Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L00759g30630115720.0
Scas_715.4729730111681e-162
YER055C (HIS1)29730111231e-156
KLLA0F27489g29730110961e-151
ADL081C29730110011e-137
Kwal_23.57792482528871e-120
KLLA0A06325g18334652.1
CAGL0B01573g223109652.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L00759g
         (301 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L00759g 93848..94768 highly similar to sp|P00498 Saccharomy...   610   0.0  
Scas_715.47                                                           454   e-162
YER055C (HIS1) [1484] chr5 complement(264891..265784) ATP phosph...   437   e-156
KLLA0F27489g 2544518..2545411 highly similar to sp|P00498 Saccha...   426   e-151
ADL081C [1660] [Homologous to ScYER055C (HIS1) - SH] (540943..54...   390   e-137
Kwal_23.5779                                                          346   e-120
KLLA0A06325g <576837..577388 FALSORF, hypothetical start FALSORF...    30   2.1  
CAGL0B01573g complement(144100..144771) highly similar to tr|Q03...    30   2.5  

>CAGL0L00759g 93848..94768 highly similar to sp|P00498 Saccharomyces
           cerevisiae YER055c HIS1, start by similarity
          Length = 306

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/301 (100%), Positives = 301/301 (100%)

Query: 1   MDFVNHLNDRLLFAVPKKGRLYEKTKQLLNGSDIKFNRSNRLDIALCTTLPIALIFLPAA 60
           MDFVNHLNDRLLFAVPKKGRLYEKTKQLLNGSDIKFNRSNRLDIALCTTLPIALIFLPAA
Sbjct: 1   MDFVNHLNDRLLFAVPKKGRLYEKTKQLLNGSDIKFNRSNRLDIALCTTLPIALIFLPAA 60

Query: 61  DIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKLQVQVPEKDRKYTDPKQLV 120
           DIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKLQVQVPEKDRKYTDPKQLV
Sbjct: 61  DIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKLQVQVPEKDRKYTDPKQLV 120

Query: 121 GKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGGSVEASCALGVGDAIVDLVES 180
           GKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGGSVEASCALGVGDAIVDLVES
Sbjct: 121 GKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGGSVEASCALGVGDAIVDLVES 180

Query: 181 GETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELIEVIKSRIQGVLTAQRYVCCSYN 240
           GETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELIEVIKSRIQGVLTAQRYVCCSYN
Sbjct: 181 GETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELIEVIKSRIQGVLTAQRYVCCSYN 240

Query: 241 TPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMIERKRKADIMDELKRKGASDIMVFE 300
           TPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMIERKRKADIMDELKRKGASDIMVFE
Sbjct: 241 TPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMIERKRKADIMDELKRKGASDIMVFE 300

Query: 301 I 301
           I
Sbjct: 301 I 301

>Scas_715.47
          Length = 297

 Score =  454 bits (1168), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 221/301 (73%), Positives = 260/301 (86%), Gaps = 9/301 (2%)

Query: 1   MDFVNHLNDRLLFAVPKKGRLYEKTKQLLNGSDIKFNRSNRLDIALCTTLPIALIFLPAA 60
           MD VNHLNDRLLFA+PKKGRLYEK+  +LNGSDIKF+RS RLDIALCTTLPIALIFLPAA
Sbjct: 1   MDLVNHLNDRLLFAIPKKGRLYEKSVTILNGSDIKFHRSQRLDIALCTTLPIALIFLPAA 60

Query: 61  DIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKLQVQVPEKDRKYTDPKQLV 120
           DIP FVGEG+CDLGITG+DQV+E+ + ++DL +DL FG CKLQVQVP  +  YT P+QL+
Sbjct: 61  DIPMFVGEGRCDLGITGVDQVREAKM-DVDLPIDLKFGSCKLQVQVP-VNGPYTKPEQLI 118

Query: 121 GKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGGSVEASCALGVGDAIVDLVES 180
           GKTIVSSF  L+ +YF +LE    G P +K++TK+KYVGGSVEASCALGV DAIVDLVES
Sbjct: 119 GKTIVSSFTNLTEEYFAKLE----GVPAEKMTTKVKYVGGSVEASCALGVADAIVDLVES 174

Query: 181 GETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELIEVIKSRIQGVLTAQRYVCCSYN 240
           GETMRAAGLIDIATVLETSA++I+++ P+ DK   +LIE IKSRI+GV+TAQRYVCC+YN
Sbjct: 175 GETMRAAGLIDIATVLETSAHVIESKNPRSDK---DLIETIKSRIEGVITAQRYVCCNYN 231

Query: 241 TPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMIERKRKADIMDELKRKGASDIMVFE 300
            PE  L +LL +TPGRR PTISK+D DGWVAVNSMIER +K +IMDELK+KGA+DIMVFE
Sbjct: 232 APEDKLSQLLTITPGRRGPTISKIDSDGWVAVNSMIERSKKGEIMDELKKKGAADIMVFE 291

Query: 301 I 301
           I
Sbjct: 292 I 292

>YER055C (HIS1) [1484] chr5 complement(264891..265784) ATP
           phosphoribosyltransferase, first step in histidine
           biosynthesis pathway [894 bp, 297 aa]
          Length = 297

 Score =  437 bits (1123), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 215/301 (71%), Positives = 254/301 (84%), Gaps = 9/301 (2%)

Query: 1   MDFVNHLNDRLLFAVPKKGRLYEKTKQLLNGSDIKFNRSNRLDIALCTTLPIALIFLPAA 60
           MD VNHL DRLLFA+PKKGRLY K+  +LNG+DI F+RS RLDIAL T+LP+AL+FLPAA
Sbjct: 1   MDLVNHLTDRLLFAIPKKGRLYSKSVSILNGADITFHRSQRLDIALSTSLPVALVFLPAA 60

Query: 61  DIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKLQVQVPEKDRKYTDPKQLV 120
           DIPTFVGEGKCDLGITG+DQV+ES + ++DL +DL FG CKLQVQVP  + +Y  P+QL+
Sbjct: 61  DIPTFVGEGKCDLGITGVDQVRESNV-DVDLAIDLQFGNCKLQVQVP-VNGEYKKPEQLI 118

Query: 121 GKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGGSVEASCALGVGDAIVDLVES 180
           GKTIV+SFVKL+  YF  LE    G  V+K++T+IK+V GSVEASCALG+GDAIVDLVES
Sbjct: 119 GKTIVTSFVKLAEKYFADLE----GTTVEKMTTRIKFVSGSVEASCALGIGDAIVDLVES 174

Query: 181 GETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELIEVIKSRIQGVLTAQRYVCCSYN 240
           GETMRAAGL+DIATVL TSAYLI+++ P+ DKS   LI  IKSRI+GV+TAQR+V C YN
Sbjct: 175 GETMRAAGLVDIATVLSTSAYLIESKNPKSDKS---LIATIKSRIEGVMTAQRFVSCIYN 231

Query: 241 TPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMIERKRKADIMDELKRKGASDIMVFE 300
            PE  L ELLKVTPGRRAPTISK+DD+GWVAV+SMIERK K  ++DELKR GASDIMVFE
Sbjct: 232 APEDKLPELLKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMVFE 291

Query: 301 I 301
           I
Sbjct: 292 I 292

>KLLA0F27489g 2544518..2545411 highly similar to sp|P00498
           Saccharomyces cerevisiae YER055c HIS1 ATP
           phosphoribosyltransferase singleton, start by similarity
          Length = 297

 Score =  426 bits (1096), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 251/301 (83%), Gaps = 9/301 (2%)

Query: 1   MDFVNHLNDRLLFAVPKKGRLYEKTKQLLNGSDIKFNRSNRLDIALCTTLPIALIFLPAA 60
           MD VNHLND+LLFA+PKKGRLYEK+  +L GSDIKF+RS RLDIA+ T +P+ALIFLPAA
Sbjct: 1   MDLVNHLNDKLLFAIPKKGRLYEKSVSILKGSDIKFHRSARLDIAISTNMPVALIFLPAA 60

Query: 61  DIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKLQVQVPEKDRKYTDPKQLV 120
           DIP FVGEG+CDLGITG+DQV+ES + +++L +DL FG CKLQVQVP    +YT P+QL+
Sbjct: 61  DIPMFVGEGRCDLGITGVDQVRESEV-DVNLPIDLQFGTCKLQVQVPVAG-EYTSPEQLI 118

Query: 121 GKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGGSVEASCALGVGDAIVDLVES 180
           GKTIVSSFV L++ YF QLE    G P  ++ T++KYVGGSVEASCALGV DAIVDLVES
Sbjct: 119 GKTIVSSFVNLTKKYFAQLE----GVPESEMVTRVKYVGGSVEASCALGVADAIVDLVES 174

Query: 181 GETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELIEVIKSRIQGVLTAQRYVCCSYN 240
           GETMRAAGL  IATVL+TSA+LI+++ P+ D    EL+  IKSRI+GV+TAQ+YV CSYN
Sbjct: 175 GETMRAAGLTAIATVLDTSAHLIESKNPKGDV---ELLRTIKSRIEGVMTAQKYVSCSYN 231

Query: 241 TPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMIERKRKADIMDELKRKGASDIMVFE 300
            PE  L ELLK+TPGRRAPTIS+++D GWVAV+SMIERK K DIMD+LK+ GA DIMVFE
Sbjct: 232 APENKLPELLKITPGRRAPTISQINDSGWVAVSSMIERKNKGDIMDDLKKNGAEDIMVFE 291

Query: 301 I 301
           I
Sbjct: 292 I 292

>ADL081C [1660] [Homologous to ScYER055C (HIS1) - SH]
           (540943..541836) [894 bp, 297 aa]
          Length = 297

 Score =  390 bits (1001), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 196/301 (65%), Positives = 237/301 (78%), Gaps = 9/301 (2%)

Query: 1   MDFVNHLNDRLLFAVPKKGRLYEKTKQLLNGSDIKFNRSNRLDIALCTTLPIALIFLPAA 60
           MD V  LNDRLLFAVPKKGRLYEK+  LLNG+DI F+RS+RLDIAL T+ P+ALIFLPAA
Sbjct: 1   MDLVRQLNDRLLFAVPKKGRLYEKSVALLNGADILFHRSHRLDIALSTSTPVALIFLPAA 60

Query: 61  DIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKLQVQVPEKDRKYTDPKQLV 120
           DIPTFVGEG+CDLGITG+DQV+ESG+  ++LL DL FG C+LQVQVP     Y+ P+QL+
Sbjct: 61  DIPTFVGEGRCDLGITGVDQVRESGV-NVELLQDLDFGRCQLQVQVPAGG-PYSQPEQLI 118

Query: 121 GKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGGSVEASCALGVGDAIVDLVES 180
           GKTIV+SF +L+R+YF +LE    G     ++T++KYVGGSVEA+CALGV DAIVDLVES
Sbjct: 119 GKTIVTSFTRLAREYFARLE----GVDEAAMTTRVKYVGGSVEAACALGVADAIVDLVES 174

Query: 181 GETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELIEVIKSRIQGVLTAQRYVCCSYN 240
           GETMRAAGL  I TVL TSA+LI +  P   KS   L++ +++RI+GVL AQ YV C+YN
Sbjct: 175 GETMRAAGLTPIGTVLSTSAHLICSPNP---KSSLALLDTVRARIEGVLAAQHYVYCTYN 231

Query: 241 TPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMIERKRKADIMDELKRKGASDIMVFE 300
                L  LL++TPGRRAPTISKLDDD W AV+SMI R+ K  I+D+LK  GA DIMVFE
Sbjct: 232 AHADALPALLRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKASGAEDIMVFE 291

Query: 301 I 301
           I
Sbjct: 292 I 292

>Kwal_23.5779
          Length = 248

 Score =  346 bits (887), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 172/252 (68%), Positives = 212/252 (84%), Gaps = 9/252 (3%)

Query: 50  LPIALIFLPAADIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKLQVQVPEK 109
           +PIALIFLPAADIP FVGEGKCDLGITG+DQV+ES ++ + L MDL FG CKLQVQVP  
Sbjct: 1   MPIALIFLPAADIPMFVGEGKCDLGITGVDQVQESDVDVL-LPMDLNFGSCKLQVQVPNA 59

Query: 110 DRKYTDPKQLVGKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGGSVEASCALG 169
              Y  P+QL+GKTIVSSF  L++ YF +LE    G PV+K++TKI+YVGGSVEASCALG
Sbjct: 60  G-PYEKPEQLIGKTIVSSFTNLTKQYFAKLE----GVPVEKITTKIRYVGGSVEASCALG 114

Query: 170 VGDAIVDLVESGETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELIEVIKSRIQGVL 229
           + DAIVDLVESGETMRAAGL DIATVLETSA+LI+++ P+ D    EL++ IKSRI+GV+
Sbjct: 115 IADAIVDLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDP---ELLQTIKSRIEGVM 171

Query: 230 TAQRYVCCSYNTPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMIERKRKADIMDELK 289
           TAQ+YV C+YN P   L+++LK+TPGRRAPTISK+DD+GWVAV++MI+RK+K  IMD+LK
Sbjct: 172 TAQKYVNCNYNAPVTALEKVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLK 231

Query: 290 RKGASDIMVFEI 301
           + GA+DIMVFEI
Sbjct: 232 KNGAADIMVFEI 243

>KLLA0A06325g <576837..577388 FALSORF, hypothetical start FALSORF,
           hypothetical start FALSORF, hypothetical start : Bad
           text!
          Length = 183

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 47  CTTLPIALIFLPAADIPTFVGEGKCDLGITGLDQ 80
           C TLP+ L ++   DI   +G   CD+ I+G+ +
Sbjct: 112 CKTLPLTLKYVITFDIVKHIGCRPCDVRISGMSR 145

>CAGL0B01573g complement(144100..144771) highly similar to tr|Q03920
           Saccharomyces cerevisiae YDR140w, start by similarity
          Length = 223

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/109 (18%), Positives = 44/109 (40%), Gaps = 11/109 (10%)

Query: 161 SVEASCALGVGDAIVDLVESGETMRAAGLIDIATVLETSAYLIQARRPQQD--KSREELI 218
           S+   C +GVG  IV       T+ +AG +++   ++ + + +++     D    ++  +
Sbjct: 42  SLNVVCEIGVGSGIVTTFMMQNTIPSAGHLNLYYAIDVNPWALESTLTTADINNCKKSYL 101

Query: 219 EVIKSRIQGVLTAQRYVCCSYNTPEGNLKELLKVTPGRRAPTISKLDDD 267
           E +++ +      +      +N P           P    PTI +  DD
Sbjct: 102 EPVQADLTSSFRTREIDLLIFNPP---------YVPAEDVPTIPEETDD 141

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.138    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,344,270
Number of extensions: 392418
Number of successful extensions: 1076
Number of sequences better than 10.0: 10
Number of HSP's gapped: 1055
Number of HSP's successfully gapped: 10
Length of query: 301
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 200
Effective length of database: 13,099,691
Effective search space: 2619938200
Effective search space used: 2619938200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)