101/239 (42%), Gaps = 29/239 (12%)

Query: 425 KIIVSGSADKTVKVWHV---ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW- 480
           KI+++ S D+T+    +   E   C T+K +    N ++L       Y+ S D T+  + 
Sbjct: 527 KIVITISRDRTMNFIELRAGEWNICETVKDNKG--NIIQLEMCDNKLYTISSDRTVSCYR 584

Query: 481 -DIRTNTCLRVFRGHVGQVQKV-IPLTIIDAQNLVTHERKPGEEDDIASNGTGE-----D 533
            DI  NT L V +  +  V+   + L + ++  +V+   K  +  D  SN T       D
Sbjct: 585 IDIVDNT-LNVSKETILSVKNSPLRLQLTNSDIIVSRSDKTMQIFDKTSNSTPRLLRLLD 643

Query: 534 DPENG-------VNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVW 586
           D  +G       VN   +          L S +LD TI+ +   +G+C+   + H + V 
Sbjct: 644 DQGDGILVNHFYVNADSD--------QILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVV 695

Query: 587 DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHDERTKSAPV 645
            +     + ++ + +G +  W+++  +      G+ L  S   +S N +      S PV
Sbjct: 696 GMTTVANKFVTVTGNGCLFSWEIRPEEEADEISGKLLDLSSSYSSKNTNTIVSAPSTPV 754

>Scas_585.8
          Length = 460

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 74/161 (45%), Gaps = 8/161 (4%)

Query: 331 KGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQK 386
           + H   V  +Q+++    + +G  D  + IW      +      H++ ++ + F  +D K
Sbjct: 128 QAHDSAVSCIQYSHAGDWMCSGDADGGIKIWQPNFNMVKEFENAHTECIRDISFSNNDSK 187

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWHVESR 444
            +T S D  +++WN+  G+   T  GH   + S D H +  +IVS S D  VK+W   S 
Sbjct: 188 FVTCSDDNVLKIWNFSNGQVERTLSGHHWDIKSCDWHPEMGLIVSASKDNLVKLWDPRSG 247

Query: 445 TCY-TLKGHTEWVNCVKLHPKSFSCYSC-SDDTTIRMWDIR 483
            C  T+      V   +  P   +  +  S D + R++DIR
Sbjct: 248 QCISTIIKFKHTVLKTRFQPTRGNLLAAISKDKSCRVFDIR 288

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 8/68 (11%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIWDL 609
            ++C+ DN +K+W   +G+  RT  GH    WDI + ++      I+S S D  +K+WD 
Sbjct: 188 FVTCSDDNVLKIWNFSNGQVERTLSGHH---WDIKSCDWHPEMGLIVSASKDNLVKLWDP 244

Query: 610 QSGKCMHT 617
           +SG+C+ T
Sbjct: 245 RSGQCIST 252

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 68/163 (41%), Gaps = 10/163 (6%)

Query: 333 HMDGVLTLQFNYRLLFTGSYDTTVAIWD--LFTGKLIRRLTGHSDGVKTLYFDDQK--LI 388
           H+   +T     R L   +Y+   ++W+   F   L++    H   V  + +      + 
Sbjct: 91  HVIPAITWTPEGRRLVVATYNGEFSLWNGTSFNESLMQ---AHDSAVSCIQYSHAGDWMC 147

Query: 389 TGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVES-RT 445
           +G  D  I++W             HT+ +  +S  ++    V+ S D  +K+W+  + + 
Sbjct: 148 SGDADGGIKIWQPNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQV 207

Query: 446 CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCL 488
             TL GH   +     HP+     S S D  +++WD R+  C+
Sbjct: 208 ERTLSGHHWDIKSCDWHPEMGLIVSASKDNLVKLWDPRSGQCI 250

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 75/204 (36%), Gaps = 51/204 (25%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-SHK-KIIVSGSADKTVKVWH 440
           + ++L+  + +    +WN  T    S  + H  +V  +  SH    + SG AD  +K+W 
Sbjct: 101 EGRRLVVATYNGEFSLWNG-TSFNESLMQAHDSAVSCIQYSHAGDWMCSGDADGGIKIWQ 159

Query: 441 VESRTCYTLK-GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
                    +  HTE +  +          +CSDD  +++W+       R   GH   ++
Sbjct: 160 PNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTLSGHHWDIK 219

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCA 559
                                           +  PE G+               ++S +
Sbjct: 220 SC------------------------------DWHPEMGL---------------IVSAS 234

Query: 560 LDNTIKLWEVRSGRCIRT--QFGH 581
            DN +KLW+ RSG+CI T  +F H
Sbjct: 235 KDNLVKLWDPRSGQCISTIIKFKH 258

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 561 DNTIKLWEVRSGRCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKIWDLQSGKCMHTF 618
           D  IK+W+         +  H E + DI+  N   + ++ S D  +KIW+  +G+   T 
Sbjct: 152 DGGIKIWQPNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTL 211

Query: 619 HG 620
            G
Sbjct: 212 SG 213

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 80/173 (46%), Gaps = 18/173 (10%)

Query: 321 RKGLCTIQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVK 378
           ++    IQE  GH   V +L F  +  L+ T   D    IWD+ +GK I  L GHS  + 
Sbjct: 294 KQAPILIQE--GHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSKPIY 351

Query: 379 TLYFDDQ--KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK---IIVSGSAD 433
           ++ +     +L +GS D TI+VW+      + T   H   V  V  +K+    +VS   D
Sbjct: 352 SVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNKQNGGYLVSSGYD 411

Query: 434 KTVKVWH----VESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
           K V +++    ++ R   +L+GH + V  + +       YS   D ++  W +
Sbjct: 412 KKVNIFNDGNWIKER---SLEGHLDKVMSIDIVGPDI--YSAGWDRSVNKWGV 459

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 69/170 (40%), Gaps = 25/170 (14%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLI------------TGSLDK 394
           +F  ++D  + I+D          +G    VK LY +D +              + S DK
Sbjct: 236 IFVCTHDGRIVIYD----------SGDETTVKILYKNDARFAQVRCHPCNSFIGSTSFDK 285

Query: 395 TIRVWNYITGECISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVES-RTCYTLKG 451
           T  + + +    I    GH+  V S+  H    ++ +   D    +W + S +   +L+G
Sbjct: 286 TWILIDTVKQAPILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQG 345

Query: 452 HTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
           H++ +  V      +   S S D TI++WDIR    +     H   V +V
Sbjct: 346 HSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQV 395

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 557 SCALDNTIKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQSGKC 614
           +  LD    +W++RSG+ I +  GH + ++  D + + +++ SGS DG+IK+WD++    
Sbjct: 322 TAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGN 381

Query: 615 MHTF 618
           + T 
Sbjct: 382 VETI 385

>Kwal_55.21450
          Length = 503

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 80/177 (45%), Gaps = 16/177 (9%)

Query: 327 IQEFKGHMDG---VLTLQFNYRLLFTGSYDTTVAIWDLFTGK-LIRRLTGHSDGVKTLYF 382
           I  + GH +G   +L L  +  L  +   D  V IWDL+  + L+R   GHS  V+ + F
Sbjct: 203 IHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGISF 262

Query: 383 DDQ--KLITGSLDKTIRVWNYITGECISTYRGH--TDSVMSVDSHKKIIVSGSADKTVKV 438
           + +  + ++ S D+ I++W+  TG+    Y      +      S+    + G ++  ++ 
Sbjct: 263 NSEGSEFLSVSFDQQIKIWDTETGKVRHQYSYSCIPNCAEFRPSNSNEFIVGLSNSEIR- 321

Query: 439 WHVESRTCY------TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLR 489
            H + RT +          H   +  +K  P      S S+D ++R+W+ + N  ++
Sbjct: 322 -HYDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWENQINIPIK 377

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 4/74 (5%)

Query: 549 MPYPTHL-LSCALDNTIKLWEV-RSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSI 604
           +P   HL LS   DN +K+W++ R    +R   GH + V  I+  ++    +S S D  I
Sbjct: 219 LPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGISFNSEGSEFLSVSFDQQI 278

Query: 605 KIWDLQSGKCMHTF 618
           KIWD ++GK  H +
Sbjct: 279 KIWDTETGKVRHQY 292

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 401 YITGECISTYRGH---TDSVMSVDSHKKIIVSGSADKTVKVWHV--ESRTCYTLKGHTEW 455
           Y+  + I TY GH   T+S++ +     + +S   D  VK+W +  +       +GH++ 
Sbjct: 197 YLPKKLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKA 256

Query: 456 VNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
           V  +  + +     S S D  I++WD  T
Sbjct: 257 VRGISFNSEGSEFLSVSFDQQIKIWDTET 285

>Kwal_33.15136
          Length = 473

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 72/317 (22%), Positives = 135/317 (42%), Gaps = 52/317 (16%)

Query: 332 GHMDGVLTLQFNYRLL---FTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKL- 387
           GH DGV T+  NY +L    T S D  V  W++ T + +     H   +  L    Q L 
Sbjct: 65  GHRDGVYTIAKNYHVLNKLATASADGVVKYWNMSTREEVCSFKAHYGLIHGLCVTPQHLS 124

Query: 388 --------ITGSLDKTIRVWNYITGE----------------CISTYRGHTDSVMSVDSH 423
                   ++   D+T+++W+  T +                 I T+ G   + + +D H
Sbjct: 125 QNKNENYMLSCGDDRTVKLWSVNTDDFSSERGDEEVIKSGNGLIKTFHGE-HAFLGIDHH 183

Query: 424 KKI--IVSGSADKTVKVW-HVESRTCYTLKGHTEWVNCVKLHPKSFSCY-SCSDDTTIRM 479
           +     V+G A+  + +W    SR    L    + V+ VK +      + S   D ++ +
Sbjct: 184 RSNSNFVTGGAE--INLWDSTRSRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVL 241

Query: 480 WDIRTNTCLRVFRGHVGQVQKVIPLTI----IDAQNLV-THERKPGEEDDIASNGTGEDD 534
           +D+RTN+  + F      VQK+    +    ++A N V  +E       D+ +       
Sbjct: 242 YDLRTNSPTQKF------VQKMRTNALCWNPMEAYNFVVANEDHNAYYYDMRNLSRALHV 295

Query: 535 PENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRT----QFGHVEGVWDIAA 590
            ++ V+   ++D   P    +++ + D TI++++V+ G         +  HV  V     
Sbjct: 296 FKDHVSAVMDVDFS-PTGDEIVTGSYDKTIRIYQVKHGHSREIYHTKRMQHVFQV-KYTM 353

Query: 591 DNFRIISGSHDGSIKIW 607
           D+  I+SGS DG++++W
Sbjct: 354 DSRYIVSGSDDGNVRMW 370

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK-----KIIVSGSADKTVKVWH 440
           +++TGS DKTIR++    G     Y  HT  +  V   K     + IVSGS D  V++W 
Sbjct: 314 EIVTGSYDKTIRIYQVKHGHSREIY--HTKRMQHVFQVKYTMDSRYIVSGSDDGNVRMWR 371

Query: 441 VES 443
            ++
Sbjct: 372 AKA 374

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 4/77 (5%)

Query: 409 TYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKS-- 465
           ++ GH   ++ +D S    +++GS DKTVK+WH + +       H ++V CVK HP    
Sbjct: 391 SFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDR 450

Query: 466 FSCYSCSDDTTIRMWDI 482
           F    C D    R+W I
Sbjct: 451 FFISGCLDHKA-RLWSI 466

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query: 328 QEFKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF---D 383
           + F GH   +L + ++    + TGS D TV +W     +L++    H D V  + F   D
Sbjct: 390 RSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPND 448

Query: 384 DQKLITGSLDKTIRVWNYITGEC 406
           D+  I+G LD   R+W+ +  E 
Sbjct: 449 DRFFISGCLDHKARLWSILDDEV 471

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 368 RRLTGHSDGVKTL-YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK-- 424
           R   GH+  +  + +  +  ++TGS+DKT+++W+    + +  +  H D V  V  H   
Sbjct: 390 RSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPND 448

Query: 425 -KIIVSGSADKTVKVWHV 441
            +  +SG  D   ++W +
Sbjct: 449 DRFFISGCLDHKARLWSI 466

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 122/301 (40%), Gaps = 30/301 (9%)

Query: 354 TTVAIWDLFTGKLIRRL-TGHSDGVKTL---YFDDQKLITGSLDKTIRVWNYITGECIST 409
           T   +  +F    + +L  GH DG   L   Y    KL +GS D  ++ WN  T E + +
Sbjct: 46  TATKLERMFAKPFVGQLGYGHRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCS 105

Query: 410 YRGH---------TDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVK 460
           +R H         T + +S       ++S   DKT+K+W V S    ++K  T+ V+   
Sbjct: 106 FRAHYGLVTGLCVTPTHLSPTKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKIVSDTG 165

Query: 461 LHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIID--AQNLVTHERK 518
                 + Y      +I       N      +  +  V +  PL+ +     N+      
Sbjct: 166 DGALLKTFYGEHAFQSIDHHRRNPNFVTGGAQIQLWDVNRKKPLSNLSWGVDNVSFVRFN 225

Query: 519 PGEEDDIASNGTGE---------DDPENGVNGQRELDKKMPYPTHLLSCAL---DNTIKL 566
             EED +AS G+           + P   V  +   +     P    + A+   D+    
Sbjct: 226 QNEEDILASTGSDNSIVLYDLRTNSPTQKVVQRMRTNALCWNPMEPFNFAIANEDHNAYY 285

Query: 567 WEVRS-GRCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKL 623
           +++R+  R +     HV  V D+  +     I++GS+D +I+I++L+ G     +H +++
Sbjct: 286 YDMRNMSRALHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRM 345

Query: 624 K 624
           +
Sbjct: 346 Q 346

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 7/64 (10%)

Query: 385 QKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK-----KIIVSGSADKTVKVW 439
           ++++TGS DKTIR++N   G     Y  HT  +  V   K     K IVSGS D  V++W
Sbjct: 315 EEIVTGSYDKTIRIFNLKHGHSREVY--HTKRMQHVFQVKFTMDSKYIVSGSDDGNVRLW 372

Query: 440 HVES 443
             ++
Sbjct: 373 RAKA 376

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 9/77 (11%)

Query: 330 FKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLY-----F 382
           FK H+  V+ + F+     + TGSYD T+ I++L  G    R   H+  ++ ++      
Sbjct: 298 FKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGH--SREVYHTKRMQHVFQVKFTM 355

Query: 383 DDQKLITGSLDKTIRVW 399
           D + +++GS D  +R+W
Sbjct: 356 DSKYIVSGSDDGNVRLW 372

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 52/97 (53%), Gaps = 4/97 (4%)

Query: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVK-TLYFDDQKLITG-SLDKTIRVWNYITGEC 406
            G+    V +W+L TG +++RL GH   +   +  DD +L+   S D++IRVW+  TGE 
Sbjct: 156 AGTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQ 215

Query: 407 ISTYRGHTDSVMSVDSHKKI--IVSGSADKTVKVWHV 441
           +    GHT  +  +   +    +VS S D T +VW V
Sbjct: 216 VGIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAV 252

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 70/171 (40%), Gaps = 17/171 (9%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVM--SVDSHKKIIVSGSADKTVKVWH 440
           D   +  G++   + VW   TG  +    GH  S+    V    +++ S S D++++VW 
Sbjct: 150 DAVYVCAGTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWS 209

Query: 441 VESRTCYTLK-GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
           +E+     +  GHT  +  ++    +    S S+D T R+W +      R+    V  V 
Sbjct: 210 LETGEQVGIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAVGAE---RMQEEAVYDVH 266

Query: 500 KVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMP 550
           +   +  +D Q           EDD+ +   G D     V+  R   ++ P
Sbjct: 267 QTKSVWAVDVQ-----------EDDMVAVTAGNDGRLRLVDLTRPGSRERP 306

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%), Gaps = 6/55 (10%)

Query: 557 SCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI----AADNFRIISGSHDGSIKIW 607
           SC+ D +I++W + +G  +   +GH   +WD+     AD  +++S S D + ++W
Sbjct: 198 SCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRFLRVAD--KLVSVSEDCTCRVW 250

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 57/115 (49%), Gaps = 9/115 (7%)

Query: 326 TIQEFKGHMDGVL--TLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF- 382
            +Q  +GH   +    +  + RL+ + S D ++ +W L TG+ +    GH+  +  L F 
Sbjct: 173 VVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRFL 232

Query: 383 -DDQKLITGSLDKTIRVWNYITGECI---STYRGH-TDSVMSVDSHKKIIVSGSA 432
               KL++ S D T RVW  +  E +   + Y  H T SV +VD  +  +V+ +A
Sbjct: 233 RVADKLVSVSEDCTCRVWA-VGAERMQEEAVYDVHQTKSVWAVDVQEDDMVAVTA 286

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 65/143 (45%), Gaps = 25/143 (17%)

Query: 330 FKGHMDGVLTLQF---NYRLLFTGSYDTTVAIWDLFTG----------------KLIRRL 370
           F+GH   VL   F   N  ++ +GS D  + IW++                   K +R L
Sbjct: 89  FRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRML 148

Query: 371 TGHSDGVKTLYF---DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKK 425
           +GHS  V  L F    +  L + SLD T+++W+ I+ E +     H D V  MS     K
Sbjct: 149 SGHSRKVGHLLFHPLAENILASSSLDYTVKIWD-ISQEEVKFTLKHPDMVTSMSFSYDGK 207

Query: 426 IIVSGSADKTVKVWHVESRTCYT 448
            +V+ S DK ++VW V +    +
Sbjct: 208 HLVTVSRDKKLRVWDVRAEKIVS 230

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 74/184 (40%), Gaps = 34/184 (18%)

Query: 333 HMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF----DDQK 386
           H D V ++ F+Y  + L T S D  + +WD+   K++     HS G K        D  K
Sbjct: 193 HPDMVTSMSFSYDGKHLVTVSRDKKLRVWDVRAEKIVSEGPAHS-GAKNQRVVWLGDTDK 251

Query: 387 LITGSL----DKTIRVW---NYITGECISTYRGHTDSVMSV----DSHKKIIVSGSADKT 435
           + T       D+ I VW   N   G     Y     S + +    DS++ + V+G  D  
Sbjct: 252 VATTGFSRLSDRQIGVWDAFNLEKGNLGGFYNVDQSSGILMPFYDDSNRILYVAGKGDGN 311

Query: 436 VKVWHVESRTCYTLKGH--TEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
           ++ +  ++   Y L  +  TE      + PK             R  +++ N  L+ ++ 
Sbjct: 312 IRYFEFQNDELYELSEYQSTEPQRGFAVAPK-------------RSVNVKENEVLKAYKA 358

Query: 494 HVGQ 497
            VG+
Sbjct: 359 -VGE 361

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 68/170 (40%), Gaps = 32/170 (18%)

Query: 449 LKGHTEWVNCVKLHP-KSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTII 507
            +GHT  V      P       S SDD  I +W+I  +  L  +    G  + + P+ ++
Sbjct: 89  FRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRML 148

Query: 508 DAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLW 567
                  H RK G    +  +   E+                     L S +LD T+K+W
Sbjct: 149 SG-----HSRKVGH---LLFHPLAEN--------------------ILASSSLDYTVKIW 180

Query: 568 EVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGKCM 615
           ++ S   ++    H + V     + D   +++ S D  +++WD+++ K +
Sbjct: 181 DI-SQEEVKFTLKHPDMVTSMSFSYDGKHLVTVSRDKKLRVWDVRAEKIV 229

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 47/91 (51%), Gaps = 9/91 (9%)

Query: 530 TGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA 589
           TG + P   V   +E D        L SC+ D++  +W   +G  + T  GH   +W I 
Sbjct: 7   TGHERPLTQVKYNKEGDL-------LFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSID 59

Query: 590 ADNFR--IISGSHDGSIKIWDLQSGKCMHTF 618
            D F    ++GS D SIK+WD+ +G+C+ T+
Sbjct: 60  VDCFTKYCVTGSADYSIKLWDVSNGQCVATW 90

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 369 RLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMS--VDSHK 424
           +LTGH   +  + ++ +   L + S D +  VW  + GE + T  GHT ++ S  VD   
Sbjct: 5   KLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFT 64

Query: 425 KIIVSGSADKTVKVWHVESRTC 446
           K  V+GSAD ++K+W V +  C
Sbjct: 65  KYCVTGSADYSIKLWDVSNGQC 86

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 49/84 (58%), Gaps = 4/84 (4%)

Query: 332 GHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKL 387
           GH   +  +++N    LLF+ S D++ ++W    G+ +  L GH+  + ++  D   +  
Sbjct: 8   GHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYC 67

Query: 388 ITGSLDKTIRVWNYITGECISTYR 411
           +TGS D +I++W+   G+C++T++
Sbjct: 68  VTGSADYSIKLWDVSNGQCVATWK 91

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 3/87 (3%)

Query: 412 GHTDSVMSVDSHKK--IIVSGSADKTVKVWH-VESRTCYTLKGHTEWVNCVKLHPKSFSC 468
           GH   +  V  +K+  ++ S S D +  VW+ +      TL GHT  +  + +   +  C
Sbjct: 8   GHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYC 67

Query: 469 YSCSDDTTIRMWDIRTNTCLRVFRGHV 495
            + S D +I++WD+    C+  ++  V
Sbjct: 68  VTGSADYSIKLWDVSNGQCVATWKSPV 94

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 74/137 (54%), Gaps = 12/137 (8%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF------DDQKLITGSLDKTIRVWN 400
           + +G  D TV ++D+ +G+  +++  H+D VK+L F      + + L+TGS DKTI+ W+
Sbjct: 94  IASGGCDNTVKLYDVASGQS-QQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWD 152

Query: 401 YITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVK 460
               + I+T     + V ++D+ ++++V G+A++ + + ++ + T       +     +K
Sbjct: 153 TRQPQPITTI-AMPERVYTMDNKQQLLVVGTAERHIAIINLANPTTIFKSSQSP----LK 207

Query: 461 LHPKSFSCYSCSDDTTI 477
              +  +CY+  D   I
Sbjct: 208 WQTRVVACYNEGDGYAI 224

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 74/202 (36%), Gaps = 33/202 (16%)

Query: 328 QEFKGHMDGVLTLQF------NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLY 381
           Q+   H D V +L+F      N   L TGS+D T+  WD    + I  +    + V T+ 
Sbjct: 114 QQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWDTRQPQPITTI-AMPERVYTMD 172

Query: 382 FDDQKLITGSLDKTIRVWNYITGECI-----STYRGHTDSVMSVDSHKKIIVSGSADKTV 436
              Q L+ G+ ++ I + N      I     S  +  T  V   +      + GS +   
Sbjct: 173 NKQQLLVVGTAERHIAIINLANPTTIFKSSQSPLKWQTRVVACYNEGDGYAI-GSVEGRC 231

Query: 437 KVWHV----ESRTCYTLKGHTEW----------------VNCVKLHPKSFSCYSCSDDTT 476
            + +V    + ++ ++ K H +                 VN +  HP   +  +   D +
Sbjct: 232 AIKYVDDEAQKKSGFSFKCHRQTQPNRAAGSSSQSLVYPVNSIAFHPIYGTFVTAGGDGS 291

Query: 477 IRMWDIRTNTCLRVFRGHVGQV 498
              WD      L+ F    G +
Sbjct: 292 FHFWDKNQRHRLKGFPSMQGSI 313

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 104/254 (40%), Gaps = 43/254 (16%)

Query: 346 LLFTGSYDTTVAIWDLFTG-------KLIRRLTGHSDGVKTLYF-----DDQKLITGSLD 393
           +L  G  +  V I+ L +        +   +L GH D +K+L F      D  L +GS D
Sbjct: 166 ILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVFRETVPGDYLLASGSQD 225

Query: 394 KTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHT 453
           + IR+W   T E I T     +  +++ S+K      SAD      HV       + GH 
Sbjct: 226 RYIRLWRIRTNEKIDTSE-EDEKKLTLLSNKIYKFDISADV-----HVAINFEALIMGHD 279

Query: 454 EWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQN-- 511
           +W++ ++ H       + + DT + +W+  T + + +    +G++      T   +    
Sbjct: 280 DWISSLQWHKTKLQLLTSTADTAVMVWEPDTISGIWICSSRLGELSSKGASTATGSSGGF 339

Query: 512 ----LVTHERKPGEEDDIASNG--------TGED----DPENGVNGQRELDKKMPYP--- 552
                 TH+ K    D I +NG        T  D    D E G+ G  +    + +    
Sbjct: 340 WSCIWFTHDGK----DVILTNGKTGSWRIWTSTDGLLWDQELGITGATKSVTDVAWSIDG 395

Query: 553 THLLSCALDNTIKL 566
            +LLS +LD T +L
Sbjct: 396 NYLLSTSLDQTTRL 409

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 69/203 (33%), Gaps = 72/203 (35%)

Query: 355 TVAIW---DLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYI------- 402
           T+A+W   D     + + L GH+  V  + F      +++ S D  +RVWN+        
Sbjct: 34  TIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREGHM 93

Query: 403 -TGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVW---------------------- 439
              ECI   + H  ++      K ++V G AD ++ VW                      
Sbjct: 94  DEVECIQVIKHHKHTITVFAVLKNLLVVGCADGSISVWSFIEDQYVLQEEFSVQKGVFPL 153

Query: 440 ----HVESRTCYTL------------------------------KGHTEWVNCVKLH--- 462
               H   +T + L                              +GH +W+  +      
Sbjct: 154 CLSMHEIEKTQFILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVFRETV 213

Query: 463 PKSFSCYSCSDDTTIRMWDIRTN 485
           P  +   S S D  IR+W IRTN
Sbjct: 214 PGDYLLASGSQDRYIRLWRIRTN 236

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 9/77 (11%)

Query: 427 IVSGSADKTVKVWHVESRTCY----TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
           +V+  A KT+ +W     + +    TLKGHT  V CV+    +    S S+D  +R+W+ 
Sbjct: 26  VVAYGAGKTIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNF 85

Query: 483 RTNTCLRVFRGHVGQVQ 499
                 ++  GH+ +V+
Sbjct: 86  P-----KLREGHMDEVE 97

>Scas_721.128
          Length = 851

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 91/231 (39%), Gaps = 45/231 (19%)

Query: 407 ISTYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKS 465
           +  Y+ H+  ++ +D S    +++ S DK V +WH +  T      H ++V  V+ HPK 
Sbjct: 260 VRIYKEHSHDILDLDWSKNNFLLTASMDKLVSLWHPDRETSLKSFPHPDFVTSVRFHPKD 319

Query: 466 --FSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEED 523
             F    C D    RMW I  N  +  F                D Q+L+T         
Sbjct: 320 DRFFVSGCLDH-KCRMWSILENKVVYEF----------------DCQDLITAIS------ 356

Query: 524 DIASNGTGEDDPENGVNGQ----RELDKKMPYPTHLLSCAL------DNTIKLWEVRSGR 573
              S G GE       NG        + K  Y  H+L   +      D++ K      G+
Sbjct: 357 --ISPGVGEFTIIGTFNGYITILSTFELKPLYTFHVLDKHMQGNSGNDSSFKNL---LGQ 411

Query: 574 CIRTQFG-HVEGV---WDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
            ++   G  V G+    +   D+ +++  S D  I+I+DL+  K +  F G
Sbjct: 412 NLKNHHGPRVTGLQLFLEKETDDLKLLVSSTDSRIRIFDLEKNKLIEVFKG 462

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 80/205 (39%), Gaps = 40/205 (19%)

Query: 327 IQEFKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--- 382
           ++ +K H   +L L ++    L T S D  V++W       ++    H D V ++ F   
Sbjct: 260 VRIYKEHSHDILDLDWSKNNFLLTASMDKLVSLWHPDRETSLKSFP-HPDFVTSVRFHPK 318

Query: 383 DDQKLITGSLDKTIRVWNYI----------------------TGE--CISTYRGHTDSVM 418
           DD+  ++G LD   R+W+ +                       GE   I T+ G+  +++
Sbjct: 319 DDRFFVSGCLDHKCRMWSILENKVVYEFDCQDLITAISISPGVGEFTIIGTFNGYI-TIL 377

Query: 419 SVDSHKKIIVSGSADKTVKVWHVESRTCYTLKG------HTEWVNCVKLHPKS----FSC 468
           S    K +      DK ++       +   L G      H   V  ++L  +        
Sbjct: 378 STFELKPLYTFHVLDKHMQGNSGNDSSFKNLLGQNLKNHHGPRVTGLQLFLEKETDDLKL 437

Query: 469 YSCSDDTTIRMWDIRTNTCLRVFRG 493
              S D+ IR++D+  N  + VF+G
Sbjct: 438 LVSSTDSRIRIFDLEKNKLIEVFKG 462

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 78/194 (40%), Gaps = 23/194 (11%)

Query: 330 FKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF---DDQ 385
           F  H+  +L   ++    L T S D TV +W +     ++    H D V  + F   DD+
Sbjct: 210 FGEHLQDILDCDWSKNSFLLTASMDKTVKLWHINRTTSLKTFV-HPDFVTCVRFHPHDDR 268

Query: 386 KLITGSLDKTIRVWNYITGECISTYR-GHTDSVMSVDSHKKIIVSGSADKTVKVWHVES- 443
              +G LD T+R W+ + GE    +  G     + V      ++ G+ +  V V H    
Sbjct: 269 FFFSGCLDHTVRTWSILEGEVAEAFNCGDLIMALDVSPDGNWLLIGTFNGYVHVLHTNGL 328

Query: 444 ---RTCYTLKGHTEWVNCVKLHPKS-------------FSCYSCSDDTTIRMWDIRTNTC 487
               + + L+   E  N  +  PK                    S+D+ +R++D+ T   
Sbjct: 329 KLLHSFHLLQKPNETENRPRHGPKITGVEFIRHKAYPWLGLLITSNDSRVRLFDMSTTRL 388

Query: 488 LRVFRGHVGQVQKV 501
           L +FRG   +  ++
Sbjct: 389 LEIFRGFSNESSRI 402

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI---AADNFRIISGSHDGSIKIWDLQS 611
           LL+ ++D T+KLW +     ++T F H + V  +     D+    SG  D +++ W +  
Sbjct: 228 LLTASMDKTVKLWHINRTTSLKT-FVHPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILE 286

Query: 612 GKCMHTFH-GRKLKGSDVNTSSN 633
           G+    F+ G  +   DV+   N
Sbjct: 287 GEVAEAFNCGDLIMALDVSPDGN 309

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 78/196 (39%), Gaps = 18/196 (9%)

Query: 427 IVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
           I +G  +  +++W+ E +       H   +  +  +  +    S   D    +WD+ +  
Sbjct: 237 IATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGV 296

Query: 487 CLRVFRGHVGQVQKV----------IPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPE 536
            L+ F     Q+             +    +D    V     PG   ++      +  P 
Sbjct: 297 VLQHFESKANQINGNNNNNSNQMFGVDTVWVDTDKFVI----PGPGGNLLVYTMSDSRPI 352

Query: 537 NGVNGQRELDKKMPYPTH---LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA-ADN 592
             + G R    ++ + +    L S A DNTI++W   +G  I   +GH + +  +   +N
Sbjct: 353 GKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN 412

Query: 593 FRIISGSHDGSIKIWD 608
             +IS S DGS+K+WD
Sbjct: 413 DMLISASMDGSVKLWD 428

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 47/91 (51%), Gaps = 9/91 (9%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFD 383
           I +  GH   +  L+FN   +LL + + D T+ +W    G  I    GH+  + +L + +
Sbjct: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN 411

Query: 384 DQKLITGSLDKTIRVWN------YITGECIS 408
           +  LI+ S+D ++++W+       ITG  I+
Sbjct: 412 NDMLISASMDGSVKLWDCGKKLQEITGNLIA 442

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 40/90 (44%), Gaps = 3/90 (3%)

Query: 425 KIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
           K ++ G     +     +SR    L GH   ++ ++ + ++    S +DD TIR+W    
Sbjct: 331 KFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGN 390

Query: 485 NTCLRVFRGHVGQVQKVIPLTIIDAQNLVT 514
              +  F GH    Q ++ L  ++   L++
Sbjct: 391 GNSIHCFYGH---TQTIVSLKWVNNDMLIS 417

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 547 KKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWD--IAADNFRIISGSHDGSI 604
           K  P    LLS + D  +K+W +  G   RT  GH  G+ D  I      ++S S DGS+
Sbjct: 148 KIFPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSV 207

Query: 605 KIWDLQSGKCMHTF 618
           ++W+L SGK +  F
Sbjct: 208 RLWELGSGKTISKF 221

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 7/96 (7%)

Query: 332 GHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVK-TLYFD-DQKL 387
            H+  V T++   +  +L +GS D  + +W L  G   R L GHS G+  T+  +  + +
Sbjct: 139 AHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNV 198

Query: 388 ITGSLDKTIRVWNYITGECISTY---RGHTDSVMSV 420
           ++ SLD ++R+W   +G+ IS +      TD V S+
Sbjct: 199 LSSSLDGSVRLWELGSGKTISKFCRKENTTDGVTSM 234

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 51/109 (46%), Gaps = 3/109 (2%)

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWHVE- 442
           K++ G     I V+++     +S    H   V +V       +++SGS D  +KVW +E 
Sbjct: 113 KIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLED 172

Query: 443 SRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVF 491
                TLKGH+  +    +  +  +  S S D ++R+W++ +   +  F
Sbjct: 173 GSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRLWELGSGKTISKF 221

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 60/160 (37%), Gaps = 46/160 (28%)

Query: 417 VMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKG-HTEWVNCVKLHPKSFSCYSCSDDT 475
           ++S D+    IV G +   + V+  E  +  +L G H   V  VK+ P +    S S D 
Sbjct: 104 LISCDASTDKIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDM 163

Query: 476 TIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDP 535
            +++W +   +  R  +GH   +   I +                               
Sbjct: 164 QLKVWSLEDGSNPRTLKGHSAGITDTIII------------------------------- 192

Query: 536 ENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCI 575
           E G N              +LS +LD +++LWE+ SG+ I
Sbjct: 193 ERGRN--------------VLSSSLDGSVRLWELGSGKTI 218

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 85/200 (42%), Gaps = 42/200 (21%)

Query: 330 FKGHMDGVLTL---QFNYRLLFTGSYDTTVAIWDLFTG----------------KLIRRL 370
           F+GH   VL      FN   + +GS D+ + IWD+                   K ++ L
Sbjct: 77  FRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFL 136

Query: 371 TGHSDGVKTLYF---DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKK 425
           TGH+  V  + +    +  L + S D T+++WN  TG+ + T + H D V  MS      
Sbjct: 137 TGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLK-HPDMVTSMSFSYDGN 195

Query: 426 IIVSGSADKTVKVWHV-ESRTCYTLKGHTE-------WV-NCVKLHPKSFSCYSCSDDTT 476
            + + + DK ++VW++ E +       HT        W+ N  +L    FS  S   D  
Sbjct: 196 YLATVARDKKLRVWNIREEKIVSEGPAHTGAKNQRVVWLGNSDRLATTGFSKLS---DRQ 252

Query: 477 IRMWDIRTNTCLRVFRGHVG 496
           I +WD        + +G +G
Sbjct: 253 IGIWD-----AFNIEKGDLG 267

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 136/316 (43%), Gaps = 52/316 (16%)

Query: 332 GHMDGVLTLQFNYRL---LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-----YFD 383
           GH DGV T+  NY +   L T S D  +  W++ T + +     H   V  L     Y  
Sbjct: 65  GHRDGVYTIAKNYNVLNKLATASGDGVIKYWNMSTREELSSFKAHYGMVTGLCVTPSYLS 124

Query: 384 DQK---LITGSLDKTIRVWNYITGE---------------CISTYRGHTDSVMSVDSH-- 423
            Q+   +++   DKT+++W+  + +                I T+ G   +  S+D H  
Sbjct: 125 PQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGE-HAFQSLDHHRQ 183

Query: 424 KKIIVSGSADKTVKVWHV-ESRTCYTLKGHTEWVNCVKLHPKSFSCY-SCSDDTTIRMWD 481
           K   V+G A   +++W    S+    L    + +N V+ +        S   D ++ ++D
Sbjct: 184 KSNFVTGGAQ--IELWDTNRSKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVVLYD 241

Query: 482 IRTNTCLRVFRGHVGQVQKVIPLTI----IDAQNLV-THERKPGEEDDIASNGTGEDDPE 536
           +RTN+  +        VQ +   +I    ++A N V  +E       D+ +        +
Sbjct: 242 LRTNSPTQKI------VQTMRTNSICWNPVEAFNFVIANEDHNAYYYDMRNMSKALHVFK 295

Query: 537 NGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI-----AAD 591
           + V+   ++D   P    +++ + D TI++++V+ G     +  H + +  I       D
Sbjct: 296 DHVSAVMDVDFS-PTGDEVVTGSYDKTIRIYQVKHGHS--REIYHTKRMQHIFQVKYTMD 352

Query: 592 NFRIISGSHDGSIKIW 607
           +  I+SGS DG++++W
Sbjct: 353 SKYIVSGSDDGNVRLW 368

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK-----KIIVSGSADKTVKVWH 440
           +++TGS DKTIR++    G     Y  HT  +  +   K     K IVSGS D  V++W 
Sbjct: 312 EVVTGSYDKTIRIYQVKHGHSREIY--HTKRMQHIFQVKYTMDSKYIVSGSDDGNVRLWR 369

Query: 441 VES 443
            ++
Sbjct: 370 AKA 372

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 9/77 (11%)

Query: 330 FKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLY-----F 382
           FK H+  V+ + F+     + TGSYD T+ I+ +  G    R   H+  ++ ++      
Sbjct: 294 FKDHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGH--SREIYHTKRMQHIFQVKYTM 351

Query: 383 DDQKLITGSLDKTIRVW 399
           D + +++GS D  +R+W
Sbjct: 352 DSKYIVSGSDDGNVRLW 368

>Kwal_26.8628
          Length = 422

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/260 (19%), Positives = 104/260 (40%), Gaps = 25/260 (9%)

Query: 365 KLIRRLTGHSDGVKTL-YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--- 420
           +++    GH+  V  + +F++  +IT S D T  +W+    + I+ +  H   V+++   
Sbjct: 166 QIVSMFKGHTCYVSQVEFFENNSIITASGDMTCALWDIPKAKRIAEFSDHLGDVLALALP 225

Query: 421 ----DSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEW-VNCVKLHPKSFSCYSCSDDT 475
                +   I  SG +D  V +W   +R        +E  ++ +K     ++  + +DD 
Sbjct: 226 PPHAQTSSPIFASGGSDGYVYIWDTRARAAAQSFFVSESDISTLKFFNNGYAIVTGADDG 285

Query: 476 TIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNG----TG 531
             RM+D+R++  +  +       Q+    T +       +   P E D   SN     T 
Sbjct: 286 VARMFDMRSDCAVASYSLSQNLQQQANSPTRL-------YNSSPLEYDVTPSNASLTKTS 338

Query: 532 EDDPENGVNGQRELDKKMPYPTHLL-SCALDNTIKLWEVRSGRCIRTQFGH---VEGVWD 587
                  ++ Q  +         L+ +C  D    +W+      +    GH   + GV  
Sbjct: 339 RSANSTYLDNQGIVSLDFSGSGRLMHACYTDYGCVIWDTLRAEIVGKLEGHSSRISGV-K 397

Query: 588 IAADNFRIISGSHDGSIKIW 607
            + D   + +GS D ++K+W
Sbjct: 398 TSPDGMAVCTGSWDATLKLW 417

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 8/74 (10%)

Query: 336 GVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHS---DGVKTLYFDDQKLITG 390
           G+++L F+   RL+     D    IWD    +++ +L GHS    GVKT   D   + TG
Sbjct: 350 GIVSLDFSGSGRLMHACYTDYGCVIWDTLRAEIVGKLEGHSSRISGVKT-SPDGMAVCTG 408

Query: 391 SLDKTIRVW--NYI 402
           S D T+++W  NY+
Sbjct: 409 SWDATLKLWSPNYM 422

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 61/139 (43%), Gaps = 11/139 (7%)

Query: 370 LTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVM--SVDSHKK 425
           L GH++ +    +  D + +++ S D  + VW+   G   +     +  V+  +++S   
Sbjct: 82  LNGHNNKISDFAWSSDSRSILSASQDGFMIVWDASLGFKKNAIPLDSQWVLTCAINSSGN 141

Query: 426 IIVSGSADKTVKVWH------VESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
           ++ S     +  ++       V+ +     KGHT +V+ V+    + S  + S D T  +
Sbjct: 142 LVASAGLTNSCTIYRISQENRVQQQIVSMFKGHTCYVSQVEFFENN-SIITASGDMTCAL 200

Query: 480 WDIRTNTCLRVFRGHVGQV 498
           WDI     +  F  H+G V
Sbjct: 201 WDIPKAKRIAEFSDHLGDV 219

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 77/180 (42%), Gaps = 25/180 (13%)

Query: 327 IQEFKGHMDGVLTL---QFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD 383
           I  F+GH   VL      F+ R+L +GS D  + +W++                 T  F 
Sbjct: 74  IPLFRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEI---------------PATYSFH 118

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVES 443
           + +   G+++    V  ++TG       GH   V+   + + ++ S S D TV++W+VE 
Sbjct: 119 NAQDEDGNVEHVAPV-KFLTGHQRKV--GH---VLYHPTAQGVLASSSLDHTVRLWNVEQ 172

Query: 444 RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVG-QVQKVI 502
            T   +  H + V  +          +   D  +R+WDIR    +    GH G + Q+V+
Sbjct: 173 GTNPIVLTHPDMVTSMSFSYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHSGPKNQRVV 232

 Score = 36.6 bits (83), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 80/233 (34%), Gaps = 80/233 (34%)

Query: 407 ISTYRGHTDSVMSVDSH---KKIIVSGSADKTVKVWHVESRTCY---------------- 447
           I  +RGHT  V+  D     ++++VSGS D  + VW + +   +                
Sbjct: 74  IPLFRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPV 133

Query: 448 -TLKGHTEWVNCVKLHPKSFSCYSCSD-DTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLT 505
             L GH   V  V  HP +    + S  D T+R+W             +V Q    I LT
Sbjct: 134 KFLTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLW-------------NVEQGTNPIVLT 180

Query: 506 IIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIK 565
             D   +VT           +  GT                       +L +   D  ++
Sbjct: 181 HPD---MVTSM-------SFSYGGT-----------------------YLATVCRDKMLR 207

Query: 566 LWEVRSGRCIRTQFGHVEG-----VW-----DIAADNFRIISGSHDGSIKIWD 608
           +W++R G  +    GH        VW      +A   F  +S   D  I +WD
Sbjct: 208 VWDIRKGEVVSEGMGHSGPKNQRVVWLGNSDRLATTGFSKLS---DRQIAVWD 257

 Score = 36.6 bits (83), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 50/103 (48%), Gaps = 10/103 (9%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWNYIT 403
           +L + S D TV +W++  G     LT H D V ++ F      L T   DK +RVW+   
Sbjct: 155 VLASSSLDHTVRLWNVEQGTNPIVLT-HPDMVTSMSFSYGGTYLATVCRDKMLRVWDIRK 213

Query: 404 GECISTYRGHTDS----VMSVDSHKKIIVSGS---ADKTVKVW 439
           GE +S   GH+      V+ + +  ++  +G    +D+ + VW
Sbjct: 214 GEVVSEGMGHSGPKNQRVVWLGNSDRLATTGFSKLSDRQIAVW 256

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 71/179 (39%), Gaps = 33/179 (18%)

Query: 333 HMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKT-----LYFDDQ 385
           H D V ++ F+Y    L T   D  + +WD+  G+++    GHS G K      L   D+
Sbjct: 181 HPDMVTSMSFSYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHS-GPKNQRVVWLGNSDR 239

Query: 386 KLITGS---LDKTIRVW---NYITGECISTYRGHTDSVMSV----DSHKKIIVSGSADKT 435
              TG     D+ I VW   N   G+    Y     S + +    DS+K + V+G  D  
Sbjct: 240 LATTGFSKLSDRQIAVWDAFNLEKGQLGGFYNVDQSSGILMPFYDDSNKILYVAGKGDGN 299

Query: 436 VKVWHVESRTCYTLK--GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFR 492
           ++ +  +    Y L     TE      + PK             R  +++ N  LR ++
Sbjct: 300 IRYYEFQDDELYELSEFQSTEPQRGFAVAPK-------------RSVNVKENEVLRAYK 345

>Kwal_26.7655
          Length = 743

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 7/107 (6%)

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVE 442
           +Q +   S+D    V++ +       Y+ HT  ++ +D S    I++ S DKT ++WH +
Sbjct: 245 EQPIGPASMDLYAPVFHPLP---FRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCD 301

Query: 443 SRTCYTLKGHTEWVNCVKLHPKS--FSCYSCSDDTTIRMWDIRTNTC 487
                 +  H ++V C K HP    F    C D  T+R+W I  N+ 
Sbjct: 302 RPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDH-TLRLWSILDNSV 347

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 78/189 (41%), Gaps = 27/189 (14%)

Query: 330 FKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF---DDQ 385
           ++ H   +L L ++    + T S D T  +W     K ++  T H D V    F   DD+
Sbjct: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDR 326

Query: 386 KLITGSLDKTIRVW---------NYITGECI-----STYRGHTDSVMSVDSHKKIIVSGS 431
             I+G LD T+R+W         +Y  G+ I     S   G   +  + + H  II+   
Sbjct: 327 FFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGH-IIILYTR 385

Query: 432 ADKTVKVWHVESRTCYTLKGHTE------WVNCVKLHPKS-FSCYSCSDDTTIRMWDIRT 484
             + V  +HV  +   T K   E       +   K  P +       S+D+ IR++ I+ 
Sbjct: 386 GLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKG 445

Query: 485 NTCLRVFRG 493
            + L V +G
Sbjct: 446 QSLLEVLKG 454

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 6/91 (6%)

Query: 356 VAIWDLFTGKLIRRLTGHSDGV--KTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGH 413
           V IWDLF+   +  L GH   +   TL  + + +++ S D++I++WN  +GE +ST  GH
Sbjct: 163 VFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLSTGWGH 222

Query: 414 TDSVMS---VDSHKKIIVSGSADKTVKVWHV 441
           T  +     +D+  K +VS S D T +VW +
Sbjct: 223 TARIWQLKFIDNDTK-VVSVSEDCTCRVWDI 252

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 38/58 (65%), Gaps = 2/58 (3%)

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWDL 609
           +++SC+ D +IKLW ++SG  + T +GH   +W +    ++ +++S S D + ++WD+
Sbjct: 195 YVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDI 252

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 5/106 (4%)

Query: 382 FDDQKLI--TGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK--KIIVSGSADKTVK 437
           F D K+    G++   + +W+  +   +    GH  S+  V   K  + +VS S D+++K
Sbjct: 147 FSDTKVYINAGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIK 206

Query: 438 VWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
           +W+++S     T  GHT  +  +K         S S+D T R+WDI
Sbjct: 207 LWNLKSGELLSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDI 252

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 6/108 (5%)

Query: 396 IRVWNYITGECISTYRGHTDSVMSVDSHKKIIV-SGSADKTVKVWHVESRT-CYTLKGHT 453
           IR    + GE    Y G     +SV S  K+ + +G+    V +W + S T  + L GH 
Sbjct: 126 IRWVKAVYGERSILYSGS----ISVFSDTKVYINAGTVMGGVFIWDLFSETKVHNLLGHE 181

Query: 454 EWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
             +  V L        SCSDD +I++W++++   L    GH  ++ ++
Sbjct: 182 GSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQL 229

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 327 IQEFKGHMDGVL--TLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           +    GH   +   TL  N   + + S D ++ +W+L +G+L+    GH+  +  L F  
Sbjct: 174 VHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQLKFID 233

Query: 383 DDQKLITGSLDKTIRVWN 400
           +D K+++ S D T RVW+
Sbjct: 234 NDTKVVSVSEDCTCRVWD 251

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 5/88 (5%)

Query: 564 IKLWEVRSGRCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGR 621
           + +W++ S   +    GH   ++   ++ +   ++S S D SIK+W+L+SG+ + T  G 
Sbjct: 163 VFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLSTGWGH 222

Query: 622 KLKGSDVNTSSNPDHDERTKSAPVACVC 649
             +   +      D+D +  S    C C
Sbjct: 223 TAR---IWQLKFIDNDTKVVSVSEDCTC 247

>AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248)
           [1242 bp, 413 aa]
          Length = 413

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 2/84 (2%)

Query: 549 MPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWD--IAADNFRIISGSHDGSIKI 606
            P    LLS ++D  +K+W    G   RT FGH   +    +      ++S S DGS+++
Sbjct: 155 FPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNVLSSSKDGSVRL 214

Query: 607 WDLQSGKCMHTFHGRKLKGSDVNT 630
           W+  SG  +  FH R      VN 
Sbjct: 215 WECGSGSMLRAFHRRDRHSDGVNA 238

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 2/103 (1%)

Query: 410 YRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRT-CYTLKGHTEWVNCVKLHPKSFSC 468
           + GH  S+    S  K+++S S D  +K+W     T   TL GHT  +    L  +  + 
Sbjct: 145 HSGHITSLHYFPS-GKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNV 203

Query: 469 YSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQN 511
            S S D ++R+W+  + + LR F         V  L +++ Q+
Sbjct: 204 LSSSKDGSVRLWECGSGSMLRAFHRRDRHSDGVNALQVLNVQS 246

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 56/137 (40%), Gaps = 17/137 (12%)

Query: 328 QEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVK--TLYFD 383
           +   GH   + +L +  + ++L + S D  + IW    G   R L GH+  +    L   
Sbjct: 140 RSLDGHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIER 199

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYR---GHTDS-----VMSVDSHK-----KIIVSG 430
            + +++ S D ++R+W   +G  +  +     H+D      V++V SH        +  G
Sbjct: 200 GRNVLSSSKDGSVRLWECGSGSMLRAFHRRDRHSDGVNALQVLNVQSHSHNGLGNPLEFG 259

Query: 431 SADKTVKVWHVESRTCY 447
           + DK     H      Y
Sbjct: 260 TEDKAFIAGHASGVLTY 276

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/69 (21%), Positives = 27/69 (39%)

Query: 430 GSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLR 489
           G  +  + + + E   C +L GH+  +  +   P      S S D  +++W     T  R
Sbjct: 123 GDTEGRLTLHNAEFSDCRSLDGHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPR 182

Query: 490 VFRGHVGQV 498
              GH   +
Sbjct: 183 TLFGHTAPI 191

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 83/194 (42%), Gaps = 22/194 (11%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAI----WDLFTGKLIRRLTGHSDGVKTLYF 382
           I+  K + + + +  F+  +L TGS D  + +    +D FT   +   T H   ++++ +
Sbjct: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW 66

Query: 383 DDQK--LITGSLDKTIRVW-------NYITGECISTYRGHTDSVMSV--DSHKKIIVSGS 431
                 L  GS D T+ +W            + ++   GH + V  V   +    + + S
Sbjct: 67  RPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCS 126

Query: 432 ADKTVKVWHV----ESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN- 485
            DK+V +W      E   C + L+ H++ V  V  HP      S S D T+R+W    + 
Sbjct: 127 RDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDD 186

Query: 486 -TCLRVFRGHVGQV 498
             C+ V  GH G V
Sbjct: 187 WECVAVLNGHEGTV 200

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 56/266 (21%), Positives = 97/266 (36%), Gaps = 69/266 (25%)

Query: 366 LIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRV----WNYITGECISTYRGHTDSVMSVD 421
           LI+ L  + + + +  F    L TGS D+ I++    ++  T   +     H  ++ SV 
Sbjct: 6   LIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVA 65

Query: 422 --SHKKIIVSGSADKTVKVWHVESRTCYT--------LKGHTEWVNCVKLHPKSFSCYSC 471
              H  ++ +GS D TV +W  E     T        ++GH   V  V      +   +C
Sbjct: 66  WRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATC 125

Query: 472 SDDTTIRMWDIRTN----TCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIAS 527
           S D ++ +W+   +     C+ V + H   V+ VI                         
Sbjct: 126 SRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW------------------------ 161

Query: 528 NGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSG--RCIRTQFGHVEGV 585
                                 P    L S + D+T+++W+       C+    GH   V
Sbjct: 162 ---------------------HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTV 200

Query: 586 WDIAADN----FRIISGSHDGSIKIW 607
           W    D     FR+ SGS D ++++W
Sbjct: 201 WSSDFDKTEGVFRLCSGSDDSTVRVW 226

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 57/128 (44%), Gaps = 13/128 (10%)

Query: 324 LCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTG----KLIRRLTGHSDGVKT 379
           L  I+  +  + GV      Y L  T S D +V IW+        + I  L  HS  VK 
Sbjct: 100 LAIIEGHENEVKGVAWSNDGYYLA-TCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158

Query: 380 LYF--DDQKLITGSLDKTIRVWNYITG--ECISTYRGHTDSVMSVDSHKKIIV----SGS 431
           + +   +  L + S D T+R+W       EC++   GH  +V S D  K   V    SGS
Sbjct: 159 VIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGS 218

Query: 432 ADKTVKVW 439
            D TV+VW
Sbjct: 219 DDSTVRVW 226

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 346 LLFTGSYDTTVAIWDLFTG--KLIRRLTGHSDGVKTLYFDDQ----KLITGSLDKTIRVW 399
           LL + SYD TV IW  +    + +  L GH   V +  FD      +L +GS D T+RVW
Sbjct: 167 LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226

Query: 400 NYI 402
            Y+
Sbjct: 227 KYM 229

>Kwal_34.15818
          Length = 349

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 105/261 (40%), Gaps = 45/261 (17%)

Query: 370 LTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMS--VDSHKK 425
           L GH   +  + F+ +   + T + D    VW  I GE + T+ GH  ++ S  VD   +
Sbjct: 6   LKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQ 65

Query: 426 IIVSGSADKTVKVWHVESRT-CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
             V+GSAD ++K+W V+  T  +T K  T  V  V+  P                     
Sbjct: 66  YAVTGSADFSIKLWKVQDGTNVFTWKTKTP-VRRVQFSPSG------------------- 105

Query: 485 NTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEED--DIASNGTGEDDPENGVNGQ 542
           +  L V  G +G    V   T+          R P  +D  DI+   T       G    
Sbjct: 106 DKILAVLDGVMGYPGSVTVYTV---------RRDPETKDIVDISEEPTFNILTREGF--- 153

Query: 543 RELDKKMPYP---THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI--AADNFRIIS 597
            E+     +    T++++   D  +  +E  SG  I +   H + V DI  + D    I+
Sbjct: 154 -EIAAVAAWSFNDTYIVAGHKDGRVSKYEGHSGEYIDSAALHTQNVSDIQFSPDGTYFIT 212

Query: 598 GSHDGSIKIWDLQSGKCMHTF 618
            S D + K+ D ++ + + T+
Sbjct: 213 SSRDSAAKLVDTETLEVLKTY 233

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 16/141 (11%)

Query: 330 FKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD--Q 385
            KGH   +  ++FN    L+FT + D   ++W    G+ +    GH   + ++  D   Q
Sbjct: 6   LKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQ 65

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVW-----H 440
             +TGS D +I++W    G  + T++  T         +++  S S DK + V      +
Sbjct: 66  YAVTGSADFSIKLWKVQDGTNVFTWKTKTPV-------RRVQFSPSGDKILAVLDGVMGY 118

Query: 441 VESRTCYTLKGHTEWVNCVKL 461
             S T YT++   E  + V +
Sbjct: 119 PGSVTVYTVRRDPETKDIVDI 139

>Scas_571.4
          Length = 601

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 60/141 (42%), Gaps = 20/141 (14%)

Query: 382 FDDQKLITGSLDKTIRVWNYITGECISTYR----------------GHTDSVMSVDSHKK 425
           F+D K+ + S D  I +WN      + TYR                GHT  V  V  H +
Sbjct: 100 FNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPSKILSGHTRKVGHVLFHPR 159

Query: 426 I---IVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
           I   + S S D TVK+W+++         H++ V  +   P      + + +  + +WDI
Sbjct: 160 IRNVLASSSLDFTVKIWNIKKGKVIGTLQHSDMVTAMAFDPDGAYLATITRNKKLTIWDI 219

Query: 483 RTNTCLRVFRGHVG-QVQKVI 502
            +   +   + H G + Q+V+
Sbjct: 220 ASKQIVSQTKSHQGPKNQRVV 240

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 68/173 (39%), Gaps = 38/173 (21%)

Query: 449 LKGHTEWVNCVKLHP-KSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTII 507
            +GH   V      P   F   S SDD  I +W+I  N  +R +R    +     P+ I 
Sbjct: 85  FRGHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENK-----PMDIR 139

Query: 508 DAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYP---THLLSCALDNTI 564
            ++ L  H RK G                            + +P     L S +LD T+
Sbjct: 140 PSKILSGHTRKVGH--------------------------VLFHPRIRNVLASSSLDFTV 173

Query: 565 KLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCM 615
           K+W ++ G+ I T   H + V  +A   D   + + + +  + IWD+ S + +
Sbjct: 174 KIWNIKKGKVIGT-LQHSDMVTAMAFDPDGAYLATITRNKKLTIWDIASKQIV 225

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 6/89 (6%)

Query: 330 FKGHMDGVLTLQFNYRL---LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK 386
             GH   V  + F+ R+   L + S D TV IW++  GK+I  L  HSD V  + FD   
Sbjct: 144 LSGHTRKVGHVLFHPRIRNVLASSSLDFTVKIWNIKKGKVIGTLQ-HSDMVTAMAFDPDG 202

Query: 387 --LITGSLDKTIRVWNYITGECISTYRGH 413
             L T + +K + +W+  + + +S  + H
Sbjct: 203 AYLATITRNKKLTIWDIASKQIVSQTKSH 231

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 580 GHVEGVWDIAAD---NFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTS 631
           GH   V D   D   +F+I S S DG I IW++     M T+   + K  D+  S
Sbjct: 87  GHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPS 141

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 109/256 (42%), Gaps = 33/256 (12%)

Query: 371 TGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD------SHK 424
           TG+  GV+  +  + +++T S D T  +W+    + +  Y  H   V+++       S  
Sbjct: 174 TGYISGVE--FVSESRVVTSSGDMTCALWDIPKAKRVREYSDHLGDVLAISIPVTNLSKN 231

Query: 425 KIIVSGSADKTVKVWHVESRTC---YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWD 481
            +  S  +D    +W V S +    +++       NC+K  P   S    +DD TI ++D
Sbjct: 232 NMFASCGSDGYTFIWDVRSPSAVQQFSIGSCDS--NCLKFFPDGNSVAVGNDDGTISLFD 289

Query: 482 IRTNTCLRVF----RGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPEN 537
           +R +  + ++    RG   Q + V     +++    +    P     +A+N   ED    
Sbjct: 290 LRADCTIALYSINDRGSPLQKENV----FLNSNEYQSSSSSPKSPISLATN-YFED---- 340

Query: 538 GVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGH---VEGVWDIAADNFR 594
              G   LD        + SC ++   ++W+V  G  + +  GH   + GV   + D   
Sbjct: 341 --RGVISLDFSGS-GRLMYSCYINLGCQVWDVLKGEVVYSLEGHGNRLAGV-KCSPDGMA 396

Query: 595 IISGSHDGSIKIWDLQ 610
           I +GS D ++K+W  Q
Sbjct: 397 ICTGSWDQTLKLWTPQ 412

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 6/69 (8%)

Query: 336 GVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSD---GVKTLYFDDQKLITG 390
           GV++L F+   RL+++   +    +WD+  G+++  L GH +   GVK    D   + TG
Sbjct: 342 GVISLDFSGSGRLMYSCYINLGCQVWDVLKGEVVYSLEGHGNRLAGVKC-SPDGMAICTG 400

Query: 391 SLDKTIRVW 399
           S D+T+++W
Sbjct: 401 SWDQTLKLW 409

>Scas_719.52
          Length = 628

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 87/219 (39%), Gaps = 39/219 (17%)

Query: 298 NGRCRQKSWKMVYRERFKVESNWRKGLCT--IQEFKGHMDGVLTL---QFNYRLLFTGSY 352
           NG+    +W       F V      G C   +  F+GH   VL      FN  ++ + S 
Sbjct: 43  NGKFISVNWNASGGGAFAVIPVAEVGKCPDQVPLFRGHTAQVLDTDFDPFNDHIIASSSD 102

Query: 353 DTTVAIWDLFTG----------------KLIRRLTGHSDGVKTLYF---DDQKLITGSLD 393
           D+ + IW +                   K ++ L+GHS  V  + F    +  L + SLD
Sbjct: 103 DSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFLSGHSRKVGHVLFHPVAENVLASSSLD 162

Query: 394 KTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHV-ESRTCYTLK 450
            T+++WN  TGE + T + H D V  MS       + +   DK ++VW + E +      
Sbjct: 163 YTVKLWNIETGEAVITLK-HPDMVTSMSFSYGGNHLATVCRDKKLRVWDIREGKIVSEGP 221

Query: 451 GHTE-------WV-NCVKLHPKSFSCYSCSDDTTIRMWD 481
            H         W+ N  +L    FS  S   D  I +WD
Sbjct: 222 AHAGAKNQRVVWLGNSDRLATTGFSRLS---DRQIGIWD 257

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 67/174 (38%), Gaps = 40/174 (22%)

Query: 449 LKGHTEWVNCVKLHP-KSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTII 507
            +GHT  V      P       S SDD+ I +W I  +   + +    G+ + + P+  +
Sbjct: 77  FRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFL 136

Query: 508 DAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLW 567
                  H RK G    +  +   E+                     L S +LD T+KLW
Sbjct: 137 SG-----HSRKVGH---VLFHPVAEN--------------------VLASSSLDYTVKLW 168

Query: 568 EVRSGRCIRTQFGHVEGVWDIAADNFRIISGSH------DGSIKIWDLQSGKCM 615
            + +G  + T   H + V  ++        G+H      D  +++WD++ GK +
Sbjct: 169 NIETGEAVIT-LKHPDMVTSMSFS----YGGNHLATVCRDKKLRVWDIREGKIV 217

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 73/184 (39%), Gaps = 33/184 (17%)

Query: 333 HMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKT-----LYFDDQ 385
           H D V ++ F+Y    L T   D  + +WD+  GK++     H+ G K      L   D+
Sbjct: 181 HPDMVTSMSFSYGGNHLATVCRDKKLRVWDIREGKIVSEGPAHA-GAKNQRVVWLGNSDR 239

Query: 386 KLITGS---LDKTIRVW---NYITGECISTYRGHTDSVMSV----DSHKKIIVSGSADKT 435
              TG     D+ I +W   N   G+    Y     S + +    D +K + ++G  D  
Sbjct: 240 LATTGFSRLSDRQIGIWDAFNLEKGDLGGFYTVDQSSGILMPFYDDGNKILYLAGKGDGN 299

Query: 436 VKVWHVESRTCYTLKGH--TEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
           ++ +  ++   + L     TE      + PK             RM +I+ N  L+ F+ 
Sbjct: 300 IRYYEFQNDELFELSEFQSTEAQRGFAVAPK-------------RMVNIKENEVLKCFKT 346

Query: 494 HVGQ 497
            V Q
Sbjct: 347 VVDQ 350

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 88/227 (38%), Gaps = 47/227 (20%)

Query: 410 YRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKS--F 466
           Y+ H   V+ ++ S    I+S S DKTVK+WH + +       H ++V CV+ HP    F
Sbjct: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRF 333

Query: 467 SCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPL-------TIIDAQN-----LVT 514
               C D    R+W I  +     F      +   + L       TII   N     L+T
Sbjct: 334 FISGCLDH-KCRLWSILDDEV--SFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMT 390

Query: 515 HERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSG-R 573
               P     +A   T E +                   H++    D+ I+     +G +
Sbjct: 391 RGLTPVSSFHVADRQTQEQN------------------AHVMVTETDSKIRHGPRVTGLQ 432

Query: 574 CIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620
             R+Q            ++FR++  S+D  I+I+DL+  K +    G
Sbjct: 433 AFRSQLD----------NSFRLVVTSNDSRIRIFDLEQRKLLEVLKG 469

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 90/224 (40%), Gaps = 37/224 (16%)

Query: 327 IQEFKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--- 382
           ++ +K H+  VL + ++    + + S D TV +W       ++    H D V  + F   
Sbjct: 271 LRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPT 329

Query: 383 DDQKLITGSLDKTIRVW--------------NYITGECISTYRGHTDSVMSVDSHKKIIV 428
           DD+  I+G LD   R+W              + IT   +S   G    + + + +  I++
Sbjct: 330 DDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILM 389

Query: 429 SGSADKTVKVWHVESRTCYTLKGH---TEWVNCVKLHPK-------------SFSCYSCS 472
           +      V  +HV  R       H   TE  + ++  P+             SF     S
Sbjct: 390 TRGL-TPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTS 448

Query: 473 DDTTIRMWDIRTNTCLRVFRG-HVGQVQKVIPLTIIDAQNLVTH 515
           +D+ IR++D+     L V +G H G  Q    L+I   Q +V +
Sbjct: 449 NDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVN 492

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 90/228 (39%), Gaps = 46/228 (20%)

Query: 320 WRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDT--TVAIWDLFTGKLIRRL----TGH 373
           W K    +     H   ++++++N       S D      +W++ +G +++      TG 
Sbjct: 247 WNKTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENVTILWNVISGTVMQHFELKETGG 306

Query: 374 SD------------GVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTD--SVMS 419
           S             GV   + DD K +       I V+            GH    SV+ 
Sbjct: 307 SSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQITEKTPTGKLIGHHGPISVLE 366

Query: 420 VDSHKKIIVSGSADKTVKVWHV---ESRTCYTLKGHTE------WVNCVKLHPKSFSCYS 470
            +   K+++S S D T+++WH     S+ C+   GH++      WV   K+        S
Sbjct: 367 FNDTNKLLLSASDDGTLRIWHGGNGNSQNCFY--GHSQSIVSASWVGDDKV-------IS 417

Query: 471 CSDDTTIRMWDIRTNTCLR--------VFRGHVGQVQKVIPLTIIDAQ 510
           CS D ++R+W ++ NT L         +F G + Q  +   +  +D Q
Sbjct: 418 CSMDGSVRLWSLKQNTLLALSIVDGVPIFAGRISQDGQKYAVAFMDGQ 465

 Score = 37.0 bits (84), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 39/205 (19%), Positives = 78/205 (38%), Gaps = 20/205 (9%)

Query: 427 IVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
           IV+G  +  +++W+        L  H   +  VK +       S   +    +W++ + T
Sbjct: 235 IVTGVENGELRLWNKTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENVTILWNVISGT 294

Query: 487 CLRVFR------------GHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDD 534
            ++ F              H G     + +  +D    V     PG +  I      E  
Sbjct: 295 VMQHFELKETGGSSINAENHSGDGSLGVDVEWVDDDKFVI----PGPKGAIFVYQITEKT 350

Query: 535 PENGVNGQRELDKKMPYPTH---LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA-A 590
           P   + G       + +      LLS + D T+++W   +G      +GH + +   +  
Sbjct: 351 PTGKLIGHHGPISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWV 410

Query: 591 DNFRIISGSHDGSIKIWDLQSGKCM 615
            + ++IS S DGS+++W L+    +
Sbjct: 411 GDDKVISCSMDGSVRLWSLKQNTLL 435

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 409 TYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKS-- 465
           T+  HTD ++ +D S    I++GS DK+ K+WH    T      H+++V  V+ HP+   
Sbjct: 258 TFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDR 317

Query: 466 FSCYSCSDDTTIRMWDI 482
           F   +C D    R+W I
Sbjct: 318 FFLSACLDQ-KCRLWSI 333

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 330 FKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF---DDQ 385
           F  H D +L + ++    + TGS D +  +W       ++    HSD V  + F   DD+
Sbjct: 259 FHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDR 317

Query: 386 KLITGSLDKTIRVWNYITGECISTY 410
             ++  LD+  R+W+ +  + I  Y
Sbjct: 318 FFLSACLDQKCRLWSILEKQVIFEY 342

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 549 MPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA-ADNFR-IISGSHDGSIKI 606
            P     LS ++D  +K+W+  +G  +RT  GH   V D A  D  R  +S S DGS+K+
Sbjct: 167 FPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKL 226

Query: 607 WDLQSGKCMHTFH 619
           W+  +  C+ T +
Sbjct: 227 WECSTSACVFTLN 239

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 53/101 (52%), Gaps = 4/101 (3%)

Query: 365 KLIRRLTGHSDGV-KTLYF-DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSV 420
           ++I+    H+  + KT +F +    ++ S+D  +++W+  TG  + T+ GHT SV   ++
Sbjct: 149 EVIKLPEAHASHITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAM 208

Query: 421 DSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKL 461
               +  VS S+D ++K+W   +  C       + +NC+ L
Sbjct: 209 VDRGRNFVSASSDGSLKLWECSTSACVFTLNSNDGINCISL 249

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 5/106 (4%)

Query: 309 VYRERFKVESNWRKGLCTIQEF-KGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGK 365
           +Y  R    +N+   L  + +  + H   +   QF  N     + S D  + IWD  TG 
Sbjct: 132 IYVLRKNTGTNYSGPLQEVIKLPEAHASHITKTQFFPNGHGFLSSSIDMRLKIWDASTGT 191

Query: 366 LIRRLTGHSDGVKTLYFDD--QKLITGSLDKTIRVWNYITGECIST 409
            +R   GH+  V      D  +  ++ S D ++++W   T  C+ T
Sbjct: 192 ELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKLWECSTSACVFT 237

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 427 IVSGSADKTVKVWHVESRT-CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN 485
            +S S D  +K+W   + T   T  GHT  VN   +  +  +  S S D ++++W+  T+
Sbjct: 173 FLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKLWECSTS 232

Query: 486 TCLRVFRGHVG 496
            C+     + G
Sbjct: 233 ACVFTLNSNDG 243

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 21/50 (42%)

Query: 450 KGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
           + H   +   +  P      S S D  +++WD  T T LR F GH   V 
Sbjct: 155 EAHASHITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVN 204

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 15/67 (22%)

Query: 557 SCALDNTIKLWEVRSGRCIRTQF---GHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGK 613
           S  L   IKL E  +    +TQF   GH              +S S D  +KIWD  +G 
Sbjct: 144 SGPLQEVIKLPEAHASHITKTQFFPNGH------------GFLSSSIDMRLKIWDASTGT 191

Query: 614 CMHTFHG 620
            + TF G
Sbjct: 192 ELRTFIG 198

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 47/90 (52%), Gaps = 9/90 (10%)

Query: 531 GEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA 590
           G + P   V   RE D        L +C+ D +  +W   +G  + T  GH+  +W I +
Sbjct: 8   GHERPLTQVKYNREGDL-------LFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDS 60

Query: 591 DNFRI--ISGSHDGSIKIWDLQSGKCMHTF 618
           D+  +  ++GS D +IK+W L +G+C+ T+
Sbjct: 61  DHTSLYCVTGSADYTIKVWTLMNGQCVQTW 90

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 332 GHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKL-- 387
           GH   +  +++N    LLFT S D + ++W    G+ +  L GH   + ++  D   L  
Sbjct: 8   GHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYC 67

Query: 388 ITGSLDKTIRVWNYITGECISTY 410
           +TGS D TI+VW  + G+C+ T+
Sbjct: 68  VTGSADYTIKVWTLMNGQCVQTW 90

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 4/81 (4%)

Query: 370 LTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDS-HKKI 426
           L GH   +  + ++ +   L T S D +  VW    GE + T  GH  S+ S+DS H  +
Sbjct: 6   LMGHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSL 65

Query: 427 I-VSGSADKTVKVWHVESRTC 446
             V+GSAD T+KVW + +  C
Sbjct: 66  YCVTGSADYTIKVWTLMNGQC 86

>Scas_615.11
          Length = 349

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 74/169 (43%), Gaps = 34/169 (20%)

Query: 346 LLFTGSYDTTVAIW-------------------DLFTGKLIRRLTGHSDGVKTLYF--DD 384
           LL  GS+D+TV+IW                   +     L+  + GH + VK + +  D 
Sbjct: 74  LLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHENEVKGIAWSHDG 133

Query: 385 QKLITGSLDKTIRVWNYITG----ECISTYRGHTDSVMSVDSHKKI--IVSGSADKTVKV 438
             L + S DK++ +W         ECIS  + H+  V  V  H ++  + S S D T+++
Sbjct: 134 ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRL 193

Query: 439 W--HVESRTCYT-LKGHTEWVNCVKLHP----KSFSCYSCSDDTTIRMW 480
           W  + +   C   L GH   V C         +S    S SDD+T+R+W
Sbjct: 194 WKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 88/213 (41%), Gaps = 37/213 (17%)

Query: 323 GLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTG-----KLIRRL--TGHSD 375
           G+   +  K   D + +L +++ LL TGS D  + I ++         L+  L  T H  
Sbjct: 2   GIKLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKK 61

Query: 376 GVKTLYFDDQK--LITGSLDKTIRVW-------------------NYITGECISTYRGHT 414
            ++ + +      L  GS D T+ +W                   N +  + ++   GH 
Sbjct: 62  AIRCVAWRPHSNLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHE 121

Query: 415 DSVMSVD-SHKKIIVSG-SADKTVKVWHV----ESRTCYT-LKGHTEWVNCVKLHPKSFS 467
           + V  +  SH   ++S  S DK+V +W      E   C + L+ H++ V  V  HP+   
Sbjct: 122 NEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPL 181

Query: 468 CYSCSDDTTIRMWDIRTN--TCLRVFRGHVGQV 498
             S S D TIR+W    +   C  V  GH G V
Sbjct: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTV 214

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 68/152 (44%), Gaps = 22/152 (14%)

Query: 330 FKGHMDGVLTLQFNY--RLLFTGSYDTTVAIW----DLFTGKLIRRLTGHSDGVKTLYFD 383
            +GH + V  + +++   LL + S D +V IW    D    + I  L  HS  VK + + 
Sbjct: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176

Query: 384 DQK--LITGSLDKTIRVWNYITG--ECISTYRGHTDSVMSVDSHKKI------IVSGSAD 433
            +   L + S D TIR+W       EC +   GH  +V   D  K        + SGS D
Sbjct: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDD 236

Query: 434 KTVKVW-HVESRTCYTLKGHTEWVNCVKLHPK 464
            TV+VW +++        G  EW+ C  + PK
Sbjct: 237 STVRVWRYIDDDE----DGQQEWI-CEAILPK 263

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 59/284 (20%), Positives = 96/284 (33%), Gaps = 86/284 (30%)

Query: 365 KLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGE--CISTYRGHTDSV----- 417
           KL + L   +D + +L +    L TGS D+ I++ N        +S      D+V     
Sbjct: 4   KLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAI 63

Query: 418 --MSVDSHKKIIVSGSADKTVKVW--------------------HVESRTCYTLKGHTEW 455
             ++   H  ++ +GS D TV +W                     +E      ++GH   
Sbjct: 64  RCVAWRPHSNLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHENE 123

Query: 456 VNCVKLHPKSFSCYSCSDDTTIRMW----DIRTNTCLRVFRGHVGQVQKVIPLTIIDAQN 511
           V  +          SCS D ++ +W    D     C+ V + H   V+ V          
Sbjct: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV---------- 173

Query: 512 LVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRS 571
            V H   P                                   L S + D+TI+LW+   
Sbjct: 174 -VWHPELP----------------------------------LLASSSYDDTIRLWKDYD 198

Query: 572 G--RCIRTQFGHVEGVW--DIA----ADNFRIISGSHDGSIKIW 607
               C     GH   VW  D       ++ R+ SGS D ++++W
Sbjct: 199 DDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242

>Scas_660.7*
          Length = 603

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 65/135 (48%), Gaps = 21/135 (15%)

Query: 350 GSYDTTVA------IWDLFTGKLIRRLTGHSDGVKTLYF-----DDQKLITGSLDKTIRV 398
           GS+  TV        +D  TG+ ++ +   S+ ++   F     D+ K +T S D TIRV
Sbjct: 205 GSFAITVGSDRKINCFDSKTGEFVKSIVDESEPIQGGIFALSWIDENKFVTASADATIRV 264

Query: 399 WNYITGECISTYRGHTDS---------VMSVDSHKKIIVSGSADKTVKVWHVESRTCYT- 448
           W+  + +C+  +   + S         V  V S +  IVS S D T+ ++ +E     T 
Sbjct: 265 WDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLSLDGTLNIFQLEQDNIITS 324

Query: 449 LKGHTEWVNCVKLHP 463
           +KGH++ +  + ++P
Sbjct: 325 IKGHSKGITALAVNP 339

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 66/161 (40%), Gaps = 41/161 (25%)

Query: 470 SCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNG 529
           + S D TIR+WD+ ++ C          VQK +  +  D   L                 
Sbjct: 255 TASADATIRVWDVNSSKC----------VQKWVVTSSSDDNVL----------------- 287

Query: 530 TGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA 589
               D + GV   +E          ++S +LD T+ ++++     I +  GH +G+  +A
Sbjct: 288 ---RDQQVGVVASQE--------GRIVSLSLDGTLNIFQLEQDNIITSIKGHSKGITALA 336

Query: 590 ADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNT 630
            +   +I+GS+DG I  W     +  HT H   +   DV T
Sbjct: 337 VN--PLITGSYDGKIMDWS-NKPEVAHTKHNNLIVSIDVQT 374

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 346 LLFTGSYDTTVAIWDL-FTGKLIRRLTGHSDGVKTLYFDDQK-LITGSLDKTIRVWN 400
           L+ TGS DT + ++ +    K+I+RL  H DG+  L ++D   L++   D  I+ W 
Sbjct: 543 LVATGSLDTNIFVYSIKRPMKIIKRLNAHKDGISALLWEDASTLVSTGADACIKKWG 599

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/111 (20%), Positives = 54/111 (48%), Gaps = 11/111 (9%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRR--LTGHSDG-------VKTLYFDDQKLITGSLDKTIR 397
             T S D T+ +WD+ + K +++  +T  SD        V  +   + ++++ SLD T+ 
Sbjct: 253 FVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLSLDGTLN 312

Query: 398 VWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYT 448
           ++       I++ +GH+  + ++  +   +++GS D  +  W  +    +T
Sbjct: 313 IFQLEQDNIITSIKGHSKGITALAVNP--LITGSYDGKIMDWSNKPEVAHT 361

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRT---------QFGHVEGVWDIAADNFRIISGSHDGSIK 605
            ++ + D TI++W+V S +C++               + V  +A+   RI+S S DG++ 
Sbjct: 253 FVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLSLDGTLN 312

Query: 606 IWDLQSGKCMHTFHG 620
           I+ L+    + +  G
Sbjct: 313 IFQLEQDNIITSIKG 327

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 48/89 (53%), Gaps = 5/89 (5%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWH 440
           DD+ L+T S+D +++V+N  TG C++  + H   V  V  D   + I+S S D+++ ++ 
Sbjct: 163 DDKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYVQGVTWDPLNQYIISQSVDRSINIYE 222

Query: 441 VESRTCYTLKG---HTEWVNCVKLHPKSF 466
           +E R    +      TE +  +KL  + F
Sbjct: 223 IELRDSKDITSSTTSTELIKRLKLKNRIF 251

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 449 LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIID 508
           L  H + VN ++   +     S  DD  + +W + TN   R  +  +G          ++
Sbjct: 76  LSLHEQAVNVIRFDHRGNVLASAGDDGQVLLWKL-TNEETRKKQQRMGDEP-------VE 127

Query: 509 AQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWE 568
                  +R  G  +D+      ++ P  G +   +L    P   +L++ ++DN++K++ 
Sbjct: 128 GDGWAVWKRLRGTANDL------DNMPGGGASEIYDLSWS-PDDKYLVTASMDNSLKVFN 180

Query: 569 VRSGRCIRTQFGH---VEGV-WDIAADNFRIISGSHDGSIKIWDLQ 610
           V +G C+     H   V+GV WD    N  IIS S D SI I++++
Sbjct: 181 VDTGNCVAFAKDHNHYVQGVTWDPL--NQYIISQSVDRSINIYEIE 224

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 74/157 (47%), Gaps = 18/157 (11%)

Query: 356 VAIWDLFTGKLI--RRLTG-----HSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECIS 408
           V I DL TGK++  ++L G     +S  +K +   + ++  G++     VW+    E I 
Sbjct: 115 VLITDL-TGKVVEEKKLVGERSILYSGSIKVISESEVQINAGTVMGGAIVWDLYKEELIH 173

Query: 409 TYRGHTDSVMSVDS--HKKIIVSGSADKTVKVWHVESRTCYTLK-GHTEWVNCVKLHPKS 465
              GH  S+  + S  H K+I S S D+++++W  E+    ++   HT  +  +K     
Sbjct: 174 NLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNND 233

Query: 466 FSCYSCSDDTTIRMWDIRTN-------TCLRVFRGHV 495
            +  S S+D T R+W+I  N           +F GH+
Sbjct: 234 ENLVSVSEDCTCRVWNIIPNDISGYELQISNIFEGHL 270

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 60/134 (44%), Gaps = 16/134 (11%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           I    GH   +  +Q +   +L+ + S D ++ +WD  TGK +     H+  +  L F  
Sbjct: 172 IHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFN 231

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMS-----------VDSHKKIIVSGS 431
           +D+ L++ S D T RVWN I  + IS Y     ++             V+  K+II +  
Sbjct: 232 NDENLVSVSEDCTCRVWNIIPND-ISGYELQISNIFEGHLLKNVWGVDVNDEKRIIATSG 290

Query: 432 ADKTVKVWHVESRT 445
            D  + V  + + T
Sbjct: 291 NDGRINVIDLNTDT 304

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 12/87 (13%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKIWDL--- 609
           + SC+ D +I+LW+  +G+ +   + H   +W++   N    ++S S D + ++W++   
Sbjct: 194 IASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNNDENLVSVSEDCTCRVWNIIPN 253

Query: 610 -QSG---KCMHTFHGRKLK---GSDVN 629
             SG   +  + F G  LK   G DVN
Sbjct: 254 DISGYELQISNIFEGHLLKNVWGVDVN 280

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

Query: 413 HTDSVMSVDSHKKIIVSGSADKTVKVWHV-ESRTCYTLKGHTEWVNCVKLHPKSFSCYSC 471
           ++ S+  +   +  I +G+      VW + +    + L GH   +  ++    +    SC
Sbjct: 138 YSGSIKVISESEVQINAGTVMGGAIVWDLYKEELIHNLTGHEGSIFYIQSSEHNKLIASC 197

Query: 472 SDDTTIRMWDIRTNTCLRVFRGHVGQV 498
           SDD +IR+WD  T   L +   H  ++
Sbjct: 198 SDDRSIRLWDRETGKELSIGWSHTARI 224

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 54/115 (46%), Gaps = 16/115 (13%)

Query: 353 DTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTY 410
           D ++ + D  T K++R+L GHS+ V    F  D + +++ SLD TIR W+  TG CI   
Sbjct: 570 DLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGV 629

Query: 411 RGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKS 465
           R     + SV ++ K   +G    T  V         T  G + W N  +  P S
Sbjct: 630 R-----LDSVATNLKFSPNGDLLATTHV---------TGNGISIWTNRAQFKPVS 670

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 11/105 (10%)

Query: 541 GQRELDK---KMPY--PTHLLSCALDN-TIKLWEVRSGRCIRTQFGHVEGV--WDIAADN 592
           G+ +LD     M Y   + L + ALD+ +I + +  + + +R  +GH   V  +D + D 
Sbjct: 544 GKLQLDAPVTSMVYHRSSDLFAVALDDLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDG 603

Query: 593 FRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHD 637
             I+S S D +I+ WDL +G C+    G +L     N   +P+ D
Sbjct: 604 RWIVSASLDSTIRTWDLPTGGCI---DGVRLDSVATNLKFSPNGD 645

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 60/145 (41%), Gaps = 4/145 (2%)

Query: 348 FTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWNYITGE 405
           F GS +  + +++L +G   ++   H   V  +  D  ++K+++  LD  I  +++    
Sbjct: 482 FVGSSEGGIGVYNLQSGLQRKKYRLHKKAVTGVAIDGMNRKMVSCGLDGLIGFYDFTKSA 541

Query: 406 CISTYR--GHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHP 463
            +   +      S++   S     V+      V +  V  +    L GH+  V      P
Sbjct: 542 FLGKLQLDAPVTSMVYHRSSDLFAVALDDLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSP 601

Query: 464 KSFSCYSCSDDTTIRMWDIRTNTCL 488
                 S S D+TIR WD+ T  C+
Sbjct: 602 DGRWIVSASLDSTIRTWDLPTGGCI 626

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 6/70 (8%)

Query: 336 GVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSD---GVKTLYFDDQKLITG 390
           GV+++ F+   RLL+    +   A+WDL  G++I +L GHSD   GV T   D   + TG
Sbjct: 395 GVISMDFSRSGRLLYVSYTEFGCAVWDLVKGEIIGKLDGHSDRISGVATSP-DGLAICTG 453

Query: 391 SLDKTIRVWN 400
           S D T++VW+
Sbjct: 454 SWDMTMKVWS 463

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/258 (20%), Positives = 100/258 (38%), Gaps = 51/258 (19%)

Query: 365 KLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMS--V 420
           K +  L GH++ V +  +  D + +++ S D  + +W+  TG   +    H+  V+S  +
Sbjct: 118 KPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLHSQWVLSCAI 177

Query: 421 DSHKKIIVSGSADKTVKVWHV------ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDD 474
             +  ++ S   D    ++ V      +       KGHT +++ ++    + S  + S D
Sbjct: 178 CPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDDN-SILTASGD 236

Query: 475 TTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDD 534
            T  +WDI  +  +  F  H+G V              ++    P E +     G G   
Sbjct: 237 MTCALWDITKSKRINEFADHLGDV--------------LSLSAAPTETE-----GNGNVF 277

Query: 535 PENGVNGQREL-DKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNF 593
              G +G   + DK++P        +  +  K+   R+G  I T                
Sbjct: 278 ASGGSDGYLYIWDKRVPTSVQSFFVSDSDVSKVKFFRNGNTIAT---------------- 321

Query: 594 RIISGSHDGSIKIWDLQS 611
               GS DG   ++DL+S
Sbjct: 322 ----GSDDGCTNLYDLRS 335

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 51/261 (19%), Positives = 104/261 (39%), Gaps = 25/261 (9%)

Query: 366 LIRRLTGHSDGVKTLYF-DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV---- 420
           ++    GH+  +  + F DD  ++T S D T  +W+    + I+ +  H   V+S+    
Sbjct: 208 IVSIFKGHTCYISEIEFLDDNSILTASGDMTCALWDITKSKRINEFADHLGDVLSLSAAP 267

Query: 421 ---DSHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTT 476
              + +  +  SG +D  + +W     T   +       V+ VK      +  + SDD  
Sbjct: 268 TETEGNGNVFASGGSDGYLYIWDKRVPTSVQSFFVSDSDVSKVKFFRNGNTIATGSDDGC 327

Query: 477 IRMWDIRTN------TCLRVFRGHVGQVQKVIPLTIID-AQNLVTHERKPGEEDDIASNG 529
             ++D+R++      +  R   G     Q+   ++ +D      T  R       I +  
Sbjct: 328 TNLYDLRSDCRIANYSLSRSIHGATPVQQQTYIMSNMDYTAPSGTLARASPYSPAIGTVS 387

Query: 530 TGEDDPENGVNGQRELDKKMPYPTHL-LSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI 588
           +   D +  ++       ++ Y ++    CA      +W++  G  I    GH + +  +
Sbjct: 388 SSFIDNQGVISMDFSRSGRLLYVSYTEFGCA------VWDLVKGEIIGKLDGHSDRISGV 441

Query: 589 AA--DNFRIISGSHDGSIKIW 607
           A   D   I +GS D ++K+W
Sbjct: 442 ATSPDGLAICTGSWDMTMKVW 462

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 37/79 (46%), Gaps = 4/79 (5%)

Query: 407 ISTYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKS 465
           + TY+ H   V+ +D S    ++S S DKT K+WH           H ++V CVK HP  
Sbjct: 405 VRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQHPDFVTCVKFHPTD 464

Query: 466 --FSCYSCSDDTTIRMWDI 482
             F    C D    R+W I
Sbjct: 465 DRFFISGCLDQ-KCRLWSI 482

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 327 IQEFKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--- 382
           ++ +K H+  VL + ++    L + S D T  +W     + ++    H D V  + F   
Sbjct: 405 VRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQ-HPDFVTCVKFHPT 463

Query: 383 DDQKLITGSLDKTIRVWNYITGEC 406
           DD+  I+G LD+  R+W+ +  E 
Sbjct: 464 DDRFFISGCLDQKCRLWSILDDEV 487

>Kwal_27.10785
          Length = 367

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 69/129 (53%), Gaps = 12/129 (9%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF------DDQKLITGSLDKTIRVWN 400
           + +G  D  V ++D+ +G+  +++  H   VK+L F      + + L+TGS DKTI+ W+
Sbjct: 94  IASGGCDNAVMVFDVSSGQS-QQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYWD 152

Query: 401 YITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVK 460
               + +ST     + V ++DS +K++V G+A++ + V  + +      K  T   + +K
Sbjct: 153 LRQPQPVSTL-AMPERVYTMDSKQKLLVVGTAERHIVVIDLNNPAA-IFKTTT---SPLK 207

Query: 461 LHPKSFSCY 469
              +S SCY
Sbjct: 208 WQTRSVSCY 216

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/251 (20%), Positives = 99/251 (39%), Gaps = 22/251 (8%)

Query: 370 LTGHSDGVKTLYF-DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV-------- 420
             GH+  +  + F D+  ++T S D T  +W+    + +  Y  H   V+++        
Sbjct: 177 FKGHTCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNS 236

Query: 421 DSHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
           ++      S  +D    +W   S +   +   +   +N ++      S  + SD+  I M
Sbjct: 237 ENSSNTFASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINM 296

Query: 480 WDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGV 539
           +D+R++  +  F    G  ++    T + A       + P     + S  +   D +  V
Sbjct: 297 YDLRSDCSIATFSLFRGYEERTPTPTYMAANMEYNTAQSP---QTLKSTSSSYLDNQGVV 353

Query: 540 NGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGH---VEGVWDIAADNFRII 596
           +       ++ Y     SC  D    +W+V  G  +    GH   V GV   + D   + 
Sbjct: 354 SLDFSASGRLMY-----SCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRS-SPDGLAVC 407

Query: 597 SGSHDGSIKIW 607
           +GS D ++KIW
Sbjct: 408 TGSWDSTMKIW 418

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/264 (20%), Positives = 107/264 (40%), Gaps = 58/264 (21%)

Query: 370 LTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMS--VDSHKK 425
           L GH++ +    +  D +++++ S D  + +W+  +G   +     +  V+S  +     
Sbjct: 88  LKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSST 147

Query: 426 IIVSGSADKTVKVWHV--ESRTCYTL----KGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
           ++ S   +    ++ V  E+R    +    KGHT +++ ++    +    + S D T  +
Sbjct: 148 LVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAH-ILTASGDMTCAL 206

Query: 480 WDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGV 539
           WDI     +R +  H+G    V+ L I +                       E + EN  
Sbjct: 207 WDIPKAKRVREYSDHLGD---VLALAIPE-----------------------EPNSENSS 240

Query: 540 NGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA-----DNFR 594
           N                SC  D    +W+ RS   +++ + +     DI A     D   
Sbjct: 241 N-------------TFASCGSDGYTYIWDSRSPSAVQSFYVNDS---DINALRFFKDGMS 284

Query: 595 IISGSHDGSIKIWDLQSGKCMHTF 618
           I++GS +G+I ++DL+S   + TF
Sbjct: 285 IVAGSDNGAINMYDLRSDCSIATF 308

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 4/69 (5%)

Query: 336 GVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGS 391
           GV++L F+   RL+++   D    +WD+  G+++ +L GH   V  +    D   + TGS
Sbjct: 351 GVVSLDFSASGRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRSSPDGLAVCTGS 410

Query: 392 LDKTIRVWN 400
            D T+++W+
Sbjct: 411 WDSTMKIWS 419

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 13/87 (14%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA---------ADNFRIISGSHDGS 603
            H+L+ + D T  LW++   + +R    H+  V  +A         + N     GS DG 
Sbjct: 193 AHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGS-DGY 251

Query: 604 IKIWDLQSGKCMHTFHGRKLKGSDVNT 630
             IWD +S   + +F+   +  SD+N 
Sbjct: 252 TYIWDSRSPSAVQSFY---VNDSDINA 275

>Kwal_47.17555
          Length = 417

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 76/189 (40%), Gaps = 35/189 (18%)

Query: 330 FKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQ-- 385
            +GH   +  ++F  +  +L +GS D  + +W    G   R L GH+  V  L   D+  
Sbjct: 144 LEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGR 203

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHTD------------SVMSVDSHKKIIVSGSAD 433
            +++ S D ++++W   +GE I ++   TD            S  S +   + +  G+A 
Sbjct: 204 NVMSSSKDGSLKLWECGSGETIHSFARKTDQSDPVNDMLILCSPGSSEDGSRHLEFGTAG 263

Query: 434 KTVKVWHVESRTCY----------TLKGHTEWVNC------VKLHPKSFS---CYSCSDD 474
           KTV   H      Y           L    E   C       + HP S S    Y+  D+
Sbjct: 264 KTVFAGHNSGFISYHDIRSKDLTFELPNQFESPCCSLASSTSQFHPASQSPVFLYAGYDN 323

Query: 475 TTIRMWDIR 483
            T+  WDIR
Sbjct: 324 GTVAQWDIR 332

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 43/83 (51%), Gaps = 3/83 (3%)

Query: 547 KKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA-DNFR-IISGSHDGSI 604
           K  P    LLS + D  +K+W    G   RT  GH   V  +   D  R ++S S DGS+
Sbjct: 155 KFFPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSL 214

Query: 605 KIWDLQSGKCMHTFHGRKLKGSD 627
           K+W+  SG+ +H+F  RK   SD
Sbjct: 215 KLWECGSGETIHSF-ARKTDQSD 236

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 56/127 (44%), Gaps = 4/127 (3%)

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWH- 440
           D    TG     I +++    E   T  GH   +  V      ++++SGSAD  +KVW  
Sbjct: 119 DYLYATGDQGGIISIYDS-QAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWST 177

Query: 441 VESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQK 500
           ++     TLKGHT  V  + +  +  +  S S D ++++W+  +   +  F     Q   
Sbjct: 178 LDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKLWECGSGETIHSFARKTDQSDP 237

Query: 501 VIPLTII 507
           V  + I+
Sbjct: 238 VNDMLIL 244

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 52/102 (50%), Gaps = 5/102 (4%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYIT 403
           L  TG     ++I+D    ++ R L GH   +  + F    + L++GS D  ++VW+ + 
Sbjct: 121 LYATGDQGGIISIYDS-QAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLD 179

Query: 404 GECISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVES 443
           G    T +GHT +V  + +    + ++S S D ++K+W   S
Sbjct: 180 GSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKLWECGS 221

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 37/95 (38%), Gaps = 3/95 (3%)

Query: 426 IIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN 485
           +  +G     + ++  ++    TL+GH   +  VK  P      S S D  +++W     
Sbjct: 121 LYATGDQGGIISIYDSQAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDG 180

Query: 486 TCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPG 520
           +  R  +GH      V  L IID    V    K G
Sbjct: 181 SNPRTLKGH---TSTVTALGIIDRGRNVMSSSKDG 212

>Scas_680.11
          Length = 347

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 9/90 (10%)

Query: 531 GEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA 590
           G + P   V   RE D        L SC+ DN   +W   +G  + T  GH   +W I  
Sbjct: 8   GHERPLTQVKYNREGDL-------LFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDV 60

Query: 591 DNF--RIISGSHDGSIKIWDLQSGKCMHTF 618
           D F    ++GS D SIK+W +++G+ ++++
Sbjct: 61  DKFTEYCVTGSADYSIKMWKVETGENVYSW 90

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 370 LTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK--K 425
           L GH   +  + ++ +   L + S D    VW  + GE + T  GH  ++ S+D  K  +
Sbjct: 6   LMGHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTE 65

Query: 426 IIVSGSADKTVKVWHVES 443
             V+GSAD ++K+W VE+
Sbjct: 66  YCVTGSADYSIKMWKVET 83

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 332 GHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD--QKL 387
           GH   +  +++N    LLF+ S D   ++W    G+ +  L GH+  + ++  D   +  
Sbjct: 8   GHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYC 67

Query: 388 ITGSLDKTIRVWNYITGECISTY 410
           +TGS D +I++W   TGE + ++
Sbjct: 68  VTGSADYSIKMWKVETGENVYSW 90

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 3/76 (3%)

Query: 412 GHTDSVMSVDSHKK--IIVSGSADKTVKVWH-VESRTCYTLKGHTEWVNCVKLHPKSFSC 468
           GH   +  V  +++  ++ S S D    VW+ V      TL GH   +  + +   +  C
Sbjct: 8   GHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYC 67

Query: 469 YSCSDDTTIRMWDIRT 484
            + S D +I+MW + T
Sbjct: 68  VTGSADYSIKMWKVET 83

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 370 LTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMS--VDSHKK 425
           L GH   +  + ++ +   + T   D    VW  + GE + T  GH  S+ S  VD H +
Sbjct: 6   LMGHERSLTQVKYNREGDLIFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDVDQHTE 65

Query: 426 IIVSGSADKTVKVWHV 441
             V+GSAD +VKVW V
Sbjct: 66  YAVTGSADFSVKVWRV 81

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 2/69 (2%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQSG 612
           + +   DN   +W   +G  + T  GH   +W I  D      ++GS D S+K+W ++ G
Sbjct: 25  IFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDVDQHTEYAVTGSADFSVKVWRVRDG 84

Query: 613 KCMHTFHGR 621
              H++  R
Sbjct: 85  SIAHSWDTR 93

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 332 GHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD--QKL 387
           GH   +  +++N    L+FT   D   ++W    G+ +  L GH+  + ++  D   +  
Sbjct: 8   GHERSLTQVKYNREGDLIFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDVDQHTEYA 67

Query: 388 ITGSLDKTIRVW 399
           +TGS D +++VW
Sbjct: 68  VTGSADFSVKVW 79

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 47/85 (55%), Gaps = 15/85 (17%)

Query: 372 GHSDGVKTL---YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--------MSV 420
           GH DGV  L   Y D  K+ +GS D  I+ W+  + E I++++ H  ++        +++
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNI 124

Query: 421 DS----HKKIIVSGSADKTVKVWHV 441
           DS    ++  ++S S DKTVK+W V
Sbjct: 125 DSASSGNQNFVLSSSDDKTVKLWSV 149

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 63/316 (19%), Positives = 123/316 (38%), Gaps = 48/316 (15%)

Query: 332 GHMDGVLTLQFNYRLL---FTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF------ 382
           GH DGV  L  +Y  L    +GS D  +  WD+ + + I     H   +  L        
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNI 124

Query: 383 ------DDQKLITGSLDKTIRVW----------------NYITGECISTYRGHTDSVMSV 420
                 +   +++ S DKT+++W                N   G     Y  H    +  
Sbjct: 125 DSASSGNQNFVLSSSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGLDH 184

Query: 421 DSHKKIIVSGSADKTVKVWHV-ESRTCYTLKGHTEWVNCVKLHPKSFSCY-SCSDDTTIR 478
                  V+G     + +W +  S+    L    + +N VK +    +   S   D +I 
Sbjct: 185 SRMTSNFVTGGP--RINLWDINRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIV 242

Query: 479 MWDIRTNTCLRVFRGHVGQVQKVIPL--TIIDAQNLV-THERKPGEEDDIASNGTGEDDP 535
           ++D+RTN+  +     + Q  +V  +    ++A N V   E       D+ +     +  
Sbjct: 243 LYDLRTNSATQ----KIVQTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVF 298

Query: 536 ENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRT----QFGHVEGVWDIAAD 591
           ++ V+   ++D   P    +++ + D TI+++ +  G         +  HV      + D
Sbjct: 299 KDHVSAVMDVDIS-PTGEEVVTASYDKTIRIFPINKGHSREIYHTKRMQHVFQA-KFSMD 356

Query: 592 NFRIISGSHDGSIKIW 607
           +  ++SGS DG++++W
Sbjct: 357 SKYVMSGSDDGNVRLW 372

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 580 GHVEGVWDIAA---DNFRIISGSHDGSIKIWDLQSGKCMHTF 618
           GH +GV+ +A    D  +I SGS DG IK WD+ S + + +F
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASF 106

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 385 QKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK-----KIIVSGSADKTVKVW 439
           ++++T S DKTIR++    G     Y  HT  +  V   K     K ++SGS D  V++W
Sbjct: 315 EEVVTASYDKTIRIFPINKGHSREIY--HTKRMQHVFQAKFSMDSKYVMSGSDDGNVRLW 372

Query: 440 HVES 443
             ++
Sbjct: 373 RAKA 376

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 69/318 (21%), Positives = 133/318 (41%), Gaps = 49/318 (15%)

Query: 332 GHMDGVLTLQFNY---RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-----YFD 383
           GH DGV  +  NY     L TGS D  +  W++ T +       H   V  L      F 
Sbjct: 65  GHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFH 124

Query: 384 DQK--------LITGSLDKTIRVW---------------NYITGE--CISTYRGHTDSVM 418
           D+K        +++ S DKT+++W               + +T E   I T+ G + +  
Sbjct: 125 DKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGES-AFQ 183

Query: 419 SVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCY-SCSDDTT 476
            +DSH++     +    + +W V   +    L    + +  +K +        S   D +
Sbjct: 184 GIDSHRENSTFATGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNS 243

Query: 477 IRMWDIRTNTCLRVFRGHVGQVQKVIPL--TIIDAQNLVT-HERKPGEEDDIASNGTGED 533
           I ++D+RTN+  +     + Q  +   +    ++A N VT +E       D+ +     +
Sbjct: 244 IVLYDLRTNSPTQ----KIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLN 299

Query: 534 DPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIR----TQFGHVEGVWDIA 589
             ++ V+   ++D   P    +++ + D +I++++   G         +  HV  V   +
Sbjct: 300 VFKDHVSAVMDVDFS-PTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQV-KYS 357

Query: 590 ADNFRIISGSHDGSIKIW 607
            D+  IISGS DG++++W
Sbjct: 358 MDSKYIISGSDDGNVRLW 375

>Kwal_27.11126
          Length = 996

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 557 SCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWDLQ 610
           SC+ D +IKLW+++SG+ + T +GH   +W++    ++ ++IS S D + ++WD+ 
Sbjct: 198 SCSDDRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDIS 253

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 66/143 (46%), Gaps = 4/143 (2%)

Query: 376 GVKTLYFDDQKLI-TGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK--KIIVSGSA 432
           G  T+Y  D+  I  G++   + VW+  + + +  +  H  ++  V + K  K   S S 
Sbjct: 142 GTITVYSQDKVHINAGTVMDGVIVWDLESEQNLHHFTDHEGAIFFVTASKNGKYAASCSD 201

Query: 433 DKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVF 491
           D+++K+W ++S +   T  GHT  +  +          S S+D T R+WDI  +  L   
Sbjct: 202 DRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQA 261

Query: 492 RGHVGQVQKVIPLTIIDAQNLVT 514
             H G + K +    +D + ++ 
Sbjct: 262 SVHEGHLLKSVWGLDVDNERMIA 284

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 55/101 (54%), Gaps = 8/101 (7%)

Query: 353 DTTVAIWDLFTGKLIRRLTGHSDGV-KTLYFD-DQKLITGSLDKTIRVWNYITGECI--- 407
           D ++ +WDL +G+L+    GH+  +   L+FD D K+I+ S D T RVW+      +   
Sbjct: 202 DRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQA 261

Query: 408 STYRGH-TDSV--MSVDSHKKIIVSGSADKTVKVWHVESRT 445
           S + GH   SV  + VD+ + I  +   D  +K+  +++++
Sbjct: 262 SVHEGHLLKSVWGLDVDNERMIAATSGNDGRIKLTDLKAKS 302

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 45/218 (20%), Positives = 86/218 (39%), Gaps = 57/218 (26%)

Query: 402 ITGECISTYRGHTDSVMSVDSHKKI-IVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCV 459
           + GE    Y G     ++V S  K+ I +G+    V VW +ES +  +    H   +  V
Sbjct: 132 VFGERSILYSG----TITVYSQDKVHINAGTVMDGVIVWDLESEQNLHHFTDHEGAIFFV 187

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKP 519
                     SCSDD +I++WD+++   L    GH  ++  ++                 
Sbjct: 188 TASKNGKYAASCSDDRSIKLWDLKSGQLLSTAWGHTARIWNLLFF--------------- 232

Query: 520 GEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQF 579
                       ++D +                  ++S + D T ++W++     +    
Sbjct: 233 ------------DNDSK------------------VISVSEDCTCRVWDISEDNTLSQAS 262

Query: 580 GH----VEGVWDIAADNFRIISGS--HDGSIKIWDLQS 611
            H    ++ VW +  DN R+I+ +  +DG IK+ DL++
Sbjct: 263 VHEGHLLKSVWGLDVDNERMIAATSGNDGRIKLTDLKA 300

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 8/96 (8%)

Query: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF------DDQKLITGSLDKTIRVWNYI 402
           +G  D  + ++D+ +G+  +++  H   V+ L F      + + ++TGS DKTI+ W+  
Sbjct: 94  SGGCDNILKLYDVASGQA-QQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYWDMR 152

Query: 403 TGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKV 438
             + IST     + V ++DS +K++V G+A++ + V
Sbjct: 153 QPQPISTV-AMPERVYALDSKQKLLVVGTAERHIVV 187

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 12/104 (11%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLT-GHSDGVKTLYF--DDQKLITGSLDKTIRVWNYI 402
           L    ++D TV IWD+  G    R    H   V T  +  D  K+ +G  D  +++++  
Sbjct: 48  LFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLYDVA 107

Query: 403 TGECISTYRGHTDSVMSV-------DSHKKIIVSGSADKTVKVW 439
           +G+      G  DS +          S+++ IV+GS DKT+K W
Sbjct: 108 SGQAQQI--GSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYW 149

 Score = 36.2 bits (82), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 550 PYPTHLLSCAL-DNTIKLWEVRSGRCI-RTQFGHVEGVWDI--AADNFRIISGSHDGSIK 605
           P    L S A  DNT+++W+V++G    R Q+ H   V     ++D  ++ SG  D  +K
Sbjct: 43  PQQDFLFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILK 102

Query: 606 IWDLQSGKCMH 616
           ++D+ SG+   
Sbjct: 103 LYDVASGQAQQ 113

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 69/170 (40%), Gaps = 38/170 (22%)

Query: 371 TGHSDGVKTLYFD-----------DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMS 419
           TGH D V  + +D           DQ +    LDK    W     E   ++R H  S++S
Sbjct: 6   TGHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRW-----EVNDSWRAHDSSIVS 60

Query: 420 VD----SHKKIIVSGSADKTVKVWHVE-----------SRTCYTLKGHTEWVNCVKLHPK 464
           +D     + +II S S DKT+K+W  +           +R C TL      + CVK  P 
Sbjct: 61  LDWASPEYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLC-TLNDSKGSLYCVKFAPS 119

Query: 465 --SFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNL 512
                  S  +D  +RM+D    + LR +        +V  L +  A NL
Sbjct: 120 HLGLRIASIGNDGIMRMYDALDPSNLRSWT----MTAEVKVLPVAPANNL 165

>Kwal_27.10385
          Length = 536

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 2/71 (2%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWH 440
           DD  ++TGS+D ++R++    G C++    H   V  V  D   + I S SAD++V V+ 
Sbjct: 147 DDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWDPQNEFIFSQSADRSVHVYR 206

Query: 441 VESRTCYTLKG 451
           +E     ++ G
Sbjct: 207 IEKTPSGSISG 217

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 37/65 (56%), Gaps = 6/65 (9%)

Query: 550 PYPTHLLSCALDNTIKLWEVRSGRCIRTQFGH---VEG-VWDIAADNFRIISGSHDGSIK 605
           P   ++++ ++DN+++++EV  G C+     H   V+G VWD    N  I S S D S+ 
Sbjct: 146 PDDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWD--PQNEFIFSQSADRSVH 203

Query: 606 IWDLQ 610
           ++ ++
Sbjct: 204 VYRIE 208

>Kwal_33.15475
          Length = 783

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 62/148 (41%), Gaps = 29/148 (19%)

Query: 365 KLIRRLTGHSDGVKTLYFDDQK-----LITGSLDKTIRVWNYITGECIST---------Y 410
           +L   L GH D VK + F ++      L TGS D+ IR+W   T E I            
Sbjct: 189 QLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRYIRLWRIRTNELIDNSDEDEFKLNL 248

Query: 411 RGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYS 470
            G+  S   +    K+ ++  A                + GH +W++C+K H +     +
Sbjct: 249 LGNKQSKFFITPDLKVAINFDA---------------LIVGHDDWISCLKWHKERPQLLA 293

Query: 471 CSDDTTIRMWDIRTNTCLRVFRGHVGQV 498
            + DT + +W+   ++ + +    +G++
Sbjct: 294 STADTAVMVWEPDADSGVWICASRLGEL 321

 Score = 36.2 bits (82), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 427 IVSGSADKTVKVWH----VESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW 480
           I++ +  KT+ +W            TLKGH   V CVK  P +    S S+D+ +R+W
Sbjct: 26  ILAFAGGKTIALWKPLDPAHHGVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLW 83

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 71/212 (33%), Gaps = 71/212 (33%)

Query: 346 LLFTGSYDTTVAIW---DLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWN 400
           L F G    T+A+W   D     + R L GH+  V  + F      +++ S D  +R+W 
Sbjct: 27  LAFAGG--KTIALWKPLDPAHHGVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWA 84

Query: 401 YITGE-----CISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESR----------- 444
           +   +     C+     H  ++ S+     I+  G AD +V +W  E+            
Sbjct: 85  FEEKDQDALKCVQVIDHHKHTITSLSVISNILSVGCADGSVSLWLTENNQAILLHSFNLQ 144

Query: 445 -----TCYTLK----------------------------------------GHTEWVNCV 459
                 C  LK                                        GH +WV  +
Sbjct: 145 TNVYPLCMALKLVEGDKYLLAIGGTNPRVFIYSFTLQDGTLNNFQLAAELEGHEDWVKAM 204

Query: 460 KLH---PKSFSCYSCSDDTTIRMWDIRTNTCL 488
             +   P +    + S D  IR+W IRTN  +
Sbjct: 205 DFYEESPGNMLLATGSQDRYIRLWRIRTNELI 236

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 66/150 (44%), Gaps = 7/150 (4%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGEC 406
           L  G  +  V I+D+   K IR L+GH D V  L +++  L +GS D+ I   +    E 
Sbjct: 306 LAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDVRMPEP 365

Query: 407 -ISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVESR-TCYTLKGHTEWVNCVKLH 462
                  HT  V  +  ++ +  + SG  D  V V+   SR     L  HT  V  +   
Sbjct: 366 YFEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWS 425

Query: 463 PKS---FSCYSCSDDTTIRMWDIRTNTCLR 489
           P      +    + D  +++W++ T+T LR
Sbjct: 426 PHKRGILATGGGTADKKMKIWNVNTSTKLR 455

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 64/127 (50%), Gaps = 8/127 (6%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDL-FTGKLIRRLTGHSDGVKTLYF--D 383
           I+   GHMD V  L +N  +L +GS D  +   D+        ++  H+  V  L +  D
Sbjct: 326 IRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDVRMPEPYFEQVETHTQEVCGLKWNTD 385

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVS---GSADKTVKV 438
           + +L +G  D  + V++  + +       HT +V ++    HK+ I++   G+ADK +K+
Sbjct: 386 ENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWSPHKRGILATGGGTADKKMKI 445

Query: 439 WHVESRT 445
           W+V + T
Sbjct: 446 WNVNTST 452

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 52/100 (52%), Gaps = 5/100 (5%)

Query: 350 GSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD-QKLIT--GSLDKTIRVWNYITGEC 406
           G+ D  + IW++ T   +R +   S     ++  +  +L+T  G     + +W+Y + E 
Sbjct: 437 GTADKKMKIWNVNTSTKLRDIDTGSQVCNMIWSKNTNELVTSHGYSRYNLTLWDYPSMEP 496

Query: 407 ISTYRGHTDSVM--SVDSHKKIIVSGSADKTVKVWHVESR 444
           ++  +GH+  V+  ++ +    +VSG+ D+T++ W +  R
Sbjct: 497 VAILKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFDR 536

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 30/52 (57%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSI 604
           +HL     +  ++++++   +CIRT  GH++ V  ++ +N  + SGS D  I
Sbjct: 304 SHLAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVACLSWNNHILTSGSRDRKI 355

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 353 DTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECI 407
           D ++ + D  T K++R+L GH + +    F  D + L++ SLD TIR W+  TG CI
Sbjct: 562 DLSIVVVDTVTQKVVRQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCI 618

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 61/145 (42%), Gaps = 4/145 (2%)

Query: 348 FTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWNYITGE 405
           F GS +  + ++++ +G L ++   H   V  +  D  ++K+++  LD  I  +++   +
Sbjct: 474 FVGSSNGGIGVYNMQSGMLRKKYRLHKRAVTGVAVDGMNRKMVSCGLDGIIGFYDFNESK 533

Query: 406 CISTYRGHTDSVMSVDSHKKIIVSGSAD--KTVKVWHVESRTCYTLKGHTEWVNCVKLHP 463
            +   +        V      + + + D    V V  V  +    L GH   +      P
Sbjct: 534 YLGKLQMDAPITSMVYHRSSDLCAFALDDLSIVVVDTVTQKVVRQLWGHGNRITAFDFSP 593

Query: 464 KSFSCYSCSDDTTIRMWDIRTNTCL 488
                 S S D+TIR WD+ T +C+
Sbjct: 594 DGRWLVSASLDSTIRTWDLPTGSCI 618

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 46/86 (53%), Gaps = 6/86 (6%)

Query: 555 LLSCALDN-TIKLWEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 611
           L + ALD+ +I + +  + + +R  +GH   +  +D + D   ++S S D +I+ WDL +
Sbjct: 555 LCAFALDDLSIVVVDTVTQKVVRQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPT 614

Query: 612 GKCMHTFHGRKLKGSDVNTSSNPDHD 637
           G C+    G K++    N   +P+ D
Sbjct: 615 GSCI---DGVKIESVATNLKFSPNGD 637

>Kwal_27.12586
          Length = 509

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 64/131 (48%), Gaps = 10/131 (7%)

Query: 327 IQEFKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRR--LTGHSDGVKTLYF 382
           + +  GH   +    FN    +L +GS D T+ +W   +G L       G++ G+ + ++
Sbjct: 328 LGKLNGHSATITAFDFNSENNMLLSGSDDKTLRVWR--SGSLSSSNCFMGNTLGITSAFW 385

Query: 383 -DDQKLITGSLDKTIRVWNYITG--ECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVW 439
            DD K+I  SLD ++R+W+++T   + IS   G      S+   K     G  D  V V+
Sbjct: 386 IDDDKVIATSLDGSVRLWSHLTNTLQAISMVDGVPIFCGSLSPDKLKFAIGKMDGEVTVY 445

Query: 440 HVESRTCYTLK 450
           ++E +   TLK
Sbjct: 446 NIE-KLLATLK 455

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 76/190 (40%), Gaps = 16/190 (8%)

Query: 427 IVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
            ++G     +++W  +++       H   +  +K +  +    +   D    +W+ +T T
Sbjct: 221 FLTGVESGEIRLWTHDAKLQNAFDFHKSSIVTIKWNSDATHFLTYDVDNVAIVWNAQTGT 280

Query: 487 CLRVFRGHV-GQVQKV-IPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRE 544
            L+ F     G V  + +  + I     V     PG +  I   G GE  P   +NG   
Sbjct: 281 ALQQFSFRENGTVDSLGVDASWIGPDKFVI----PGPQGSIYICGMGESRPLGKLNGHSA 336

Query: 545 LDKKMPYPTH---LLSCALDNTIKLW---EVRSGRCIR-TQFGHVEGVWDIAADNFRIIS 597
                 + +    LLS + D T+++W    + S  C      G     W    D+ ++I+
Sbjct: 337 TITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAFW---IDDDKVIA 393

Query: 598 GSHDGSIKIW 607
            S DGS+++W
Sbjct: 394 TSLDGSVRLW 403

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 60/158 (37%), Gaps = 12/158 (7%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITG 404
             TG     + +W     KL      H   + T+ +  D    +T  +D    VWN  TG
Sbjct: 221 FLTGVESGEIRLWT-HDAKLQNAFDFHKSSIVTIKWNSDATHFLTYDVDNVAIVWNAQTG 279

Query: 405 ECISTY----RGHTDSVMSVDSH----KKIIVSGSADKTVKVWHVESRTCYTLKGHTEWV 456
             +  +     G  DS + VD+      K ++ G           ESR    L GH+  +
Sbjct: 280 TALQQFSFRENGTVDS-LGVDASWIGPDKFVIPGPQGSIYICGMGESRPLGKLNGHSATI 338

Query: 457 NCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
                + ++    S SDD T+R+W   + +    F G+
Sbjct: 339 TAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGN 376

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 62/144 (43%), Gaps = 24/144 (16%)

Query: 317 ESNWRKGLCTIQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIW--------------- 359
           E   RK L  +     H   V  L+F  + + L +GS D  + IW               
Sbjct: 63  EEQLRKPLANMSR---HTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMEN 119

Query: 360 DLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSV 417
           DL    + RRL  H + ++ + +  D   L+T  LD++I VWN  T E I  +  H   V
Sbjct: 120 DLEHWNVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHV 179

Query: 418 MSV--DSHKKIIVSGSADKTVKVW 439
             V  D   K   + S D+TVKV+
Sbjct: 180 KGVVFDPANKYFATASDDRTVKVF 203

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 62/125 (49%), Gaps = 8/125 (6%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDL-FTGKLIRRLTGHSDGVKTLYFD-- 383
           I+   GH+D V  L +N  +L +GS D  +   D+         +  H+  V  L ++  
Sbjct: 337 IRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVA 396

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVS---GSADKTVKV 438
           D KL +G  D  + V+   +   I T+  H  +V  M+   HK+ +++   G+AD+ +K+
Sbjct: 397 DNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKI 456

Query: 439 WHVES 443
           W+V +
Sbjct: 457 WNVNT 461

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 61/146 (41%), Gaps = 7/146 (4%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNY-ITGE 405
           L  G  +  V I+D+   K IR L+GH D V  L +++  L +GS D  I   +  +   
Sbjct: 317 LAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDP 376

Query: 406 CISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVESRT-CYTLKGHTEWVNCVKLH 462
              T   HT  V  +  +     + SG  D  V V+   S++   T   H   V  +   
Sbjct: 377 FFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWS 436

Query: 463 PKSFSCYSC---SDDTTIRMWDIRTN 485
           P      +    + D  +++W++ T+
Sbjct: 437 PHKRGVLATGGGTADRRLKIWNVNTS 462

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSI 604
           +HL     +  +++++V   +CIRT  GH++ V  ++ +N  + SGS D  I
Sbjct: 315 SHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRI 366

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 355 TVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWNYITGECISTYRG 412
           ++ ++ +   K + RL GH+  + TL F+  ++ L++ S D TI+VW        + +  
Sbjct: 321 SLLVYTIGNNKPLGRLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTD 380

Query: 413 HTDSVMSVD-SHKKIIVSGSADKTVKVWHV 441
           HT ++ S    +  +I+S + D TVKVW +
Sbjct: 381 HTKTISSAHWINDDLIISTAYDGTVKVWSI 410

 Score = 36.6 bits (83), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 40/212 (18%), Positives = 84/212 (39%), Gaps = 20/212 (9%)

Query: 411 RGHTDSVMSVD--SHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSC 468
           R   + ++SV      +++++G+    +++W+ + +    L  H   +  +K +      
Sbjct: 206 RSEEEPIISVSWSPDGELVLTGTTSGELRLWNKQGKLKNILDSHRSPIVAMKWNQDCTHL 265

Query: 469 YSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV----IPLTIIDAQNLVTHERKPGEEDD 524
            +      + +W   T T L+ F    G ++      I L  ++    V     PG    
Sbjct: 266 LTTDVSNVVILWSTLTGTQLQHFSFKEGDIENEDSLGIDLEWVETDKFVI----PGPGGS 321

Query: 525 IASNGTGEDDPENGVNGQRELDKKMPYPTH---LLSCALDNTIKLWEVRSGRCIRTQFGH 581
           +     G + P   + G       + +      LLS + DNTIK+W   +         H
Sbjct: 322 LLVYTIGNNKPLGRLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDH 381

Query: 582 VEGV----WDIAADNFRIISGSHDGSIKIWDL 609
            + +    W    ++  IIS ++DG++K+W +
Sbjct: 382 TKTISSAHW---INDDLIISTAYDGTVKVWSI 410

 Score = 36.2 bits (82), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 32/161 (19%), Positives = 65/161 (40%), Gaps = 12/161 (7%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQ--KLITGSLDKTIRVWNYI 402
            L+ TG+    + +W+   GKL   L  H   +  + ++     L+T  +   + +W+ +
Sbjct: 222 ELVLTGTTSGELRLWNK-QGKLKNILDSHRSPIVAMKWNQDCTHLLTTDVSNVVILWSTL 280

Query: 403 TGECISTYRGHTDSVMSVDS---------HKKIIVSGSADKTVKVWHVESRTCYTLKGHT 453
           TG  +  +      + + DS           K ++ G     +      ++    L GHT
Sbjct: 281 TGTQLQHFSFKEGDIENEDSLGIDLEWVETDKFVIPGPGGSLLVYTIGNNKPLGRLLGHT 340

Query: 454 EWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494
             +  ++ +  + S  S SDD TI++W    ++    F  H
Sbjct: 341 STITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDH 381

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 332 GHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YFDDQKLI 388
           GH   + TL+FN   + L + S D T+ +W           T H+  + +  + +D  +I
Sbjct: 338 GHTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDHTKTISSAHWINDDLII 397

Query: 389 TGSLDKTIRVW----NYITGEC 406
           + + D T++VW    N I  E 
Sbjct: 398 STAYDGTVKVWSISKNSIVAEA 419

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 48/102 (47%), Gaps = 9/102 (8%)

Query: 393 DKTIRVWNYITGECISTYRGHTDSVMS--VDSHKKIIVSGSADKTVKVWHV-ESRTCYTL 449
           D    VW  I GE + T+ GH  ++ S  VD   +  V+GSAD +VK+W V +    YT 
Sbjct: 31  DSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTEYAVTGSADFSVKLWKVCDGSNVYTW 90

Query: 450 KGHTEWVNCVKLHPKSFSCYSCSDDT-----TIRMWDIRTNT 486
           K  T  V  V+  P      +  D       ++ ++D+  NT
Sbjct: 91  KTKTP-VRRVEFSPAGDKILAVLDGVMGYAGSVTVYDVVRNT 131

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 555 LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWDLQSG 612
           + SCA D+   +W   +G  + T  GH+  +W I  D F    ++GS D S+K+W +  G
Sbjct: 25  IFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTEYAVTGSADFSVKLWKVCDG 84

Query: 613 KCMHTF 618
             ++T+
Sbjct: 85  SNVYTW 90

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 330 FKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD--Q 385
            KGH   +  +++N    L+F+ + D+  ++W    G+ +    GH   + ++  D   +
Sbjct: 6   LKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTE 65

Query: 386 KLITGSLDKTIRVWNYITGECISTYRGHT 414
             +TGS D ++++W    G  + T++  T
Sbjct: 66  YAVTGSADFSVKLWKVCDGSNVYTWKTKT 94

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 25/53 (47%)

Query: 449 LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
           LKGH   +  VK + +    +SC+ D+   +W       L  F GH+G +  +
Sbjct: 6   LKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAINGERLGTFEGHMGTIWSI 58

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 63/125 (50%), Gaps = 8/125 (6%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDL-FTGKLIRRLTGHSDGVKTLYF--D 383
           I+   GH+D V  L +N  +L +GS D T+   D+        ++  H   +  L +  +
Sbjct: 411 IRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMADPFFEKIETHEQEICGLKWNTN 470

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVS---GSADKTVKV 438
           D KL +G  D  + V++  +     +   H  +V  M+   HK+ I++   G+AD+T+K+
Sbjct: 471 DNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADRTLKM 530

Query: 439 WHVES 443
           W+V +
Sbjct: 531 WNVNT 535

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 67/149 (44%), Gaps = 7/149 (4%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNY-ITGE 405
           L  G  +  V I+D+   K IR L+GH D V  L +++  L +GS D+TI   +  +   
Sbjct: 391 LAIGQGNGIVEIYDVTKEKCIRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMADP 450

Query: 406 CISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLH 462
                  H   +  +  +++   + SG  D  V V+   SRT + ++  H   V  +   
Sbjct: 451 FFEKIETHEQEICGLKWNTNDNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWS 510

Query: 463 PKS---FSCYSCSDDTTIRMWDIRTNTCL 488
           P      +    + D T++MW++ T+  L
Sbjct: 511 PHKQGILATGGGTADRTLKMWNVNTSVKL 539

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSI 604
           +HL     +  +++++V   +CIRT  GH++ V  ++ +N  + SGS D +I
Sbjct: 389 SHLAIGQGNGIVEIYDVTKEKCIRTLSGHLDRVACLSWNNHILSSGSRDRTI 440

>YER066W (YER066W) [1497] chr5 (290240..290797) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has high similarity to a
           region of S. cerevisiae Cdc4p, which is a component of
           the SCF-Cdc4p complex involved in ubiquitin-dependent
           degradation [558 bp, 185 aa]
          Length = 185

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 51/120 (42%), Gaps = 22/120 (18%)

Query: 365 KLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYIT----GEC------------ 406
           K +  L+GH+D + +  +D ++   I+ S+D TIR+W+       GEC            
Sbjct: 2   KCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAK 61

Query: 407 ----ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLH 462
               + T RGH   V  +    K +VS S D +++ W   +        HT+      LH
Sbjct: 62  ILGAMYTLRGHRALVGLLGLSDKFLVSASVDGSIRCWDANTYFLKHFFDHTQLNTITALH 121

 Score = 35.0 bits (79), Expect = 0.10,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 25/126 (19%)

Query: 330 FKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGK--------------------LI 367
             GH D + +  +++  +   + S DTT+ IWDL   +                     +
Sbjct: 7   LSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILGAM 66

Query: 368 RRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHT--DSVMSVDSHKK 425
             L GH   V  L   D+ L++ S+D +IR W+  T   +  +  HT  +++ ++    +
Sbjct: 67  YTLRGHRALVGLLGLSDKFLVSASVDGSIRCWDANT-YFLKHFFDHTQLNTITALHVSDE 125

Query: 426 IIVSGS 431
           ++VSGS
Sbjct: 126 VLVSGS 131

 Score = 33.1 bits (74), Expect = 0.47,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 447 YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWD---IRTN 485
           Y L GHT+ +       +   C S S DTTIR+WD   IR N
Sbjct: 5   YILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNN 46

 Score = 30.0 bits (66), Expect = 3.7,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 6/50 (12%)

Query: 573 RCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKIWDLQ----SGKCMH 616
           +C+    GH + ++    D+   R IS S D +I+IWDL+    +G+C +
Sbjct: 2   KCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSY 51

 Score = 29.3 bits (64), Expect = 8.3,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 20/88 (22%)

Query: 556 LSCALDNTIKLWEVRS----GRC----------------IRTQFGHVEGVWDIAADNFRI 595
           +S ++D TI++W++ +    G C                + T  GH   V  +   +  +
Sbjct: 27  ISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILGAMYTLRGHRALVGLLGLSDKFL 86

Query: 596 ISGSHDGSIKIWDLQSGKCMHTFHGRKL 623
           +S S DGSI+ WD  +    H F   +L
Sbjct: 87  VSASVDGSIRCWDANTYFLKHFFDHTQL 114

>Scas_605.18
          Length = 424

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 6/73 (8%)

Query: 336 GVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGS 391
           GV++L F+   RL+F    D    IWD+   +++ +L GHS+ V ++    D   + TGS
Sbjct: 352 GVVSLDFSNSGRLMFACYTDLGCIIWDVLKAEIVGKLEGHSNRVSSVRTSPDGLGVCTGS 411

Query: 392 LDKTIRVW--NYI 402
            D T+R+W  NY+
Sbjct: 412 WDSTMRIWSPNYM 424

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 49/241 (20%), Positives = 94/241 (39%), Gaps = 23/241 (9%)

Query: 381 YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV---------DSHKKIIVSGS 431
           + D+  +IT S D T  +W+    + +  Y  H   V+++         ++   I  S  
Sbjct: 188 FLDNSHIITSSGDMTCALWDIPKAKRVREYADHLGDVLALALPPPSADENTGANIFASCG 247

Query: 432 ADKTVKVWHVESRTCYTLKGHTEW---VNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCL 488
           +D    +W  ++RT   ++        VN ++      S  +  DD  I M+D+R++  +
Sbjct: 248 SDGYTYIW--DTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTGGDDGVINMFDLRSDCAI 305

Query: 489 RVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKK 548
             +    G +QK I      + N+      P      A + +  D+      G   LD  
Sbjct: 306 ASYSLQQG-IQKEIRDPTYMSSNMEYSRGSPQSPISTAISSSYLDN-----QGVVSLDFS 359

Query: 549 MPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKI 606
                 + +C  D    +W+V     +    GH   V  +  + D   + +GS D +++I
Sbjct: 360 NS-GRLMFACYTDLGCIIWDVLKAEIVGKLEGHSNRVSSVRTSPDGLGVCTGSWDSTMRI 418

Query: 607 W 607
           W
Sbjct: 419 W 419

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 51/293 (17%), Positives = 109/293 (37%), Gaps = 55/293 (18%)

Query: 370 LTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMS--VDSHKK 425
           L GH++ +    +  D + +++ S D  + +W+  +G   +     +  V+S  +     
Sbjct: 87  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDTASGLKRNAIPLDSQWVLSCALSPSGN 146

Query: 426 IIVSGSADKTVKVWHV------ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
           +  S   +    ++ V      +       KGHT +++ ++    S    + S D T  +
Sbjct: 147 LAASAGLNNNCTIYRVSKENRVQQNVVSIFKGHTCYISDIEFLDNSH-IITSSGDMTCAL 205

Query: 480 WDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGV 539
           WDI     +R +  H+G V             L      P  +++  +N           
Sbjct: 206 WDIPKAKRVREYADHLGDV-------------LALALPPPSADENTGAN----------- 241

Query: 540 NGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA--ADNFRIIS 597
                            SC  D    +W+ R+   ++  F     V  I    D   I++
Sbjct: 242 --------------IFASCGSDGYTYIWDTRTSAAVQKFFASDTDVNAIQFFKDGNSIVT 287

Query: 598 GSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVN----TSSNPDHDERTKSAPVA 646
           G  DG I ++DL+S   + ++  ++    ++      SSN ++   +  +P++
Sbjct: 288 GGDDGVINMFDLRSDCAIASYSLQQGIQKEIRDPTYMSSNMEYSRGSPQSPIS 340

>Scas_397.2
          Length = 410

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 2/86 (2%)

Query: 547 KKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWD-IAADNFR-IISGSHDGSI 604
           K  P    +LS + D  +KLW ++   C R   GH   + D +  +  R  +S S DG++
Sbjct: 146 KFFPSGEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTM 205

Query: 605 KIWDLQSGKCMHTFHGRKLKGSDVNT 630
           K+W+  SG  + TF  R+     +N+
Sbjct: 206 KLWECGSGSTVRTFMRRENPNDGINS 231

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 46/127 (36%), Gaps = 45/127 (35%)

Query: 451 GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQ 510
            H   +  +K  P      S S D  +++W I+  +C R+FRGH  ++   + +      
Sbjct: 137 AHCSEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLI------ 190

Query: 511 NLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVR 570
                ER             G D                      +S +LD T+KLWE  
Sbjct: 191 -----ER-------------GRD---------------------FVSSSLDGTMKLWECG 211

Query: 571 SGRCIRT 577
           SG  +RT
Sbjct: 212 SGSTVRT 218

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 425 KIIVSGSADKTVKVWHVESRTC-YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIR 483
           ++++SGS+D  +K+W ++  +C    +GHT  +    L  +     S S D T+++W+  
Sbjct: 152 EVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKLWECG 211

Query: 484 TNTCLRVF 491
           + + +R F
Sbjct: 212 SGSTVRTF 219

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 8/74 (10%)

Query: 372 GHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGH----TDSVMSVDSHKK 425
            H   + TL F    + +++GS D  +++W+     C   +RGH    TDSV+      +
Sbjct: 137 AHCSEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLI--ERGR 194

Query: 426 IIVSGSADKTVKVW 439
             VS S D T+K+W
Sbjct: 195 DFVSSSLDGTMKLW 208

>Scas_465.4
          Length = 1002

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 4/90 (4%)

Query: 356 VAIWDLFTGKLIRRLTGHSDGV--KTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGH 413
           V IWDLF    +  L GH   +   T+  + + + + S D++I++WN  TGE + T  GH
Sbjct: 161 VLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGWGH 220

Query: 414 TDSV--MSVDSHKKIIVSGSADKTVKVWHV 441
           T  +  +   ++   ++S S D T +VW +
Sbjct: 221 TARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKIWDL 609
           ++ SC+ D +IKLW +++G  + T +GH   +W++   N   ++IS S D + ++WD+
Sbjct: 193 YITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 8/105 (7%)

Query: 402 ITGECIS--TYRG-----HTDSVMSVDSHKKIIVSGSADKTVKVWHVESRT-CYTLKGHT 453
           +TGE +S  T +G     ++ S+      K  I +G+    V +W +   T  Y L GH 
Sbjct: 120 LTGEILSRKTLQGERSILYSGSIKEFSPEKVYISAGTVMGGVLIWDLFLETKLYNLVGHE 179

Query: 454 EWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQV 498
             +    +        SCSDD +I++W+++T   L    GH  ++
Sbjct: 180 GSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGWGHTARI 224

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 332 GHMDGVL--TLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKL 387
           GH   +   T+  N R + + S D ++ +W+L TG+ +    GH+  +  L F  +D +L
Sbjct: 177 GHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKFFNNDTQL 236

Query: 388 ITGSLDKTIRVWNYITGE 405
           I+ S D T RVW+ +  E
Sbjct: 237 ISVSEDNTCRVWDILQDE 254

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 77/178 (43%), Gaps = 28/178 (15%)

Query: 330 FKGHMDGVLTLQFNY---RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK 386
           F+GH   VL   F+      + + S D  + IWD+     I + +G ++ +K +  +  K
Sbjct: 77  FRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSILK-SGDNEEIKDI--EPTK 133

Query: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVES-RT 445
            +TG   K                 GH   ++   + K ++ S S D TV++W+VE+   
Sbjct: 134 FLTGHSRKV----------------GH---ILYHPTAKDVLASSSLDYTVRIWNVETGED 174

Query: 446 CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVG-QVQKVI 502
            Y LK H + V  +          + + D  +R+W++R    +     H G + Q+V+
Sbjct: 175 IYKLK-HPDMVTSMSFSYDGTHLATVARDKKLRVWNVREEKVVSEGAAHAGAKNQRVV 231

>AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372)
           [3072 bp, 1023 aa]
          Length = 1023

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 353 DTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTY 410
           D ++ + D  T +++R+L GHS+ +    F  D + +++ SLD T+R W+  TG CI   
Sbjct: 652 DFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDGRWIVSASLDSTLRTWDLPTGTCIDGV 711

Query: 411 R 411
           R
Sbjct: 712 R 712

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 67/150 (44%), Gaps = 6/150 (4%)

Query: 343 NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWN 400
           N+ L+  GS +  +++++L +G   +    H   V  L  D  ++K+++  LD  +  ++
Sbjct: 561 NFALI--GSSNGGISVYNLQSGIKRKVYKMHKGSVTGLAVDGMNRKMVSCGLDGLVGFYD 618

Query: 401 YITGECISTYR-GHTDSVMSVDSHKKIIVSGSADKTVKVW-HVESRTCYTLKGHTEWVNC 458
           + T   +   + G   + +      ++      D +++V   V  R    L GH+  +  
Sbjct: 619 FTTNSFLGKLQLGAPITQLVYHRASELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITA 678

Query: 459 VKLHPKSFSCYSCSDDTTIRMWDIRTNTCL 488
               P      S S D+T+R WD+ T TC+
Sbjct: 679 FDFSPDGRWIVSASLDSTLRTWDLPTGTCI 708

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 89/214 (41%), Gaps = 60/214 (28%)

Query: 430 GSADKTVKVWHVES---RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
           GS++  + V++++S   R  Y  K H   V  + +   +    SC  D  +  +D  TN+
Sbjct: 566 GSSNGGISVYNLQSGIKRKVY--KMHKGSVTGLAVDGMNRKMVSCGLDGLVGFYDFTTNS 623

Query: 487 CLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELD 546
            L       G++Q   P+T      LV H                               
Sbjct: 624 FL-------GKLQLGAPIT-----QLVYHR------------------------------ 641

Query: 547 KKMPYPTHLLSCALDN-TIKLWEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGS 603
                 + L + ALD+ +I++ +  + R +R  +GH   +  +D + D   I+S S D +
Sbjct: 642 -----ASELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDGRWIVSASLDST 696

Query: 604 IKIWDLQSGKCMHTFHGRKLK--GSDVNTSSNPD 635
           ++ WDL +G C+    G +L+   ++V  S+N D
Sbjct: 697 LRTWDLPTGTCI---DGVRLESVATNVQFSANGD 727

>Kwal_47.17567
          Length = 590

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 64/125 (51%), Gaps = 8/125 (6%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGK-LIRRLTGHSDGVKTLYF--D 383
           I+   GH+D V  L +N  +L +GS D  +   D+ T +     +  H+  V  L +  +
Sbjct: 361 IRTIPGHIDRVACLSWNNHILTSGSRDRRILHRDVRTPQSSFEEIRTHNQEVCGLKWNVE 420

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVS---GSADKTVKV 438
           D KL +G  D  + V++  +         HT +V  M+   H++ I++   G+ADK +K+
Sbjct: 421 DNKLASGGNDNAVFVYDGTSRLPFLKLEEHTAAVKAMAWSPHRRGILATGGGTADKRLKI 480

Query: 439 WHVES 443
           W+V++
Sbjct: 481 WNVKT 485

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 65/149 (43%), Gaps = 7/149 (4%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGE- 405
           L  G  +  V I+D+   K IR + GH D V  L +++  L +GS D+ I   +  T + 
Sbjct: 341 LAVGQTNGLVNIFDVEKKKCIRTIPGHIDRVACLSWNNHILTSGSRDRRILHRDVRTPQS 400

Query: 406 CISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVESRTCY-TLKGHTEWVNCVKLH 462
                R H   V  +  +     + SG  D  V V+   SR  +  L+ HT  V  +   
Sbjct: 401 SFEEIRTHNQEVCGLKWNVEDNKLASGGNDNAVFVYDGTSRLPFLKLEEHTAAVKAMAWS 460

Query: 463 PKS---FSCYSCSDDTTIRMWDIRTNTCL 488
           P      +    + D  +++W+++T+  L
Sbjct: 461 PHRRGILATGGGTADKRLKIWNVKTSVKL 489

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 79/183 (43%), Gaps = 11/183 (6%)

Query: 311 RERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIR 368
           R+R  +  + R    + +E + H   V  L++N     L +G  D  V ++D  +     
Sbjct: 386 RDRRILHRDVRTPQSSFEEIRTHNQEVCGLKWNVEDNKLASGGNDNAVFVYDGTSRLPFL 445

Query: 369 RLTGHSDGVKTLYFDDQK---LITG--SLDKTIRVWNYITG---ECISTYRGHTDSVMSV 420
           +L  H+  VK + +   +   L TG  + DK +++WN  T      + T     + + S 
Sbjct: 446 KLEEHTAAVKAMAWSPHRRGILATGGGTADKRLKIWNVKTSVKLHDVDTASQVCNMIWSK 505

Query: 421 DSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
           ++++ I   G +   + +W   +      LKGH+  V  + L     +  S + D T+R 
Sbjct: 506 NTNEIITSHGYSKYNLTLWDGNTLEPMAILKGHSFRVLHMTLSTDGTTVVSGAGDETLRY 565

Query: 480 WDI 482
           W +
Sbjct: 566 WKL 568

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSI 604
           +HL     +  + +++V   +CIRT  GH++ V  ++ +N  + SGS D  I
Sbjct: 339 SHLAVGQTNGLVNIFDVEKKKCIRTIPGHIDRVACLSWNNHILTSGSRDRRI 390

>Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement
          Length = 367

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 66/127 (51%), Gaps = 12/127 (9%)

Query: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF------DDQKLITGSLDKTIRVWNYI 402
           +G  D  V ++D+ +G+  +++  H   ++ L F      + + L+TGS DKTI+ W+  
Sbjct: 96  SGGCDNVVKLFDVQSGQA-QQVGAHDSAIRHLRFIQCGPTNTECLVTGSWDKTIKYWDMR 154

Query: 403 TGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLH 462
             + +ST     D V ++DS +K++V  +A++ + +  + +      K  T   + +K  
Sbjct: 155 QPQPVSTLM-MPDRVYAMDSKQKLLVVATAERHIAIIDLNNPAT-IFKTAT---SPLKWQ 209

Query: 463 PKSFSCY 469
            +S SCY
Sbjct: 210 TRSVSCY 216

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 561 DNTIKLWEVRSGRCI-RTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMH 616
           DN +++W+V  G    R Q+ H   V     + D  ++ SG  D  +K++D+QSG+   
Sbjct: 57  DNKVRIWDVNGGMAQGRAQYEHQAPVLTTRWSNDGTKVASGGCDNVVKLFDVQSGQAQQ 115

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 10/103 (9%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLT-GHSDGVKTLYF--DDQKLITGSLDKTIRVWNYI 402
           L    S+D  V IWD+  G    R    H   V T  +  D  K+ +G  D  +++++  
Sbjct: 50  LFSVSSWDNKVRIWDVNGGMAQGRAQYEHQAPVLTTRWSNDGTKVASGGCDNVVKLFDVQ 109

Query: 403 TGECI------STYRGHTDSVMSVDSHKKIIVSGSADKTVKVW 439
           +G+        S  R H   +    ++ + +V+GS DKT+K W
Sbjct: 110 SGQAQQVGAHDSAIR-HLRFIQCGPTNTECLVTGSWDKTIKYW 151

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 17/77 (22%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRII-----------SGSHD 601
           T + S   DN +KL++V+SG+  +       G  D A  + R I           +GS D
Sbjct: 92  TKVASGGCDNVVKLFDVQSGQAQQV------GAHDSAIRHLRFIQCGPTNTECLVTGSWD 145

Query: 602 GSIKIWDLQSGKCMHTF 618
            +IK WD++  + + T 
Sbjct: 146 KTIKYWDMRQPQPVSTL 162

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 49/95 (51%), Gaps = 7/95 (7%)

Query: 356 VAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSL--DKTIRVWNYITGECISTYRGH 413
           V IWDLF+   I  L GH   +  +   +      S   D++IR+W+  TG+ +S    H
Sbjct: 161 VIIWDLFSETKIHNLLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGKQLSVGWSH 220

Query: 414 TDSV---MSVDSHKKIIVSGSADKTVKVWH-VESR 444
           T  +   M  D+  K+I S S D T +VW+ +ESR
Sbjct: 221 TARIWNLMFFDNDSKLI-SVSEDCTCRVWNIIESR 254

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 424 KKIIVSGSADKTVKVWHVESRT-CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
           K  + +G+    V +W + S T  + L GH   +  V L        SCSDD +IR+WD+
Sbjct: 149 KVYVNAGTVMGGVIIWDLFSETKIHNLLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDL 208

Query: 483 RTNTCLRVFRGHVGQV 498
            T   L V   H  ++
Sbjct: 209 ETGKQLSVGWSHTARI 224

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 4/80 (5%)

Query: 327 IQEFKGHMDGVL--TLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-- 382
           I    GH   +    L  N R + + S D ++ +WDL TGK +     H+  +  L F  
Sbjct: 172 IHNLLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGKQLSVGWSHTARIWNLMFFD 231

Query: 383 DDQKLITGSLDKTIRVWNYI 402
           +D KLI+ S D T RVWN I
Sbjct: 232 NDSKLISVSEDCTCRVWNII 251

 Score = 36.6 bits (83), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWDL 609
           ++ SC+ D +I+LW++ +G+ +   + H   +W++    ++ ++IS S D + ++W++
Sbjct: 193 YVASCSDDRSIRLWDLETGKQLSVGWSHTARIWNLMFFDNDSKLISVSEDCTCRVWNI 250

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 564 IKLWEVRSGRCIRTQFGHVEGVWDI-AADNFRIISG-SHDGSIKIWDLQSGK 613
           + +W++ S   I    GH   ++ +  ++N R ++  S D SI++WDL++GK
Sbjct: 161 VIIWDLFSETKIHNLLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGK 212

>Scas_512.3
          Length = 534

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 6/73 (8%)

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTVK---- 437
           D+ +++GS+D +IRV++  +G+ + TY  H   V  V  D   + I+S SAD++V     
Sbjct: 158 DRYVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPLNEFILSQSADRSVNIYQI 217

Query: 438 VWHVESRTCYTLK 450
           +W  +S T   LK
Sbjct: 218 IWDSDSNTIDKLK 230

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 6/75 (8%)

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGH---VEGV-WDIAADNFRIISGSHDGSIKIWDL 609
           +++S ++DN+I+++++ SG+ + T   H   V+GV WD    N  I+S S D S+ I+ +
Sbjct: 160 YVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPL--NEFILSQSADRSVNIYQI 217

Query: 610 QSGKCMHTFHGRKLK 624
                 +T    KLK
Sbjct: 218 IWDSDSNTIDKLKLK 232

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 24/33 (72%), Gaps = 2/33 (6%)

Query: 595 IISGSHDGSIKIWDLQSGKCMHTF--HGRKLKG 625
           ++SGS D SI+++D++SGK + T+  H   ++G
Sbjct: 161 VVSGSMDNSIRVFDIESGKLLGTYADHNHYVQG 193

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWNYI 402
           R + +GS D ++ ++D+ +GKL+     H+  V+ + +D  ++ +++ S D+++ ++  I
Sbjct: 159 RYVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPLNEFILSQSADRSVNIYQII 218

>Scas_510.5
          Length = 362

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 14/122 (11%)

Query: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF------DDQKLITGSLDKTIRVWNYI 402
           +G  D  V ++D+ +G+  +++  H   VK + F      + + L+TGS DK+I+ W+  
Sbjct: 95  SGGCDNIVKLFDVASGQS-QQIGMHDAPVKAVRFVNCGPSNTECLVTGSWDKSIKYWDMR 153

Query: 403 TGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVES------RTCYTLKGHTEWV 456
             + IST     D V ++DS ++++V G+A++ + + ++ +       T   LK  T  V
Sbjct: 154 QPQAISTVI-MPDRVYTMDSKQQLLVVGTAERHIAIINLNNPGSIFKTTLSPLKWQTRVV 212

Query: 457 NC 458
           +C
Sbjct: 213 SC 214

>Kwal_23.4118
          Length = 939

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 353 DTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTY 410
           D ++ + D  T K++R+L GHS+ + +  F  D + +I+ SLD T R W+  TG CI   
Sbjct: 565 DFSIVVVDAVTQKVVRQLWGHSNRISSFDFSPDGRWIISTSLDGTARTWDLPTGCCIDGI 624

Query: 411 RGHTDSVMS 419
           R   DSV +
Sbjct: 625 R--LDSVAT 631

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 6/86 (6%)

Query: 555 LLSCALDN-TIKLWEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 611
           L + ALD+ +I + +  + + +R  +GH   +  +D + D   IIS S DG+ + WDL +
Sbjct: 558 LFALALDDFSIVVVDAVTQKVVRQLWGHSNRISSFDFSPDGRWIISTSLDGTARTWDLPT 617

Query: 612 GKCMHTFHGRKLKGSDVNTSSNPDHD 637
           G C+    G +L     N   +P+ D
Sbjct: 618 GCCI---DGIRLDSVATNIRFSPNAD 640

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 62/149 (41%), Gaps = 12/149 (8%)

Query: 348 FTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWNYITGE 405
           F GS +  + +++L +G   ++   H   V  +  D  ++K+++  LD  +  +++    
Sbjct: 477 FVGSSNGGIGVYNLQSGLPRKKYRLHKKAVSGIAVDGMNRKMVSCGLDGIVGFYDF---- 532

Query: 406 CISTYRGHTD---SVMSVDSHKKIIVSGSA---DKTVKVWHVESRTCYTLKGHTEWVNCV 459
             S+Y G       V S+  H+   +   A      V V  V  +    L GH+  ++  
Sbjct: 533 SKSSYLGKLQLDAPVTSMVYHRSSDLFALALDDFSIVVVDAVTQKVVRQLWGHSNRISSF 592

Query: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCL 488
              P      S S D T R WD+ T  C+
Sbjct: 593 DFSPDGRWIISTSLDGTARTWDLPTGCCI 621

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 75/164 (45%), Gaps = 15/164 (9%)

Query: 333 HMDGVLTLQFNYRL---LFTGSYDTTVAIWDLFTGKLIRR-LTGHSD---GVKTLYFDDQ 385
           H +    L FN  +   L +GS DTTVA+WD+   K  +  LT H D    VK   F+  
Sbjct: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESN 244

Query: 386 KLITGSLDKTIRVWNY-ITGECISTYRGHTD-SVMSVDSHKK-IIVSGSADKTVKVWHVE 442
              T S DKT++V +  +  E +      +  + +S   H + ++ +   D  + ++ + 
Sbjct: 245 VFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMR 304

Query: 443 --SRTCYTLKGHTEWVNCVKLHPKS--FSCYSCSDDTTIRMWDI 482
             S   + + GH + V  V+  P +    C S SD   I +WD+
Sbjct: 305 DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDL 347

>YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear pore
           protein required for poly(A)+ RNA export, has WD (WD-40)
           repeats, functions in the nuclear export of the small
           ribosomal subunit [1098 bp, 365 aa]
          Length = 365

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 71/135 (52%), Gaps = 12/135 (8%)

Query: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF------DDQKLITGSLDKTIRVWNYI 402
           +G  D  + ++D+ +G+  +++  HS  +K L F      + + ++TGS DKTI+ W+  
Sbjct: 97  SGGCDNALKLYDIASGQ-TQQIGMHSAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMR 155

Query: 403 TGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLH 462
             + +ST     + V S+D+ + ++V  +A++ + + ++ + T    K  T   + +K  
Sbjct: 156 QPQPVSTVM-MPERVYSMDNKQSLLVVATAERHIAIINLANPTT-IFKATT---SPLKWQ 210

Query: 463 PKSFSCYSCSDDTTI 477
            +  +CY+ +D   I
Sbjct: 211 TRCVACYNEADGYAI 225

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 355 TVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRG 412
           ++ ++ +   K I +L GH+  +  L +  D++ L++ S DKT+R W        + + G
Sbjct: 317 SILVFSIGESKPIGKLVGHTKTLTVLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYG 376

Query: 413 HTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCYTL 449
           HT S+   D      ++S S D +V+VW V+      L
Sbjct: 377 HTQSITYADWLDDDRLISTSMDGSVRVWSVKQNALVGL 414

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 77/190 (40%), Gaps = 10/190 (5%)

Query: 427 IVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486
           +++G  +  +++W            H   V  ++ +  S    +   D    +W+  T T
Sbjct: 222 LITGVENGELRMWSFRGILQNVFNFHRSPVVSIEWNADSTHVLTSDVDNITIVWNALTGT 281

Query: 487 CLRVF--RGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRE 544
            L+ F  +   G     I +  I+    V     PG +  I     GE  P   + G  +
Sbjct: 282 ALQHFDLKDTTGNESLGIDVEWIETDKFVI----PGLQGSILVFSIGESKPIGKLVGHTK 337

Query: 545 LDKKMPYPTH---LLSCALDNTIKLWEVRSGRCIRTQFGHVEGV-WDIAADNFRIISGSH 600
               + Y +    LLS + D T++ W   +       +GH + + +    D+ R+IS S 
Sbjct: 338 TLTVLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYGHTQSITYADWLDDDRLISTSM 397

Query: 601 DGSIKIWDLQ 610
           DGS+++W ++
Sbjct: 398 DGSVRVWSVK 407

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 63/161 (39%), Gaps = 10/161 (6%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITG 404
           L TG  +  + +W  F G L      H   V ++ +  D   ++T  +D    VWN +TG
Sbjct: 222 LITGVENGELRMWS-FRGILQNVFNFHRSPVVSIEWNADSTHVLTSDVDNITIVWNALTG 280

Query: 405 ECISTY-----RGHTDSVMSVD--SHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVN 457
             +  +      G+    + V+     K ++ G     +     ES+    L GHT+ + 
Sbjct: 281 TALQHFDLKDTTGNESLGIDVEWIETDKFVIPGLQGSILVFSIGESKPIGKLVGHTKTLT 340

Query: 458 CVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQV 498
            +  +  +    S SDD T+R W          F GH   +
Sbjct: 341 VLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYGHTQSI 381

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 76/172 (44%), Gaps = 24/172 (13%)

Query: 343 NYRLLFTGSYDTTVAIWD--LFTGKLIR------RLTGHSDGVKTLYFDDQK------LI 388
           N  LL  G     + I+   L  GK+I        L GH D VK++ F  Q+      L 
Sbjct: 165 NKYLLAIGGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGDYLLC 224

Query: 389 TGSLDKTIRVWNYITGECISTYRGHTD--SVMSVDSHKKIIVSGSADKTVKVWHVESRTC 446
           +GS D+ IR+W   T + I          +++S   HK  I   S D  + + + E+   
Sbjct: 225 SGSQDRYIRIWRIRTNDLIDDSEDDETKLTLLSSKQHKFHI---SEDLRIGI-NFEA--- 277

Query: 447 YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQV 498
             + GH +WV+ ++ H       + + DT + +W+   ++ + V    +G++
Sbjct: 278 -LIIGHDDWVSSLQWHESKLQLLASTADTAVMIWEPDESSGVWVCSSRLGEM 328

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/230 (20%), Positives = 91/230 (39%), Gaps = 33/230 (14%)

Query: 356 VAIWDLFTGK---LIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGE----- 405
           +A+W+        +   L GH   V  + F      L++ S D  +++W Y   E     
Sbjct: 37  IALWNPLDADCRGIYATLKGHEAEVTCVKFMPGTDILVSASEDHHVKLWKYKAPESEELE 96

Query: 406 CISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKS 465
           CI T   ++ +++S+++   +IV GSA   V +W  E+    T     E+     + P  
Sbjct: 97  CIQTITHYSHTIVSIETLAGLIVIGSAGGLVSIWVPETEGSDTYIISHEYSLPRNVFPL- 155

Query: 466 FSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDI 525
             C+S S+    +       T +++F                   + V  E K  E  ++
Sbjct: 156 --CFSLSNVVGNKYLLAIGGTTVKIF-----------------IYSFVLSEGKVIENFNL 196

Query: 526 ASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCI 575
           A+   G +D    +  + +   + P    L S + D  I++W +R+   I
Sbjct: 197 AAELEGHEDWVKSIQFRHQ---ETPGDYLLCSGSQDRYIRIWRIRTNDLI 243

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 402 ITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWH---VESRTCY-TLKGHTEWVN 457
           +  E I         V S +  + ++  G A K + +W+    + R  Y TLKGH   V 
Sbjct: 4   VNSEAIFIGANKQTQVCSYNKARNVLAFG-AGKNIALWNPLDADCRGIYATLKGHEAEVT 62

Query: 458 CVKLHPKSFSCYSCSDDTTIRMWDIRT 484
           CVK  P +    S S+D  +++W  + 
Sbjct: 63  CVKFMPGTDILVSASEDHHVKLWKYKA 89

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 15/120 (12%)

Query: 329 EFKGHMDGVLTLQFNYR------LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF 382
           E +GH D V ++QF ++      LL +GS D  + IW + T  LI         +  L  
Sbjct: 199 ELEGHEDWVKSIQFRHQETPGDYLLCSGSQDRYIRIWRIRTNDLIDDSEDDETKLTLLSS 258

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSH--KKIIVSGSADKTVKVWH 440
              K     + + +R+   I  E +    GH D V S+  H  K  +++ +AD  V +W 
Sbjct: 259 KQHKF---HISEDLRI--GINFEALII--GHDDWVSSLQWHESKLQLLASTADTAVMIWE 311

>Kwal_56.24399
          Length = 369

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 80/199 (40%), Gaps = 27/199 (13%)

Query: 332 GHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGH----SDGVKTL-YFDD 384
           GH   VL  +F  +  L  +   D  + IWDL +G     + GH    S  + T    DD
Sbjct: 74  GHTRPVLACKFVKSGTLALSAGLDPHLCIWDLKSGH--NHVLGHCHRRSAAITTFDTLDD 131

Query: 385 QKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDS-HKKIIVSGSADKTVKVWHVES 443
            + +TGS D  + + +  TG  +  + GHT  V  V + +     S S D  +K+W   +
Sbjct: 132 TRAVTGSSDTRLALVDLHTGRKLRNFAGHTRVVNQVRALNTDRFASVSDDGALKIWDAHT 191

Query: 444 RT----------CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
           ++           +TL   +   +   L       Y+   D  IR +D+R N    +F  
Sbjct: 192 KSPVWQISSEFPLFTLTSSSSSSDDNIL-------YTSGLDPVIRAYDLRQNNGQELFNW 244

Query: 494 HVGQVQKVIPLTIIDAQNL 512
                  V  + I  ++NL
Sbjct: 245 STPHTDSVTSIHINASRNL 263

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 561 DNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNF-RIISGSHDGSIKIWD 608
           D  + L ++ +GR +R   GH   V  + A N  R  S S DG++KIWD
Sbjct: 140 DTRLALVDLHTGRKLRNFAGHTRVVNQVRALNTDRFASVSDDGALKIWD 188

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 17/75 (22%)

Query: 556 LSCALDNTIKLWEVRSGRCIRTQFGHVEG----------VWDIAADNFRIISGSHDGSIK 605
           LS  LD  + +W+++SG        HV G           +D   D+ R ++GS D  + 
Sbjct: 92  LSAGLDPHLCIWDLKSGH------NHVLGHCHRRSAAITTFD-TLDDTRAVTGSSDTRLA 144

Query: 606 IWDLQSGKCMHTFHG 620
           + DL +G+ +  F G
Sbjct: 145 LVDLHTGRKLRNFAG 159

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 62/145 (42%), Gaps = 4/145 (2%)

Query: 348 FTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWNYITGE 405
           F GS + ++ I+++ +G L ++   H   V  +  D  ++K+++  LD  +  +++    
Sbjct: 476 FIGSSNGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKST 535

Query: 406 CISTYRGHTDSVMSVDSHKKIIVSGSAD--KTVKVWHVESRTCYTLKGHTEWVNCVKLHP 463
            +   +        V      + + + D    V +  V  R    L GH+  +      P
Sbjct: 536 LLGKLKLDAPITAMVYHRSSDLFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSP 595

Query: 464 KSFSCYSCSDDTTIRMWDIRTNTCL 488
           +     S S D+TIR WD+ T  C+
Sbjct: 596 EGRWIVSASLDSTIRTWDLPTGGCI 620

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 3/64 (4%)

Query: 555 LLSCALDN-TIKLWEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 611
           L + ALD+ +I + +  + R +R  +GH   +  +D + +   I+S S D +I+ WDL +
Sbjct: 557 LFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWIVSASLDSTIRTWDLPT 616

Query: 612 GKCM 615
           G C+
Sbjct: 617 GGCI 620

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 565 KLWEVRSGRCIRTQF-----GHVEGVWDIAADNFRIISGSHDGSIKIWDLQSG--KCMHT 617
           + W++R+ R  R  F     G V+ V      NF  I GS +GSI I+++QSG  +  + 
Sbjct: 441 RTWDMRNKRVGRWTFDTTDDGFVKSVAMSQCGNFGFI-GSSNGSITIYNMQSGILRKKYK 499

Query: 618 FHGRKLKG 625
            H R + G
Sbjct: 500 LHKRAVTG 507

>Sklu_1659.2 YMR092C, Contig c1659 410-2251
          Length = 613

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 4/90 (4%)

Query: 351 SYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTY 410
           S D T+ I+ +    L+RR+ GH+ G+  L  +   L++GS D  +  W       +  Y
Sbjct: 315 SLDGTLNIFKIGEDSLVRRIEGHNKGITALVVN--PLVSGSYDGRVVQWINENEPHMENY 372

Query: 411 RGHTDSVMSVDSHKKIIVSGSADKTVKVWH 440
            G+   ++S+D+  KI+ + S D T+KV++
Sbjct: 373 HGNM--IVSIDNTDKIVSTVSWDDTLKVFN 400

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/70 (22%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGK 613
            +++ +LD T+ ++++     +R   GH +G+  +  +   ++SGS+DG +  W  ++  
Sbjct: 310 EIVALSLDGTLNIFKIGEDSLVRRIEGHNKGITALVVN--PLVSGSYDGRVVQWINENEP 367

Query: 614 CMHTFHGRKL 623
            M  +HG  +
Sbjct: 368 HMENYHGNMI 377

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 346 LLFTGSYDTTVAIWDL-FTGKLIRRLTGHSDGVKTLYFDDQK-LITGSLDKTIRVW 399
           L+ TGS DT + I+ +    K+I++L  H DGV  + + +++ +++  +D  I+ W
Sbjct: 553 LVATGSLDTHMFIYSVKRPMKIIKKLNAHKDGVSVVKWKNKETIVSAGVDACIKEW 608

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 11/75 (14%)

Query: 427 IVSGSADKTVKVWHVESRTCY-------TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
            V+ SAD T+K+W VES  C        TL      V   K H       + S D T+ +
Sbjct: 267 FVTSSADCTLKLWDVESSKCLQSWSLENTLSNQQVGVAVTKDH----EIVALSLDGTLNI 322

Query: 480 WDIRTNTCLRVFRGH 494
           + I  ++ +R   GH
Sbjct: 323 FKIGEDSLVRRIEGH 337

>Scas_718.6*
          Length = 546

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGS-LDKTIRVWNYIT 403
           L     + ++ ++ +   K I +L GH   +  + F+   + L+T S  D +IR+W+   
Sbjct: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401

Query: 404 GECISTYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHV 441
             C + + GH+ S++S+   +  +++S S D +V++W V
Sbjct: 402 ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/173 (18%), Positives = 75/173 (43%), Gaps = 16/173 (9%)

Query: 330 FKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKLIRRL--------TGHSDGVKT 379
           F  H   ++++++N   +   +   D    +W+   G +++             S GV  
Sbjct: 275 FNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDI 334

Query: 380 LYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD---SHKKIIVSGSADKTV 436
            + D  KL+   ++ +I V++    + I    GH  ++  ++   + + ++ S  +D ++
Sbjct: 335 EWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSI 394

Query: 437 KVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCL 488
           ++WH +   C     GH++ +  +          S S D ++R+W +  N CL
Sbjct: 395 RIWHGQKENCCNCFYGHSQSIISLSWINDDL-VISASMDGSVRIWSVVEN-CL 445

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 327 IQEFKGHMDGVLTLQFNY--RLLFTGS-YDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YF 382
           I +  GH   +  ++FN   RLL T S  D ++ IW            GHS  + +L + 
Sbjct: 362 IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWI 421

Query: 383 DDQKLITGSLDKTIRVWNYI 402
           +D  +I+ S+D ++R+W+ +
Sbjct: 422 NDDLVISASMDGSVRIWSVV 441

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 36/194 (18%), Positives = 76/194 (39%), Gaps = 13/194 (6%)

Query: 425 KIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484
           ++I++   +  +++W+ + R       H   +  +K +  S    S   D    +W+   
Sbjct: 251 ELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAIN 310

Query: 485 NTCLRVFRGHVGQVQKVIPLTI----IDAQNLVTHERKPGEEDDIASNGTGEDDPENGVN 540
              L+ F            L +    +D   LV     PG    I      ++ P   + 
Sbjct: 311 GIILQHFEPEQKLENNTESLGVDIEWVDKDKLVV----PGVNGSILVYSIDDNKPIGKLL 366

Query: 541 GQRELDKKMPYPTH----LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA-ADNFRI 595
           G +     + +  +    L S   D +I++W  +   C    +GH + +  ++  ++  +
Sbjct: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLV 426

Query: 596 ISGSHDGSIKIWDL 609
           IS S DGS++IW +
Sbjct: 427 ISASMDGSVRIWSV 440

>Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement
          Length = 411

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 45/87 (51%), Gaps = 4/87 (4%)

Query: 547 KKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGH---VEGVWDIAADNFRIISGSHDGS 603
           K  P    LLS +LD  +K+W    G   RT  GH   + G  +I      I+S S DG+
Sbjct: 148 KFFPSSQVLLSSSLDMRLKIWSALDGSNPRTIMGHKSIITGT-EIIERGRNILSCSKDGT 206

Query: 604 IKIWDLQSGKCMHTFHGRKLKGSDVNT 630
           +K+W+  SGK ++TF  R+ K   VN 
Sbjct: 207 VKLWECGSGKNIYTFTRRENKKDSVNA 233

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/267 (21%), Positives = 103/267 (38%), Gaps = 59/267 (22%)

Query: 367 IRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMS--VDS 422
           +R L GH++ +  + +  D   +++ S D  I +W+  TG   S     +  V+S  +  
Sbjct: 79  VRTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFTGLKKSAIPLLSQWVLSSAISP 138

Query: 423 HKKIIVSGSADKTVKVWHV------ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTT 476
              ++ S   D    V+ V      +       KGHT +++  +   +  +  + S D T
Sbjct: 139 SGNLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATEFLDER-TILTASGDMT 197

Query: 477 IRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPE 536
             MWDI  +  +  F  H+G V     LT+                 D+    TG     
Sbjct: 198 CAMWDIPKSKRVTEFIDHLGDV-----LTM-----------------DLPPANTGR---- 231

Query: 537 NGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNF--- 593
                         Y  + ++   D    LW+VR     ++ F       D++A  F   
Sbjct: 232 --------------YGHNFITGGSDGYAYLWDVRQPNSAQSFFISDS---DVSAIKFFNN 274

Query: 594 --RIISGSHDGSIKIWDLQSGKCMHTF 618
               ++GS DGS +++DL+S   + T+
Sbjct: 275 GESFMAGSDDGSARLFDLRSDCQISTY 301

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 336 GVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGS 391
           GV+++ F+   RL++    D   A+WD+  G++I ++ GH + +  +    D   +++ S
Sbjct: 364 GVISIDFSSSGRLMYACYADYGCAVWDIIKGEMIGKVDGHRNRINAVKTSPDGMAVVSSS 423

Query: 392 LDKTIRVW 399
            D T++VW
Sbjct: 424 WDMTLKVW 431

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/135 (19%), Positives = 62/135 (45%), Gaps = 9/135 (6%)

Query: 366 LIRRLTGHSDGVK-TLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--- 421
           +I    GH+  +  T + D++ ++T S D T  +W+    + ++ +  H   V+++D   
Sbjct: 167 VISIFKGHTCYISATEFLDERTILTASGDMTCAMWDIPKSKRVTEFIDHLGDVLTMDLPP 226

Query: 422 ----SHKKIIVSGSADKTVKVWHV-ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTT 476
                +    ++G +D    +W V +  +  +       V+ +K      S  + SDD +
Sbjct: 227 ANTGRYGHNFITGGSDGYAYLWDVRQPNSAQSFFISDSDVSAIKFFNNGESFMAGSDDGS 286

Query: 477 IRMWDIRTNTCLRVF 491
            R++D+R++  +  +
Sbjct: 287 ARLFDLRSDCQISTY 301

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 75/184 (40%), Gaps = 16/184 (8%)

Query: 324 LCTIQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLY 381
           L  ++  KGH + +  +++  +   + + S D  + IWD FTG     +   S  V +  
Sbjct: 76  LQPVRTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFTGLKKSAIPLLSQWVLSSA 135

Query: 382 FDDQKLITGS--LDKTIRVW-----NYITGECISTYRGHTDSVMSVDS-HKKIIVSGSAD 433
                 +  S  LD    V+     N I    IS ++GHT  + + +   ++ I++ S D
Sbjct: 136 ISPSGNLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATEFLDERTILTASGD 195

Query: 434 KTVKVWHV-ESRTCYTLKGHTEWVNCVKLHPKSFSCY-----SCSDDTTIRMWDIRTNTC 487
            T  +W + +S+       H   V  + L P +   Y     +   D    +WD+R    
Sbjct: 196 MTCAMWDIPKSKRVTEFIDHLGDVLTMDLPPANTGRYGHNFITGGSDGYAYLWDVRQPNS 255

Query: 488 LRVF 491
            + F
Sbjct: 256 AQSF 259

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 417 VMSVD--SHKKIIVSGSADKTVKVWHV-ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSD 473
           V+S+D  S  +++ +  AD    VW + +      + GH   +N VK  P   +  S S 
Sbjct: 365 VISIDFSSSGRLMYACYADYGCAVWDIIKGEMIGKVDGHRNRINAVKTSPDGMAVVSSSW 424

Query: 474 DTTIRMW 480
           D T+++W
Sbjct: 425 DMTLKVW 431

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 398 VWNYITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVW 439
           VW+ I GE I    GH + + +V +      +VS S D T+KVW
Sbjct: 388 VWDIIKGEMIGKVDGHRNRINAVKTSPDGMAVVSSSWDMTLKVW 431

>Scas_702.16
          Length = 816

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 69/155 (44%), Gaps = 25/155 (16%)

Query: 308 MVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDL---- 361
           +  ++   ++   +K L ++     H   V  L+F  N + L +GS D  + IW L    
Sbjct: 56  LSLKDEVPIDKELKKPLASMSR---HTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEER 112

Query: 362 -----FTGK-------LIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECI 407
                F G+       + +RL  H + ++ + +  D   L++  LD+ + +WN IT E +
Sbjct: 113 PIQPIFGGESEKERWAVRKRLVAHDNDIQDICWAPDSSLLVSVGLDRAVIIWNGITFEKL 172

Query: 408 STYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWH 440
             +  H   V  V  D   K   + S D+T+K++ 
Sbjct: 173 KRFDVHQSHVKGVIFDPANKYFATASDDRTMKIFR 207

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 41/100 (41%), Gaps = 19/100 (19%)

Query: 383 DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVE 442
           D +++ TG LD  IR+W                   SVDS K+I+   S    V +    
Sbjct: 28  DGKRVATGGLDGKIRIW-------------------SVDSIKQIVKILSLKDEVPIDKEL 68

Query: 443 SRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482
            +   ++  HT  V C+K  P      S SDD  + +W +
Sbjct: 69  KKPLASMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTL 108

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 61/125 (48%), Gaps = 8/125 (6%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDL-FTGKLIRRLTGHSDGVKTLYF--D 383
           I+   GH+D V  L +N  +L +GS D  +   D+            HS  V  L +  D
Sbjct: 322 IRTLSGHLDRVACLSWNQHILSSGSKDHKILHRDVRMPEHYFETANTHSQEVCGLKWNVD 381

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVS---GSADKTVKV 438
           + +L +G  D  + V++  + + +  +  H  +V  M+   H++  ++   G+AD+ +K+
Sbjct: 382 ENRLASGGNDNVVYVYDGPSKKPVLKFTEHNAAVKAMAWSPHRRATLATGGGTADRRLKI 441

Query: 439 WHVES 443
           W+V S
Sbjct: 442 WNVNS 446

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 64/145 (44%), Gaps = 9/145 (6%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLIT-----GSLDKTIRVWNY 401
           L +G  D  V ++D  + K + + T H+  VK + +   +  T     G+ D+ +++WN 
Sbjct: 385 LASGGNDNVVYVYDGPSKKPVLKFTEHNAAVKAMAWSPHRRATLATGGGTADRRLKIWNV 444

Query: 402 ITG---ECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVN 457
            +G     + T     + V S ++ + +   G +   + +W   +      LKGH+  V 
Sbjct: 445 NSGVRLNDVDTGSQVCNMVWSKNTDEIVTSHGYSKFNLTLWDCPTLEPLAVLKGHSFRVL 504

Query: 458 CVKLHPKSFSCYSCSDDTTIRMWDI 482
            + L     +  S + D T+R W +
Sbjct: 505 HLTLSTDGTTIVSGAGDETLRYWKL 529

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 356 VAIWDLFTGKLIRRLTGHSDGVK--TLYFDDQKLITGSLDKTIRVWNYITGECISTYRGH 413
           + +WD  T + +  L GHS  V   TL  D   +++G+ D+T+R W        S +   
Sbjct: 482 LTLWDCPTLEPLAVLKGHSFRVLHLTLSTDGTTIVSGAGDETLRYWKLFGK---SKFGNQ 538

Query: 414 TDSVMS 419
           +DSV++
Sbjct: 539 SDSVLT 544

>KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces
           cerevisiae YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis, start by similarity
          Length = 582

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 63/123 (51%), Gaps = 8/123 (6%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGK-LIRRLTGHSDGVKTLYF--D 383
           I+   GH+D V  L +N  +L +GS D  +   D+   +    ++  HS  V  L +  +
Sbjct: 353 IRTLSGHVDRVACLSWNNHVLSSGSRDRKILHRDVRAPEPFFEQIDTHSQEVCGLKWNVN 412

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVS---GSADKTVKV 438
           + KL +G  D  + V++    + + +   HT +V  M+   H + +++   G+ADK +K+
Sbjct: 413 ENKLASGGNDNMVYVYDGTLRQPMLSMEEHTAAVKAMAWSPHTRGVLATGGGTADKKLKI 472

Query: 439 WHV 441
           W++
Sbjct: 473 WNI 475

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 49/97 (50%), Gaps = 5/97 (5%)

Query: 350 GSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD-QKLIT--GSLDKTIRVWNYITGEC 406
           G+ D  + IW++     +  +   S     L+  +  ++IT  G     + +WNY T E 
Sbjct: 464 GTADKKLKIWNISKAVKLNEVDTGSQLCNMLWSKNTDEIITSHGYSKYNLTLWNYPTLEP 523

Query: 407 ISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHV 441
           ++  +GH+  V  +++ +    +VSG+ D+T++ W +
Sbjct: 524 MAVLKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKL 560

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 62/143 (43%), Gaps = 7/143 (4%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGE- 405
           L  G     V I+D+   K IR L+GH D V  L +++  L +GS D+ I   +    E 
Sbjct: 333 LAVGLSSGIVEIYDVLKNKCIRTLSGHVDRVACLSWNNHVLSSGSRDRKILHRDVRAPEP 392

Query: 406 CISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVESR-TCYTLKGHTEWVNCVKLH 462
                  H+  V  +  + ++  + SG  D  V V+    R    +++ HT  V  +   
Sbjct: 393 FFEQIDTHSQEVCGLKWNVNENKLASGGNDNMVYVYDGTLRQPMLSMEEHTAAVKAMAWS 452

Query: 463 PKS---FSCYSCSDDTTIRMWDI 482
           P +    +    + D  +++W+I
Sbjct: 453 PHTRGVLATGGGTADKKLKIWNI 475

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 553 THLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSI 604
           +HL        +++++V   +CIRT  GHV+ V  ++ +N  + SGS D  I
Sbjct: 331 SHLAVGLSSGIVEIYDVLKNKCIRTLSGHVDRVACLSWNNHVLSSGSRDRKI 382

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/152 (19%), Positives = 60/152 (39%), Gaps = 7/152 (4%)

Query: 355 TVAIWDLFTGKLIRRLTGHSDGVKTLYFDD-QKLITGSLDKTIRVWNYITGECISTYRGH 413
           ++ + D  T  +    T  SD     + D    L  G     + +++ +  +CI T  GH
Sbjct: 300 SIFLSDNTTNDVTHLATSESDFTSLSWVDSGSHLAVGLSSGIVEIYDVLKNKCIRTLSGH 359

Query: 414 TDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYT----LKGHTEWVNCVKLHPKSFSCY 469
            D V  +  +  ++ SGS D+  K+ H + R        +  H++ V  +K +       
Sbjct: 360 VDRVACLSWNNHVLSSGSRDR--KILHRDVRAPEPFFEQIDTHSQEVCGLKWNVNENKLA 417

Query: 470 SCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
           S  +D  + ++D      +     H   V+ +
Sbjct: 418 SGGNDNMVYVYDGTLRQPMLSMEEHTAAVKAM 449

>Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement
          Length = 569

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 85/206 (41%), Gaps = 33/206 (16%)

Query: 440 HVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ 499
           ++E    +    HT  VN ++L+ K     S   D  I  WD+ T  C+  F+G V Q+ 
Sbjct: 263 YMEGSISHYFSKHTSVVNQLRLNDKEDKFISGGWDKQILEWDLNTGDCVNEFKGSVAQLS 322

Query: 500 KVI--PL-TIIDAQNLVTHERKPGEE------DDIASNGTGEDDPENGVNGQRELDKKMP 550
            +   PL + +D  +LV  E    +E      DD+ S    ED+ E  ++   + D +  
Sbjct: 323 SLEFRPLFSTVDIDSLVEKEPFQKQEQIQQKDDDMDSLFGDEDEEEKRMDLDTQSDDRNR 382

Query: 551 YPTH------------------LLSCALDNTIKLWEVRSGR--CIRTQFGHVEGVWDIAA 590
                                  L+ +++ +I +W+ R+     +  Q G     W ++A
Sbjct: 383 QEKQSMQEISKNTLKTSCDESIFLTSSINGSIHVWDRRTPAKPVVGLQRGPQVPPWCMSA 442

Query: 591 ----DNFRIISGSHDGSIKIWDLQSG 612
               D  RI +G  +  ++ +DL+ G
Sbjct: 443 CWSMDGDRIYAGRRNAVVEEFDLKMG 468

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 364 GKLIRRLTGHSDGVKTLYFDDQ--KLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD 421
           G +    + H+  V  L  +D+  K I+G  DK I  W+  TG+C++ ++G    + S++
Sbjct: 266 GSISHYFSKHTSVVNQLRLNDKEDKFISGGWDKQILEWDLNTGDCVNEFKGSVAQLSSLE 325

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 594 RIISGSHDGSIKIWDLQSGKCMHTFHG 620
           + ISG  D  I  WDL +G C++ F G
Sbjct: 290 KFISGGWDKQILEWDLNTGDCVNEFKG 316

>Kwal_33.13515
          Length = 398

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 64/162 (39%), Gaps = 28/162 (17%)

Query: 354 TTVAIWDLFTGKLIRRL-TGHSDGVKTLYFDDQKLITGSL-----------DKTIR---V 398
           + ++IWD  TG LI+   TG S G    Y+       G+L           DK      V
Sbjct: 121 SRISIWDASTGALIKSFETGLSSGNYKCYYSPNGKWFGALVENGEFCLFDVDKNYELCSV 180

Query: 399 WNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVES-------RTCYTLKG 451
                GE +++    T    S D   K + +G     + ++ VE        R C    G
Sbjct: 181 SQLCAGENLASLNKVTALQWSHDG--KWLYAGFESGEIVLFEVEMAAVKLKVRAC----G 234

Query: 452 HTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRG 493
           HT  + C+KL P +    + S DT    WD+ +  C RV  G
Sbjct: 235 HTGAITCMKLDPDNRFLVAGSLDTICSFWDLSSMCCERVING 276

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 66/145 (45%), Gaps = 14/145 (9%)

Query: 314 FKVESNWRKGLCTIQEF-----KGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTG-- 364
           F V+ N+   LC++ +         ++ V  LQ+++  + L+ G     + ++++     
Sbjct: 169 FDVDKNYE--LCSVSQLCAGENLASLNKVTALQWSHDGKWLYAGFESGEIVLFEVEMAAV 226

Query: 365 KLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD- 421
           KL  R  GH+  +  +  D  ++ L+ GSLD     W+  +  C     G   S++ +D 
Sbjct: 227 KLKVRACGHTGAITCMKLDPDNRFLVAGSLDTICSFWDLSSMCCERVINGFDTSILDLDL 286

Query: 422 SHKKIIVSGSADKTVKVWHVESRTC 446
           S   + V   +D   +++ +ES  C
Sbjct: 287 SRDGVAVGLCSDNQTRIYLIESGAC 311

>YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anaphase
           promoting complex (APC), required for microtubule
           function at mitosis and for exit from anaphase, contains
           WD (WD-40) repeats [1833 bp, 610 aa]
          Length = 610

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 72/165 (43%), Gaps = 19/165 (11%)

Query: 350 GSYDTTVAIWDLFTGKLIRRL-TGHSDGVKTLYFDDQKLITGSLDKTIRVWNY-ITGECI 407
           G  D    IWD+ T  LIR + +G    + +L + D  + TGS    I++ +  I    +
Sbjct: 319 GKEDGNTEIWDVETMSLIRTMRSGLGVRIGSLSWLDTLIATGSRSGEIQINDVRIKQHIV 378

Query: 408 STYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVESRTC---YTLKGHTEWVNCVKLH 462
           ST+  HT  V  +S  S    + SG  D TV +W  ++RT    ++ K HT  V  +   
Sbjct: 379 STWAEHTGEVCGLSYKSDGLQLASGGNDNTVMIW--DTRTSLPQFSKKTHTAAVKALSWC 436

Query: 463 PKSFSCYSCSDDTT---IRMWDIRT-------NTCLRVFRGHVGQ 497
           P S +  +     T   I  W+  T       NT  +V   H GQ
Sbjct: 437 PYSPNILASGGGQTDKHIHFWNSITGARVGSINTGSQVSSLHWGQ 481

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 62/160 (38%), Gaps = 19/160 (11%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLY---FDDQKLITGS--LDKTIRVWNY 401
           L +G  D TV IWD  T         H+  VK L    +    L +G    DK I  WN 
Sbjct: 400 LASGGNDNTVMIWDTRTSLPQFSKKTHTAAVKALSWCPYSPNILASGGGQTDKHIHFWNS 459

Query: 402 ITGECISTY------------RGHTDSVMSVDSHKKIIVSGSADKTVKVWHVES--RTCY 447
           ITG  + +             + HT +   + + + +   G+ +  + V++ E+  +   
Sbjct: 460 ITGARVGSINTGSQVSSLHWGQSHTSTNGGMMNKEIVATGGNPENAISVYNYETKFKVAE 519

Query: 448 TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTC 487
            +  H   + C +L P   +  +   D  ++ + I    C
Sbjct: 520 VVHAHEARICCSQLSPDGTTLATVGGDENLKFYKIFDPRC 559

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 65/167 (38%), Gaps = 5/167 (2%)

Query: 340 LQFNYRLLFTGSYDTTVAIWDLFTG--KLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIR 397
           L ++ + +   + DT + +W+  TG   L+      +    T   DD  +  G  D    
Sbjct: 267 LSWSKKNVLAIALDTALYLWNATTGDVSLLTDFENTTICSVTWSDDDCHISIGKEDGNTE 326

Query: 398 VWNYITGECISTYR-GHTDSVMSVDSHKKIIVSGSADKTVKV--WHVESRTCYTLKGHTE 454
           +W+  T   I T R G    + S+     +I +GS    +++    ++     T   HT 
Sbjct: 327 IWDVETMSLIRTMRSGLGVRIGSLSWLDTLIATGSRSGEIQINDVRIKQHIVSTWAEHTG 386

Query: 455 WVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKV 501
            V  +          S  +D T+ +WD RT+      + H   V+ +
Sbjct: 387 EVCGLSYKSDGLQLASGGNDNTVMIWDTRTSLPQFSKKTHTAAVKAL 433

>Scas_719.30
          Length = 940

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 13/105 (12%)

Query: 541 GQRELDK---KMPY--PTHLLSCALDN-TIKLWEVRSGRCIRTQFGHVEGV--WDIAADN 592
           G+ +LD    KM Y   + L +  LD+ +I L +  + R +R  +GH   +   D + D 
Sbjct: 539 GKLQLDAPITKMVYHRSSDLFALILDDLSIVLIDAVTQRVVRQFWGHSNRITALDFSPDG 598

Query: 593 FRIISGSHDGSIKIWDLQSGKCMHTFHGRKLK--GSDVNTSSNPD 635
             I+S S D +I+ WDL +G C+    G KL+   +DV  S N D
Sbjct: 599 RWIVSASLDSTIRTWDLPTGGCI---DGIKLESVATDVKFSPNGD 640

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 68/153 (44%), Gaps = 20/153 (13%)

Query: 348 FTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGSLDKTIRVWNYITGE 405
           F GS +  ++++++ +G L ++   H   V  +  D  ++K+++  LD  +  +++    
Sbjct: 477 FVGSSNGGISVFNMQSGILRKKYRLHKKTVTGIALDGMNRKMVSCGLDGIVGFYDF---- 532

Query: 406 CISTYRGHTDSVMSVDSH-KKIIVSGSAD---------KTVKVWHVESRTCYTLKGHTEW 455
             ST+ G     + +D+   K++   S+D           V +  V  R      GH+  
Sbjct: 533 NKSTFLGK----LQLDAPITKMVYHRSSDLFALILDDLSIVLIDAVTQRVVRQFWGHSNR 588

Query: 456 VNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCL 488
           +  +   P      S S D+TIR WD+ T  C+
Sbjct: 589 ITALDFSPDGRWIVSASLDSTIRTWDLPTGGCI 621

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIR--RLTGHSDGVKTLYF 382
           +++F GH + +  L F  + R + + S D+T+  WDL TG  I   +L   +  VK    
Sbjct: 579 VRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGIKLESVATDVKFSPN 638

Query: 383 DDQKLITGSLDKTIRVWN 400
            D    T  +   I +WN
Sbjct: 639 GDMLATTHVIGNGIYIWN 656

>KLLA0E20779g complement(1841092..1842207) similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2 required for
           nuclear pore complex structure and function, start by
           similarity
          Length = 371

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 55/96 (57%), Gaps = 8/96 (8%)

Query: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF------DDQKLITGSLDKTIRVWNYI 402
           +G  D  + ++D+ TG+  +++  H+  V++L F      + + + TGS DKT++ W+  
Sbjct: 96  SGGCDNVLKVFDVTTGQA-QQIGQHNSAVQSLRFVSCGPTNQECIATGSWDKTVKYWDLR 154

Query: 403 TGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKV 438
           + + I T +   + V  +D+ +K++V G A++ + V
Sbjct: 155 SPQPIMTLQ-MPERVYCMDASQKLMVVGMAERHIAV 189

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 346 LLFTGSYDTTVAIWDLFTGKLIRRLT-GHSDGVKTLYF--DDQKLITGSLDKTIRVWNYI 402
           +    S+D+ V IWD+ +G    R    H   V T  +  D  K+ +G  D  ++V++  
Sbjct: 50  MFSVSSWDSKVRIWDVQSGSPQGRAQYDHQAPVLTTRWSIDGTKVASGGCDNVLKVFDVT 109

Query: 403 TGECISTYRGHTDSVMSV------DSHKKIIVSGSADKTVKVWHVES 443
           TG+     + H  +V S+       ++++ I +GS DKTVK W + S
Sbjct: 110 TGQAQQIGQ-HNSAVQSLRFVSCGPTNQECIATGSWDKTVKYWDLRS 155

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 7/59 (11%)

Query: 561 DNTIKLWEVRSGRCI-RTQFGHVEGV----WDIAADNFRIISGSHDGSIKIWDLQSGKC 614
           D+ +++W+V+SG    R Q+ H   V    W I  D  ++ SG  D  +K++D+ +G+ 
Sbjct: 57  DSKVRIWDVQSGSPQGRAQYDHQAPVLTTRWSI--DGTKVASGGCDNVLKVFDVTTGQA 113

>Scas_670.21
          Length = 595

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 62/125 (49%), Gaps = 8/125 (6%)

Query: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDL-FTGKLIRRLTGHSDGVKTLYF--D 383
           ++   GH+D V  L +N  +L +GS D  +   D+        RL  HS  V  L +  +
Sbjct: 366 VRTLSGHVDRVACLSWNGHILTSGSRDHNILHRDVRMPDPFFERLNTHSQEVCGLQWNTE 425

Query: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVS---GSADKTVKV 438
           + KL +G  D  + V++  +   +  +  H  +V ++    HK+ I++   G+ D+ +K+
Sbjct: 426 ENKLASGGNDNVVCVYDGTSRNPMIKFIEHKAAVKALAWSPHKRGILATGGGTVDRRLKI 485

Query: 439 WHVES 443
           W+V +
Sbjct: 486 WNVNT 490

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%)

Query: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTI 396
           L  G  +  V I+D+   K +R L+GH D V  L ++   L +GS D  I
Sbjct: 346 LAVGQGNGLVEIYDVVKRKCVRTLSGHVDRVACLSWNGHILTSGSRDHNI 395

>Kwal_55.21144
          Length = 570

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 64/288 (22%), Positives = 120/288 (41%), Gaps = 28/288 (9%)

Query: 331 KGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRL-TGHSDG-VKTLYF--DD 384
           +GH D +LTL    + + + TG  D  + IW   +   ++ + T    G V +L F  + 
Sbjct: 230 EGHYDEILTLAASPDGKYVITGGRDRKLIIWSTESLAPVKVIPTKDRRGEVLSLVFRKNS 289

Query: 385 QKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDS--HKKIIVSGSADKTVKVWHVE 442
            +L     D  IR ++      +    GH D V+ + +   ++ +  GS D+T  +W + 
Sbjct: 290 DQLYAACADYKIRTYSINQFSQLEILYGHQDLVVGISALGMERCVTVGSRDRTAMLWKIA 349

Query: 443 SRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVI 502
             T  T +G  +    +K   K  +  S + +      DI  +   R F    G +  V 
Sbjct: 350 DETRLTFRGGDDPERLLKRWIKQNTTKSDTGE------DITPDESERPFFYGEGSIDCV- 402

Query: 503 PLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHL-LSCALD 561
             T+ID  + +T      +  +I+     +  P   +  +R      P PT   +S   D
Sbjct: 403 --TMIDDSHFITG----SDNGNISLWSLSKKKP---LYTERTAHGVAPAPTSTQISAEAD 453

Query: 562 NTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDL 609
              +  ++++ +  +  +  +  +  I   N   +SGS DGS++IW L
Sbjct: 454 EQKRNLQLQNQKIAQPYW--ITALHAIPYSNV-FVSGSWDGSLRIWKL 498

>KLLA0F06754g complement(650475..651509) similar to sp|P53011
           Saccharomyces cerevisiae YGL100w SEH1 nuclear pore
           protein, start by similarity
          Length = 344

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 63/150 (42%), Gaps = 34/150 (22%)

Query: 370 LTGHSDGVKTLYFD-----------DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVM 418
           LTGHSD V  + +D           DQ +    LDK    W     E   +++ H  S++
Sbjct: 5   LTGHSDLVHDISYDFYGRRVATCSSDQHIKVFKLDKETNEW-----ELSESWKAHDSSIV 59

Query: 419 SVD----SHKKIIVSGSADKTVKVWHVE-----------SRTCYTLKGHTEWVNCVKLHP 463
           S+D       +II S S DKT+K+W  +            + C TL   T  +  VK  P
Sbjct: 60  SLDWAAPEFGRIIASVSYDKTIKLWEEDPDALELSGKRWQKLC-TLNDATGPLFSVKFAP 118

Query: 464 K--SFSCYSCSDDTTIRMWDIRTNTCLRVF 491
                   +  +D  +R++D   ++ LR +
Sbjct: 119 SHLGLRLAALGNDGKLRLYDALESSDLRSW 148

>Kwal_47.17465
          Length = 800

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 58/128 (45%), Gaps = 21/128 (16%)

Query: 333 HMDGVLTLQFNY--RLLFTGSYDTTVAIWD--------LFTGK-------LIRRLTGHSD 375
           H   V  ++F+     L +GS D  + IW+        +F  +       + RRL  H +
Sbjct: 21  HTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRRLVAHDN 80

Query: 376 GVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV--DSHKKIIVSGS 431
            ++ + +  D   L+T  LD+++ VWN  T E I  +  H   V  V  D   K   + S
Sbjct: 81  DIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKIKRFDVHQSLVKGVIFDPANKYFATAS 140

Query: 432 ADKTVKVW 439
            D+TV+++
Sbjct: 141 DDRTVRIF 148

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 89/225 (39%), Gaps = 24/225 (10%)

Query: 403 TGECISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVESRTCYTL---KGHTEWVN 457
           T E  +T  GH D +++V +    K +V+G  D+ + VW  ES +   +   K     V 
Sbjct: 227 TNEYENTTEGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVL 286

Query: 458 CVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHER 517
            +     S   ++   D  +R + I   + L V  GH   V  +  L++     + + +R
Sbjct: 287 SLAFRKNSDQLFASCADYKVRTYAINQFSQLEVLYGHQDLVVDISALSMERCVTVGSRDR 346

Query: 518 -----KPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSG 572
                K  +E  +   G GED PE  +    + + K      +     ++  K +   S 
Sbjct: 347 TAMLWKIADETRLTFRG-GED-PERLLKRWLKQNSKELENGEIEPAKEEDAPKFYGEGSI 404

Query: 573 RCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHT 617
            C+               D+   I+GS +G+I +W L   K + T
Sbjct: 405 DCV------------CMVDDSHFITGSDNGNISLWSLSKKKPIFT 437

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 57/129 (44%), Gaps = 8/129 (6%)

Query: 331 KGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRL-TGHSDG-VKTLYF--DD 384
           +GH D +LT+    + + + TG  D  + +W   +   ++ + T    G V +L F  + 
Sbjct: 235 EGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVLSLAFRKNS 294

Query: 385 QKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD--SHKKIIVSGSADKTVKVWHVE 442
            +L     D  +R +       +    GH D V+ +   S ++ +  GS D+T  +W + 
Sbjct: 295 DQLFASCADYKVRTYAINQFSQLEVLYGHQDLVVDISALSMERCVTVGSRDRTAMLWKIA 354

Query: 443 SRTCYTLKG 451
             T  T +G
Sbjct: 355 DETRLTFRG 363

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 6/69 (8%)

Query: 336 GVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHS---DGVKTLYFDDQKLITG 390
           G+++L F+   RLL+    +    +WD   G+++ RL GHS    GV+T   D   + TG
Sbjct: 354 GIVSLDFSISGRLLYACYTEYGCIVWDTLRGEIVGRLEGHSSRISGVRT-SPDGMCVCTG 412

Query: 391 SLDKTIRVW 399
           S D T+++W
Sbjct: 413 SWDSTMKLW 421

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 50/254 (19%), Positives = 101/254 (39%), Gaps = 53/254 (20%)

Query: 370 LTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMS--VDSHKK 425
           L GH++ +    +  D + +++ S D  + +W+ ++G   +     +  V++  +   + 
Sbjct: 84  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDPMSGLKKNAIPLDSQWVLACAISPSRN 143

Query: 426 IIVSGSADKTVKVWHV--ESRT----CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479
           ++ SG       ++ +  E+RT        KGHT +V+ ++      S  + S D T  +
Sbjct: 144 LVASGGLSNNCTIYRISQENRTQQKIVSIFKGHTCYVSDLEFINNE-SILTASGDMTCAL 202

Query: 480 WDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGV 539
           WDI  +  +  +  H+G    V+ L++                            P  G 
Sbjct: 203 WDIPKSKRVSEYSDHLGD---VLTLSV----------------------------PPAGT 231

Query: 540 NGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDI--AADNFRIIS 597
                      Y +   S   D  + LW+ RS   ++  F     +  +   +D   II+
Sbjct: 232 TS---------YDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSDGNSIIT 282

Query: 598 GSHDGSIKIWDLQS 611
           GS DG  +++DL+S
Sbjct: 283 GSDDGIARLFDLRS 296

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 18/82 (21%)

Query: 374 SDGVKTLYFDDQKLITGSLDKTIR--------------VWNYITGECISTYRGHTDSVMS 419
           ++ +++ Y D+Q ++  SLD +I               VW+ + GE +    GH+  +  
Sbjct: 342 AETIRSSYLDNQGIV--SLDFSISGRLLYACYTEYGCIVWDTLRGEIVGRLEGHSSRISG 399

Query: 420 VDSHKK--IIVSGSADKTVKVW 439
           V +      + +GS D T+K+W
Sbjct: 400 VRTSPDGMCVCTGSWDSTMKLW 421

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,647,866
Number of extensions: 992193
Number of successful extensions: 7760
Number of sequences better than 10.0: 427
Number of HSP's gapped: 5446
Number of HSP's successfully gapped: 1660
Length of query: 662
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 554
Effective length of database: 12,857,365
Effective search space: 7122980210
Effective search space used: 7122980210
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)