Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L00737g91189844310.0
YIL047C (SYG1)90293421400.0
Scas_700.25*93195119700.0
Scas_704.3991685118670.0
Kwal_23.578585692218510.0
ADL080W86389117070.0
KLLA0F27467g84491313521e-173
KLLA0A02057g3842241586e-11
Kwal_47.187213832461471e-09
Sklu_2440.133811981453e-09
AAR127C3812611283e-07
CAGL0F02871g3681851052e-04
Scas_570.83531821006e-04
AFR628C86939920.009
Kwal_33.1361889173910.012
YCR037C (PHO87)92371900.017
YDR414C (ERD1)362183880.021
Scas_625.1693268880.026
ADR289C807102850.062
CAGL0I05632g886141840.084
YNR013C (PHO91)89460820.13
KLLA0C03454g90039820.14
Kwal_23.612981670790.28
CAGL0K08008g890122780.38
CAGL0L12012g29387731.1
CAGL0L05082g38788721.8
Scas_689.169139712.5
CAGL0F02387g95238713.0
Scas_634.1591679694.3
KLLA0F06160g85975685.6
CAGL0I04906g205114665.9
KLLA0C11363g517134686.3
Scas_595.9114860678.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L00737g
         (898 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L00737g complement(90349..93084) similar to sp|P40528 Sacch...  1711   0.0  
YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein fo...   828   0.0  
Scas_700.25*                                                          763   0.0  
Scas_704.39                                                           723   0.0  
Kwal_23.5785                                                          717   0.0  
ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH] complement(...   662   0.0  
KLLA0F27467g complement(2541110..2543644) similar to sp|P40528 S...   525   e-173
KLLA0A02057g 186220..187374 gi|1169545|sp|P41771|ERD1_KLULA Kluy...    65   6e-11
Kwal_47.18721                                                          61   1e-09
Sklu_2440.13 YDR414C, Contig c2440 19959-21104 reverse complement      60   3e-09
AAR127C [314] [Homologous to ScYDR414C (ERD1) - SH] (568957..570...    54   3e-07
CAGL0F02871g complement(278122..279228) similar to sp|P16151 Sac...    45   2e-04
Scas_570.8                                                             43   6e-04
AFR628C [3820] [Homologous to ScYJL198W (PHO90) - SH; ScYCR037C ...    40   0.009
Kwal_33.13618                                                          40   0.012
YCR037C (PHO87) [571] chr3 complement(194409..197180) Member of ...    39   0.017
YDR414C (ERD1) [1239] chr4 complement(1295586..1296674) Protein ...    39   0.021
Scas_625.16                                                            39   0.026
ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH] (1193040.....    37   0.062
CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces c...    37   0.084
YNR013C (PHO91) [4596] chr14 complement(649027..651711) Member o...    36   0.13 
KLLA0C03454g 311611..314313 similar to sp|P25360 Saccharomyces c...    36   0.14 
Kwal_23.6129                                                           35   0.28 
CAGL0K08008g 793765..796437 similar to tr|Q06825 Saccharomyces c...    35   0.38 
CAGL0L12012g complement(1290397..1291278) similar to sp|P32643 S...    33   1.1  
CAGL0L05082g complement(573480..574643) similar to sp|P36081 Sac...    32   1.8  
Scas_689.1                                                             32   2.5  
CAGL0F02387g complement(229207..232065) similar to sp|P25360 Sac...    32   3.0  
Scas_634.15                                                            31   4.3  
KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces c...    31   5.6  
CAGL0I04906g 448237..448854 highly similar to sp|P25451 Saccharo...    30   5.9  
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    31   6.3  
Scas_595.9                                                             30   8.2  

>CAGL0L00737g complement(90349..93084) similar to sp|P40528
           Saccharomyces cerevisiae YIL047c SYG1, start by
           similarity
          Length = 911

 Score = 1711 bits (4431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 842/898 (93%), Positives = 842/898 (93%)

Query: 1   MKFADHLRESTISEWXXXXXXXXXXXXXXXXXXANTAKLNIPAVGYVSGRGTPKKKYNDF 60
           MKFADHLRESTISEW                  ANTAKLNIPAVGYVSGRGTPKKKYNDF
Sbjct: 1   MKFADHLRESTISEWKGKYIDYKYGKKKLKKYKANTAKLNIPAVGYVSGRGTPKKKYNDF 60

Query: 61  QVECINDFIEDWLIPNQLYKCNEFYLWLLSQCQEKYLILSQQLDCYREHKKEFREISSRV 120
           QVECINDFIEDWLIPNQLYKCNEFYLWLLSQCQEKYLILSQQLDCYREHKKEFREISSRV
Sbjct: 61  QVECINDFIEDWLIPNQLYKCNEFYLWLLSQCQEKYLILSQQLDCYREHKKEFREISSRV 120

Query: 121 TYQTSSTSVLQAYGSISNAPEEDIEEDPELSFKKHDNMFQMTLKHFLNEHDLMPSWPKMF 180
           TYQTSSTSVLQAYGSISNAPEEDIEEDPELSFKKHDNMFQMTLKHFLNEHDLMPSWPKMF
Sbjct: 121 TYQTSSTSVLQAYGSISNAPEEDIEEDPELSFKKHDNMFQMTLKHFLNEHDLMPSWPKMF 180

Query: 181 IETIPEALKPKSINTKLKETFAYSXXXXXXXXXMRNKDEHGNKILKNPHKELKHARALLS 240
           IETIPEALKPKSINTKLKETFAYS         MRNKDEHGNKILKNPHKELKHARALLS
Sbjct: 181 IETIPEALKPKSINTKLKETFAYSNKLNLNLNLMRNKDEHGNKILKNPHKELKHARALLS 240

Query: 241 DALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKHDAVS 300
           DALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKHDAVS
Sbjct: 241 DALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKHDAVS 300

Query: 301 TEATIKASKAKTLTDDDIGEDSSTITDTNVSLTSTTIDPLRAWEAKLTKWYTVDVVNSLS 360
           TEATIKASKAKTLTDDDIGEDSSTITDTNVSLTSTTIDPLRAWEAKLTKWYTVDVVNSLS
Sbjct: 301 TEATIKASKAKTLTDDDIGEDSSTITDTNVSLTSTTIDPLRAWEAKLTKWYTVDVVNSLS 360

Query: 361 EKKRHLEKLKKVSIQYSLNEQMIHRNNRAILQMTVFGVFTGIAVTLIAYTLYLAFLSPLN 420
           EKKRHLEKLKKVSIQYSLNEQMIHRNNRAILQMTVFGVFTGIAVTLIAYTLYLAFLSPLN
Sbjct: 361 EKKRHLEKLKKVSIQYSLNEQMIHRNNRAILQMTVFGVFTGIAVTLIAYTLYLAFLSPLN 420

Query: 421 TKRHKILFPIWGGWYMILLISLFFLIDCFIWHRTGINYRFIMFGEVQAKSGTQFFNNDFA 480
           TKRHKILFPIWGGWYMILLISLFFLIDCFIWHRTGINYRFIMFGEVQAKSGTQFFNNDFA
Sbjct: 421 TKRHKILFPIWGGWYMILLISLFFLIDCFIWHRTGINYRFIMFGEVQAKSGTQFFNNDFA 480

Query: 481 TTGIPLRLYXXXXXXXXXXXXXXXXXHFDHLTPYGYIYFIVVGLLFITPYDLIPYWDKLV 540
           TTGIPLRLY                 HFDHLTPYGYIYFIVVGLLFITPYDLIPYWDKLV
Sbjct: 481 TTGIPLRLYFLAFFIISCAIISALSFHFDHLTPYGYIYFIVVGLLFITPYDLIPYWDKLV 540

Query: 541 ETRKFLVTTTIRLVLSGLYPVEFKDFFLGDIICSLTYTLSDLAIFACYYAPKTRKDPLGM 600
           ETRKFLVTTTIRLVLSGLYPVEFKDFFLGDIICSLTYTLSDLAIFACYYAPKTRKDPLGM
Sbjct: 541 ETRKFLVTTTIRLVLSGLYPVEFKDFFLGDIICSLTYTLSDLAIFACYYAPKTRKDPLGM 600

Query: 601 CGSSHSKAMGVLSCLPSFWRFMQCVRRFFDSNDWFPHLPNAAKYLLGVAYNATLCAYRLS 660
           CGSSHSKAMGVLSCLPSFWRFMQCVRRFFDSNDWFPHLPNAAKYLLGVAYNATLCAYRLS
Sbjct: 601 CGSSHSKAMGVLSCLPSFWRFMQCVRRFFDSNDWFPHLPNAAKYLLGVAYNATLCAYRLS 660

Query: 661 NHSPAKRNPFIIFATLNSISTSIWDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWETGK 720
           NHSPAKRNPFIIFATLNSISTSIWDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWETGK
Sbjct: 661 NHSPAKRNPFIIFATLNSISTSIWDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWETGK 720

Query: 721 YDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQTIQQSAVTSFALAVTEVCRRFIWVIFRVE 780
           YDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQTIQQSAVTSFALAVTEVCRRFIWVIFRVE
Sbjct: 721 YDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQTIQQSAVTSFALAVTEVCRRFIWVIFRVE 780

Query: 781 NEHVANVHLFRVTGEALLPYPNQDVVDFSGKATTDLYDDQHFQQGRDSIESSRPXXXXXX 840
           NEHVANVHLFRVTGEALLPYPNQDVVDFSGKATTDLYDDQHFQQGRDSIESSRP      
Sbjct: 781 NEHVANVHLFRVTGEALLPYPNQDVVDFSGKATTDLYDDQHFQQGRDSIESSRPSHLHDL 840

Query: 841 XXXXXXINNKFEEPTATYHSIVRRRTAIFDNISRSIPWAHAKDFQRPLTQHNGESSKT 898
                 INNKFEEPTATYHSIVRRRTAIFDNISRSIPWAHAKDFQRPLTQHNGESSKT
Sbjct: 841 DLSLSDINNKFEEPTATYHSIVRRRTAIFDNISRSIPWAHAKDFQRPLTQHNGESSKT 898

>YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein for
           which truncation and overexpression can suppress
           lethality of Gpa1p deficiency, member of the divalent
           anion:Na+ (DASS) family of membrane transporters [2709
           bp, 902 aa]
          Length = 902

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/934 (47%), Positives = 577/934 (61%), Gaps = 101/934 (10%)

Query: 1   MKFADHLRESTISEWX---------XXXXXXXXXXXXXXXXXANTAKLNIPAVG------ 45
           MKFADHL ES I EW                           +++ +  +P+V       
Sbjct: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF 60

Query: 46  -------------YVSGRGTPKKKYNDFQVECINDFIEDWLIPNQLYKCNEFYLWLLSQC 92
                        Y SG    KK Y+  Q E + DFIEDWLI  QL KCNEFYLWLL +C
Sbjct: 61  QQREPGKSRSDGDYRSGPAF-KKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKEC 119

Query: 93  QEKYLILSQQLDCYREHKKEFREISSRVTYQTSSTSVLQAYG--SISNAPEEDIEEDPE- 149
            +K+ +L  QL  Y   K   R+  +R +     ++ L A G    S++    I+ D   
Sbjct: 120 DKKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRS 179

Query: 150 -----LSFKKHDNMFQMTL----KHFLNEHDLMPSWPKMFIETIPEALKPKSINTKLKET 200
                +   K     +++L    +  L ++ L+PSWPK     + +  +  S  ++ +ET
Sbjct: 180 VMYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDAS--SRGRET 237

Query: 201 FAYSXXXXXXXXXMRNKDEHGNKILKNPHKELKHARALLSDALLEFYLFLQLVKSYRDVN 260
           FA+                 G   L+        AR LLS+A++E+YL+LQLVKS+RD+N
Sbjct: 238 FAF-----------------GASFLET--MTTTQARNLLSNAIIEYYLYLQLVKSFRDIN 278

Query: 261 VVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKHDAVSTEATIKASKAKTLTDDDIGE 320
           V GFRK+VKKFDKTC T+EL  FM + R +YT+FKH   + +  + A K + +T      
Sbjct: 279 VTGFRKMVKKFDKTCHTRELTTFMSYARTHYTLFKHADANVQ--LVAQKMQQITS----- 331

Query: 321 DSSTITDTNVSLTSTTIDPLRAWEAKLTKWYTVDVVNSLSEKKRHLEKLKKVSIQYSLNE 380
            S     + +S      +P+   E ++T+W+T  + NS  ++K +  KLKK++IQYS++E
Sbjct: 332 -SQPTPTSELSSAQRDKEPITWLETQITEWFTTALTNSPKDRKHNTHKLKKLTIQYSISE 390

Query: 381 QMIHRNNRAILQMTVFGVFTGIAVTLIAYTLYLAFLSPLNTKRHKILFPIWGGWYMILLI 440
           QM+HRNNR+I+QM V G+  G+++TLI YTLYL   S   +  HKILFP+WGGWYM+LLI
Sbjct: 391 QMVHRNNRSIVQMLVVGLGIGVSMTLITYTLYLGISSEETSFTHKILFPLWGGWYMVLLI 450

Query: 441 SLFFLIDCFIWHRTGINYRFIMFGEVQAKSGTQFFNNDFATTGIPLRLYXXXXXXXXXXX 500
           +  FL++CFIWHRTGINYRFIM GE+Q+K+GTQFFNNDFAT+ IPL+LY           
Sbjct: 451 AFLFLVNCFIWHRTGINYRFIMLGEIQSKNGTQFFNNDFATSKIPLKLYFLTFFIVPCAV 510

Query: 501 XXXXXXHFDHLTPYGYIYFIVVGLLFITPYDLIPYWDKLVETRKFLVTTTIRLVLSGLYP 560
                   + LTP G++Y  +V  LF+ P  LIPYWDK+V TRK+LV T IRL++SG +P
Sbjct: 511 CSMLSFALEKLTPLGFLYIGIVSFLFLCPSGLIPYWDKVVHTRKWLVVTLIRLMMSGFFP 570

Query: 561 VEFKDFFLGDIICSLTYTLSDLAIFACYYAPKTRKDPLGMCGSSHSKAMGVLSCLPSFWR 620
           VEF DFFLGDIICSLTY+++D+A+F C Y+      P  +CGSSHS+AMGVLSCLPS+WR
Sbjct: 571 VEFGDFFLGDIICSLTYSIADIAMFFCVYS----HTPNNLCGSSHSRAMGVLSCLPSYWR 626

Query: 621 FMQCVRRFFDSNDWFPHLPNAAKYLLGVAYNATLCAYRLSNHSPAKRNPFIIFATLNSIS 680
           FMQC+RRF DS DWFPHL NAAKY LG+AYNATLCAYRLS+ S  +R PFI+ ATLNSI 
Sbjct: 627 FMQCLRRFADSGDWFPHLLNAAKYTLGIAYNATLCAYRLSDRSEQRRTPFIVCATLNSIL 686

Query: 681 TSIWDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWETGKYDWSRKAVYYIAMVLDVVIR 740
           TS WDLVMDWS   ++  + N  LR DLYLAGK+NWE G Y +SRK VYY AM+ D++IR
Sbjct: 687 TSAWDLVMDWSFAHNTT-SYNWLLRDDLYLAGKKNWENGSYSFSRKLVYYFAMIWDILIR 745

Query: 741 FQWIVYAVAPQTIQQSAVTSFALAVTEVCRRFIWVIFRVENEHVANVHLFRVTGEALLPY 800
           F+WIVYA+APQTIQQSAVTSF LA+ EV RRF+W+IFRVENEHVANVHLFRVTG+A LPY
Sbjct: 746 FEWIVYAIAPQTIQQSAVTSFILALLEVLRRFVWIIFRVENEHVANVHLFRVTGDAPLPY 805

Query: 801 P-------NQDVVDFSGKATTDLYDDQHFQQGRDSIESSRPXXXXXXXXXXXXINNKFEE 853
           P       + D  D   KA + L +D       D+   S                  F E
Sbjct: 806 PIAQVGDDSMDSSDLGSKAFSSL-NDIPITPSHDNNPHS------------------FAE 846

Query: 854 PTATYHSIVRRRTAIFDNISRSIPWAHAKDFQRP 887
           P   Y    RRR+++F+NISRSIPWAHA DFQRP
Sbjct: 847 PMPAYRGTFRRRSSVFENISRSIPWAHATDFQRP 880

>Scas_700.25*
          Length = 931

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/951 (45%), Positives = 548/951 (57%), Gaps = 108/951 (11%)

Query: 1   MKFADHLRESTISEWXXXXXXXXXXXXXXXX----------XXANTAKLNIPAVGYVSG- 49
           MKF DHL ES I EW                               + LN      +   
Sbjct: 1   MKFGDHLNESMIPEWKDKYVEYKVGKKKLKTFKQKLQNDIDETTTDSLLNASVSDSIEST 60

Query: 50  -----RGTP---------KKKYNDFQVECINDFIEDWLIPNQLYKCNEFYLWLLSQCQEK 95
                  TP         +K Y+  + + + +F++DWLI  QL KCN+FY  L++ C++K
Sbjct: 61  YIDQENSTPVTPSHVYSIQKDYSPVKKKIVQEFVKDWLIGEQLNKCNDFYEELINDCRKK 120

Query: 96  YLILSQQLDCYREHKKEFREISSRVTYQTSSTSVLQAYGSISNAPEEDIEEDP------- 148
           Y IL  Q+  Y   +       +R     SS+  +     + N P +   + P       
Sbjct: 121 YNILENQIRFYNIQRHSIDNKKTRNLLIVSSSESVD----VENTPIDSTIQHPYAPNRGR 176

Query: 149 -------------ELSFKKHDNMFQMTLKHFLNEHDLMPSWPKMFIETIPEALKPKSINT 195
                          +F  H   FQ  LK  L  ++++PS P                  
Sbjct: 177 VITLNGQQNVANANKNFASHFLYFQ-KLKTILKNNNVLPSLPA----------------- 218

Query: 196 KLKETFAYSXXXXXXXXXMRNKDEHGNKILKNPHKELKHARALLSDALLEFYLFLQLVKS 255
             K   +Y            N +   N +L      ++ A+ LL++A+LEFYLFLQLVK+
Sbjct: 219 --KGITSYFHQNGRGSQGEGNINASENDMLS--EITVEKAQKLLTEAILEFYLFLQLVKT 274

Query: 256 YRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKHD----AVSTEATIKASKAK 311
           YRD+N+ GFRKI KKFDKTC+T+E   FM + + NYTIF H     A+ T+   K S  +
Sbjct: 275 YRDLNLTGFRKIAKKFDKTCETKECLKFMNYAKENYTIFSHIDPNIALMTDRMKKTSTYQ 334

Query: 312 TLTDDDIGEDSSTITDTNVSLTSTTIDPLRAWEAKLTKWYTVDVVNSLSEKKRHLEKLKK 371
            L  +DI  ++ +             DPL  WE+K+  WY  D+ NSL+E KR+ +KL+K
Sbjct: 335 PLVFEDITPENESD------------DPLLWWESKVRGWYIKDLTNSLTEMKRNNDKLRK 382

Query: 372 VSIQYSLNEQMIHRNNRAILQMTVFGVFTGIAVTLIAYTLYLAFLSPLNTKRHKILFPIW 431
             IQYSLNE++IHR N +ILQMT+ G F G A +LI YTLYL F S      H+ILFP+W
Sbjct: 383 FGIQYSLNERIIHRINISILQMTISGFFIGAAFSLIIYTLYLIFTSDDKAYIHRILFPLW 442

Query: 432 GGWYMILLISLFFLIDCFIWHRTGINYRFIMFGEVQAKSGTQFFNNDFATTGIPLRLYXX 491
           GGWYM+LLIS  F+ +CFIWHR+GINYRFIMFGE+QA+SGTQFFNNDFATT I L+ Y  
Sbjct: 443 GGWYMVLLISFLFIGNCFIWHRSGINYRFIMFGEIQARSGTQFFNNDFATTKISLKYYFI 502

Query: 492 XXXXXXXXXXXXXXXHFDHLTPYGYIYFIVVGLLFITPYDLIPYWDKLVETRKFLVTTTI 551
                            + LTP G+I+  +V  LF+ P  +IP+WDKLVETRK+L  + I
Sbjct: 503 SLFILACSILAIISFQLEKLTPLGFIFPGIVITLFLAPSWMIPFWDKLVETRKWLFCSGI 562

Query: 552 RLVLSGLYPVEFKDFFLGDIICSLTYTLSDLAIFACYYAPKTRKDPLGMCGSSHSKAMGV 611
           RL+ SG YPVEF DFFLGDI+CSLTY++SDLA+F C Y    R D    C SSH ++MGV
Sbjct: 563 RLIFSGFYPVEFGDFFLGDIVCSLTYSISDLAMFFCVYV---RSDN-ATCSSSHLRSMGV 618

Query: 612 LSCLPSFWRFMQCVRRFFDSNDWFPHLPNAAKYLLGVAYNATLCAYRLSNHSPAKRNPFI 671
           L CLPSFWRFMQC+RRF DS DWFPHL NAAKY LGVAYNATLC YR+S  S   R  FI
Sbjct: 619 LGCLPSFWRFMQCLRRFADSGDWFPHLLNAAKYTLGVAYNATLCVYRISPKSFHSRQIFI 678

Query: 672 IFATLNSISTSIWDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWETGKYDWSRKAVYYI 731
           +FATLN+  TSIWDLVMDWS+LQ S    N FLR DLYLAGK+NW+TGKY   RK++YY 
Sbjct: 679 VFATLNATYTSIWDLVMDWSLLQPS--QNNTFLRDDLYLAGKKNWKTGKYSNKRKSIYYF 736

Query: 732 AMVLDVVIRFQWIVYAVAPQTIQQSAVTSFALAVTEVCRRFIWVIFRVENEHVANVHLFR 791
           AM+ +V++RF+WIVYA+APQTIQQSA TSF LA  EV RRF+W+IFRVENEHVANV+LFR
Sbjct: 737 AMIWNVIVRFEWIVYAIAPQTIQQSADTSFILATAEVLRRFVWIIFRVENEHVANVNLFR 796

Query: 792 VTGEALLPYP-NQDVVDFSGKATTDLYDD---QHFQQGRDSIE-SSRPXXXXXXXXXXXX 846
           V+G A LPYP N   +   G + +D   +        G D++  ++ P            
Sbjct: 797 VSGTAPLPYPINITSITPLGSSDSDEATNIIVLESNSGNDNLSVTNEPQQTSNRINRFDT 856

Query: 847 IN----------NKFEEPTATYHSIVRRRTAIFDNISRSIPWAHAKDFQRP 887
           +            + EEP   YH  + RRT  F +IS+SIPWAH  DFQRP
Sbjct: 857 VGAVPNVDITRETRIEEPMPAYHPPLERRTTTFGSISKSIPWAHTSDFQRP 907

>Scas_704.39
          Length = 916

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/851 (47%), Positives = 528/851 (62%), Gaps = 59/851 (6%)

Query: 55  KKYNDFQVECINDFIEDWLIPNQLYKCNEFYLWLLSQCQEKYLILSQQLDCYREHKKEFR 114
           + Y+   +E I++F+E+W+I  QL KCNEFY WLL+  ++K+ IL  Q+  +   K+ F 
Sbjct: 96  RVYSPLLIEIIHEFMENWIISIQLTKCNEFYNWLLNDSRKKFKILQNQVHLFNIQKRLFN 155

Query: 115 EISSRVTYQTSSTSVLQAYGSISNAPEEDIEEDPELSFKKHDNMFQMTLKHFLNEHDLMP 174
           +         ++ S+  +YGS+  +   D             ++ Q ++K  L+ H L+P
Sbjct: 156 D---------AANSISSSYGSLMTSATSD---------SVTTSLIQ-SIKDTLHAHRLLP 196

Query: 175 SWPKMFIETIPEALKPKSINTKLKETFAYSXXXXXXXXXMRNKDEHGNKILKNPHKELKH 234
           S+P+        +LK    N    +T +                 + N    +    L  
Sbjct: 197 SYPQY-------SLKQLIFNNTTSDTESQPLMERETFNPEDQLLNNLNNNTSSAKSSLDK 249

Query: 235 ARALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIF 294
           +  LLSDA+LEFYLFLQL+KSYRD+NV GFRKIVKKFDKT +T EL  FM F + N+TIF
Sbjct: 250 SAKLLSDAILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFMAFAKQNFTIF 309

Query: 295 KHDAVSTEATIKASKAKTLTDDDIGEDSSTITDTNVSLTSTTIDPLRAWEAKLTKWYTVD 354
           KH  +     +  +K K      I      I D  +  ++   DP+  WE+K+  WY   
Sbjct: 310 KH--IDPNIKLMTNKMK-----QISSYQPIIFDELIP-SNEIDDPILWWESKVKDWYVNQ 361

Query: 355 VVNSLSEKKRHLEKLKKVSIQYSLNEQMIHRNNRAILQMTVFGVFTGIAVTLIAYTLYLA 414
           + NS    K++ +KLKK+ IQYSLNEQM+HRNNRAI+QMT+     GI+ T IA T+YL+
Sbjct: 362 LTNSPKSMKKNNKKLKKLIIQYSLNEQMVHRNNRAIIQMTIAAWILGISSTSIANTIYLS 421

Query: 415 FLSPLNTKRHKILFPIWGGWYMILLISLFFLIDCFIWHRTGINYRFIMFGEVQAKSGTQF 474
           F+S   +  HKILFPIWGGWYM+LLISL  + +CFIWH++ INYRFIMFGE++A+SGTQF
Sbjct: 422 FMSGYTSYTHKILFPIWGGWYMVLLISLLIISNCFIWHKSEINYRFIMFGEIKARSGTQF 481

Query: 475 FNNDFATTGIPLRLYXXXXXXXXXXXXXXXXXHFDHLTPYGYIYFIVVGLLFITPYD--- 531
           +NNDFATT I L LY                 H ++L PY  IY ++   LFI P     
Sbjct: 482 YNNDFATTRISLNLYFLSFFILPLSICALLSFHNENLFPYAIIYPLIATSLFIAPKAISK 541

Query: 532 -LIPYWDKLVETRKFLVTTTIRLVLSGLYPVEFKDFFLGDIICSLTYTLSDLAIFAC-YY 589
            ++PYW+KL E R +++TT IRL LSGLYPVEF DFFLGDIICSLTY++SD+A+F C Y+
Sbjct: 542 YILPYWNKLKEIRVWILTTFIRLSLSGLYPVEFGDFFLGDIICSLTYSMSDIAMFFCIYF 601

Query: 590 APKTRKDPLGMCGSSHSKAMGVLSCLPSFWRFMQCVRRFFDSNDWFPHLPNAAKYLLGVA 649
           + K    P   CGSSHS  MG+LSCLP++WR MQC RR+ DS DWFPHL NA KY LGVA
Sbjct: 602 SDK----PSTTCGSSHSITMGILSCLPNYWRMMQCFRRWADSADWFPHLLNAIKYGLGVA 657

Query: 650 YNATLCAYRLSNHSPA-KRNPFIIFATLNSISTSIWDLVMDWSVLQSSIGNENLFLRKDL 708
           YN TLCAYRLSNH     RN FII A LN++ TS+WDL +DWS+LQ    + N  LR DL
Sbjct: 658 YNGTLCAYRLSNHERGTTRNTFIIVAALNALITSVWDLTVDWSLLQP--DSNNWLLRNDL 715

Query: 709 YLAGKRNWETGKYDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQTIQQSAVTSFALAVTEV 768
           YLAGK++WETG+Y  +RK+ YYIAMV DV+IRFQWIVYA+APQTIQQ+A+TSF LA TE+
Sbjct: 716 YLAGKKDWETGQYSRARKSFYYIAMVWDVLIRFQWIVYAIAPQTIQQNAITSFILATTEI 775

Query: 769 CRRFIWVIFRVENEHVANVHLFRVTGEALLPYPNQDVVDFSGKATTDLYDDQHFQQGRDS 828
            RR IWVI RVENEHVANVHLFRVTG A LPYP         K T  + +++   +  D 
Sbjct: 776 IRRCIWVIIRVENEHVANVHLFRVTGNAPLPYPVNVQTIALTKPTFQIGEEERMAENLDQ 835

Query: 829 IESSRPXXXXXXXXXXXXINNKFEEPT--ATYHSIVRRRTAIFDNISRSIPWAHAKDFQR 886
                              N  ++E      Y ++ RRRT  F  IS+SIPW HA DFQR
Sbjct: 836 -----------QALGNLSFNVSYDENAMWPPYRTLARRRTTTFAEISKSIPWVHATDFQR 884

Query: 887 PLTQHNGESSK 897
           P T  +   SK
Sbjct: 885 PTTLLSSNESK 895

>Kwal_23.5785
          Length = 856

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/922 (41%), Positives = 537/922 (58%), Gaps = 104/922 (11%)

Query: 1   MKFADHLRESTISEWXXXXXXXXXXXXXXXXXXANTAKLNIPAVGYVSGRGTP------- 53
           MKFA+HLRES + EW                     A   +      S    P       
Sbjct: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60

Query: 54  ------KKKYNDFQVECINDFIEDWLIPNQLYKCNEFYLWLLSQCQEKYLILSQQLDCYR 107
                  + Y   Q   +  F+E W+I  +L KCN+FYLW L +C  ++ +L +Q++ + 
Sbjct: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE 120

Query: 108 EHKKEFREISSRVTYQTSSTSVLQAYGSISNAPEEDIEEDPELSFKKHDNMFQMTLKHFL 167
             + +          Q+ + +  + YG++      D +E  +      D+  +      +
Sbjct: 121 ADQAQ----------QSIADTDSKYYGAV------DRDETIQPITAGKDSTLRSRFFRVV 164

Query: 168 NEHDLMPSWPKM--FIETIPEALKPKSINTKLKETFAYSXXXXXXXXXMRNKDEHGNKIL 225
            + +L+PS+P+M  F   + ++ +  +++    ETFA +           N+ +H     
Sbjct: 165 QDLELVPSFPRMAPFKRLLDQSPEDNNLSVSHGETFAPTTLST-------NQIQHR---- 213

Query: 226 KNPHKELKHARALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMR 285
                        LSDAL+EFYL LQL+K YR+VNV GFRKIVKKFDKTC T+EL  F+ 
Sbjct: 214 -------------LSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIE 260

Query: 286 FVRANYTIFKHDAVSTEATIKASKAKTLTDDDIGEDSSTITDTNVSLTSTTIDPLRAWEA 345
           + ++ Y IF+H     EA  +    +      +GE SS  T+ NV       DPL +WE 
Sbjct: 261 YAKSTYPIFQH----AEANARVVAHQMHDSALLGERSSFATELNVE------DPLLSWEQ 310

Query: 346 KLTKWYTVDVVNSLSEKKRHLEKLKKVSIQYSLNEQMIHRNNRAILQMTVFGVFTGIAVT 405
           + TKWYT  + +S  ++KR   +LK +S++YSLNEQ +HR NR+ILQM V GV  G ++ 
Sbjct: 311 QTTKWYTDVLSSSSKDRKRKTARLKNLSLEYSLNEQKVHRFNRSILQMFVSGVLLGGSLA 370

Query: 406 LIAYTLYLAFLSPLNTKRHKILFPIWGGWYMILLISLFFLIDCFIWHRTGINYRFIMFGE 465
           L+ YTLY  F++  +++ H +L P+WGGWYM+ LI+  FL++CFIWHR+ INYRFIMFGE
Sbjct: 371 LVGYTLYRGFVASNSSEIHSLLLPLWGGWYMVFLITFLFLLNCFIWHRSNINYRFIMFGE 430

Query: 466 VQAKSGTQFFNNDFATTGIPLRLYXXXXXXXXXXXXXXXXXHFDHLTPYGYIYFIVVGLL 525
           + ++ G   FNNDF+TT IP+  Y                 +  +L P+  I+  +V +L
Sbjct: 431 MHSRRGAVLFNNDFSTTKIPILFYFASVLAFPMALLSSISFNEVNLNPWAIIWIALVVVL 490

Query: 526 FITPY--DL----IPYWDKLVETRKFLVTTTIRLVLSGLYPVEFKDFFLGDIICSLTYTL 579
           F +P   +L    IPYW+KL ++ ++++ + +RL+ SG YPV+F DFFLGDI CSLTY+L
Sbjct: 491 FFSPVLGELPLLSIPYWNKLTKSVRWILVSFVRLIFSGFYPVQFGDFFLGDIFCSLTYSL 550

Query: 580 SDLAIFACYYAPKTRKDPLGMCGSSHSKAMGVLSCLPSFWRFMQCVRRFFDSNDWFPHLP 639
           +D+A+F C Y+P     P G CGSSHSKAMG ++CLP+FWRFMQC+RRF DS DWFPHL 
Sbjct: 551 ADIAMFFCIYSPT----PNGRCGSSHSKAMGAMTCLPNFWRFMQCLRRFSDSGDWFPHLL 606

Query: 640 NAAKYLLGVAYNATLCAYRLSNHSPAKRNPFIIFATLNSISTSIWDLVMDWSVLQSSIGN 699
           N  KY L V Y A+LCAYR+S H+ ++RN FIIFATLN + TSIWD++MDWS+LQS  G+
Sbjct: 607 NGLKYSLSVVYYASLCAYRIS-HTRSRRNVFIIFATLNGVCTSIWDIIMDWSLLQS--GS 663

Query: 700 ENLFLRKDLYLAGKRNWETGKYDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQTIQQSAVT 759
            N  LR DLYLAG++NW+TG Y   RK+VYY+AM+ DV +RFQW+VYA+AP TIQQSA+T
Sbjct: 664 RNWLLRDDLYLAGRKNWKTGAYSKRRKSVYYLAMIWDVAMRFQWVVYAIAPATIQQSAIT 723

Query: 760 SFALAVTEVCRRFIWVIFRVENEHVANVHLFRVTGEALLPYPNQDVVDFSGKATTDLYDD 819
           SF LA  EV RRF+W+IFRVENEHVANVHLF+V+GE  LPYP     +   +A+      
Sbjct: 724 SFILAALEVTRRFVWIIFRVENEHVANVHLFKVSGEISLPYPTTVNEESETEASV---SS 780

Query: 820 QHFQQGRDSIESSRPXXXXXXXXXXXXINNKFEEPTATYHSIVRRRT----AIFDNISRS 875
            H+     S  +                      PT  Y     +++     +   +S S
Sbjct: 781 NHYAMSEMSFPT-------------------MAAPTPMYRGESTQKSTGSNGLLRTLSSS 821

Query: 876 IPWAHAKDFQRPLTQHNGESSK 897
           IPWAHA+DFQRP     G++++
Sbjct: 822 IPWAHAQDFQRPTGCAGGDNAR 843

>ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH]
           complement(542124..544715) [2592 bp, 863 aa]
          Length = 863

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/891 (40%), Positives = 505/891 (56%), Gaps = 75/891 (8%)

Query: 1   MKFADHLRESTISEWXXXXXXXXXXXXXXXXXXANTAKLNIPAVGYVSGRGTPKKKYNDF 60
           MKFA+ LRES+I EW                           +V          + Y   
Sbjct: 1   MKFAERLRESSIPEWRDKYLDYKLGKKKLKSYKEKLKASRALSVRPTQRSRARDEPYTMQ 60

Query: 61  QVECINDFIEDWLIPNQLYKCNEFYLWLLSQCQEKYLILSQQLDCYREHKKE-FREISSR 119
           Q + + +F+  W+I  +L KC+EFY W L QC+ KY +L QQ++ Y   K E    +S  
Sbjct: 61  QEDAVYEFVMGWVIGTELAKCDEFYQWQLDQCERKYQLLKQQIEMYCLQKDENGAGLSYG 120

Query: 120 VTYQTSSTSVLQAYGSISNAPEEDIEEDPELSFKKHDNMFQMTLKHFLNEHDLMPSWPKM 179
            TY+    + L A  S   +P          S     +  Q  +K +L E DLMPS P  
Sbjct: 121 ATYEGQEETGLAAQLSAGRSPSP--------SRAGRLDRAQEGVKRWLQERDLMPSLPAR 172

Query: 180 FI-ETIPEALKPKSINTKLKETFAYSXXXXXXXXXMRNKDEHGNKILKNPHKELKHARAL 238
           +  E  P  +K  S NT   ETF +                        P K  + A+  
Sbjct: 173 WSREQGPARVKKYSANT---ETFMHIC----------------------PSK--RQAQLQ 205

Query: 239 LSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKHDA 298
           L  ALLE+YL LQL+K+YRD+NV GFRKIVKKFDKTC T+EL+ FM +   +  +F+H  
Sbjct: 206 LGHALLEYYLTLQLLKNYRDLNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFEHMG 265

Query: 299 VSTEATIKASKAKTLTDDDIGEDSSTITDTNVSLTSTTIDPLRAWEAKLTKWYTVDVVNS 358
            +      + KA     + + + ++ +       +S   DP+  WE ++ +WYT  +  S
Sbjct: 266 QNLRLYANSFKA----SNSLCQPAARMN------SSPEKDPVTYWEDQVFQWYTEALTES 315

Query: 359 LSEKKRHLEKLKKVSIQYSLNEQMIHRNNRAILQMTVFGVFTGIAVTLIAYTLYLAFLSP 418
              +K H++KL+ +S+QYS+NEQ++HRNN  ++QM   G   G+AV L+   L L   + 
Sbjct: 316 TQARKHHVQKLRSLSLQYSMNEQIVHRNNTCVVQMFTAGSLLGVAVVLVIIALMLGIRAD 375

Query: 419 LNTKRHKILFPIWGGWYMILLISLFFLIDCFIWHRTGINYRFIMFGEVQAKSGTQFFNND 478
           +++ RH ILFP+WGGWY++LL+SL F +DC+IW R  +NY+FIMFGE+ ++ G   FNND
Sbjct: 376 ISSYRHLILFPVWGGWYLVLLMSLLFCLDCYIWFRGKVNYQFIMFGEIHSRKGNTVFNND 435

Query: 479 FATTGIPLRLYXXXXXXXXXXXXXXXXXHFDHLTPYGYIYFIVVGLLFITPYDLIPYWDK 538
           F+TT I   LY                     L P+ ++  ++  L F     ++PYW +
Sbjct: 436 FSTTKISGHLYMVSLAFITVGAVSLCSMVRATLAPWLWLCALLFALGFSMSSFILPYWRE 495

Query: 539 LVETRKFLVTTTIRLVLSGLYPVEFKDFFLGDIICSLTYTLSDLAIFACYYAPKTRKDPL 598
           L +TR++L+ T IRLV SG YPV+F DFFLGDI+CSLTY+++D+A   C ++ +      
Sbjct: 496 LRKTRQWLIVTAIRLVFSGAYPVQFGDFFLGDIVCSLTYSMADVASVFCVFSGQK----Y 551

Query: 599 GMCGSSHSKAMGVLSCLPSFWRFMQCVRRFFDSNDWFPHLPNAAKYLLGVAYNATLCAYR 658
            MCGSS+  +MGVLSC+PS+WR MQC+RR+ DSND FPHL N AKY + + YNA LCAYR
Sbjct: 552 NMCGSSNLISMGVLSCIPSYWRLMQCLRRYLDSNDRFPHLLNGAKYAVAILYNACLCAYR 611

Query: 659 LSNHSPAKRNPFIIFATLNSISTSIWDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWET 718
           ++    + R+ FI    +NS+ +SIWDLVMDWS+ Q    + N  LR DLYLAGKRNW+T
Sbjct: 612 INKLHHSYRSWFIAAGIINSVFSSIWDLVMDWSLFQ--FQSTNFLLRDDLYLAGKRNWQT 669

Query: 719 GKYDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQTIQQSAVTSFALAVTEVCRRFIWVIFR 778
           G+Y   RKA+YY++M+ DV IRFQWIVYA+AP+ IQQSAVTSF L + EV RRFIW+IFR
Sbjct: 670 GQYSKRRKAMYYVSMISDVAIRFQWIVYAIAPRVIQQSAVTSFILGILEVVRRFIWIIFR 729

Query: 779 VENEHVANVHLFRVTGEALLPYPNQDVVDFSGKATTDLYDDQHFQQGRDSIESSRPXXXX 838
           VENEHVANVHLF++TGE  LPYP   +      +T+ ++D       ++S E        
Sbjct: 730 VENEHVANVHLFKITGETPLPYP---ISPSRALSTSTVHDKHALPSTKNSHED------- 779

Query: 839 XXXXXXXXINNKFEEPTATYHSIVRRRTAIFDNISRSIPWAHAKDFQRPLT 889
                   +      P   +  +  R  +I  N    IPWAHAKDFQRP T
Sbjct: 780 ------LVLYASVRHPEVLH--MRHRAPSILSN----IPWAHAKDFQRPST 818

>KLLA0F27467g complement(2541110..2543644) similar to sp|P40528
           Saccharomyces cerevisiae YIL047c SYG1 member of the
           major facilitator superfamily singleton, start by
           similarity
          Length = 844

 Score =  525 bits (1352), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 332/913 (36%), Positives = 486/913 (53%), Gaps = 99/913 (10%)

Query: 1   MKFADHLRESTISEWXXXXXXXXXXXXXXXXXXANTAKLNIPAVGYVSGRGTPK-----K 55
           MKFA+HLRES + EW                            V Y  G+   K     K
Sbjct: 1   MKFAEHLRESVVPEWSDKY------------------------VNYKLGKKKIKQFQKLK 36

Query: 56  KYND---FQVECINDFIEDWLIPNQLYKCNEFYLWLLSQCQEKYLILSQQLDCYREHKKE 112
           K  D        + +FI+DWL+ +QL  C+EFY W LS+ + KY  L +Q+  Y     +
Sbjct: 37  KVQDVGSMDRTIVREFIDDWLVRDQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADK 96

Query: 113 FREISSRVTYQTSSTS-VLQAYGSISNAPEEDIEEDPELSFKKHDNMFQMTLKHFLNEHD 171
              + S   Y+ +S S    +YGSI         +D   + KK        LK +L  H+
Sbjct: 97  RSRLDSLDEYRIASLSRAPDSYGSIFPNFSPIALKD---TVKKK---IWYDLKRWLVTHN 150

Query: 172 LMPSWPKMFIETIP-EALKPKSINTKLKETFAYSXXXXXXXXXMRNKDEHGNKILKNPHK 230
           L PS P  +    P  A K +   ++ +ETF                        +    
Sbjct: 151 LCPSMPVSWKNRDPLLAKKDRKRASRGQETFQ----------------------TETSPL 188

Query: 231 ELKHARALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRAN 290
            L   R  LSDA+L+FYL+LQL+K+YRD+NV GFRKIVKKFDK     +L  FM + +  
Sbjct: 189 SLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVLHQDQLKTFMPYAKKY 248

Query: 291 YTIFKHDAVSTEATIKASKAKTLTDDDIGEDSSTITDTNVSLTSTTIDPLRAWEAKLTKW 350
             +F       +  +K  K      + I  +    +D +V       DPL  WE    KW
Sbjct: 249 SIMFSQ----YDEYLKLIKDNVEHAEVINVNLFLGSDNDVDRLKK--DPLTFWEQTAIKW 302

Query: 351 YTVDVVNSLSEKKRHLEKLKKVSIQYSLNEQMIHRNNRAILQMTVFGVFTGIAVTL-IAY 409
           YT+ + +S  +KK +LE++K +S+QYS+NEQ IHRNN ++ QM +     GI+VTL I  
Sbjct: 303 YTMTLTSSSKDKKHNLERIKNLSLQYSVNEQTIHRNNASMFQMFLGSAQLGISVTLVILM 362

Query: 410 TLYLAFLSPLNTKRHKILFPIWGGWYMILLISLFFLIDCFIWHRTGINYRFIMFGEVQAK 469
           T+ LA  S  + +    L PIW  ++ +  + L F+IDCFIW++  INYRFIMFGE+ ++
Sbjct: 363 TIILAKNS--SDEVRSALLPIWSSFHYLTFMGLLFIIDCFIWYKVKINYRFIMFGEIHSR 420

Query: 470 SGTQFFNNDFATTGIPLRLYXXXXXXXXXXXXXXXXXHFDHLTPYGYIYFIVVGLLFITP 529
           +G   FNNDF  T IPL+ +                   + L P+   +  +   LF   
Sbjct: 421 NGPVLFNNDFGMTHIPLQFFHATTFLCICSILAFCSLMLEKLEPWMITWLCIAVALFFWK 480

Query: 530 YDLI---PYWDKLVETRKFLVTTTIRLVLSGLYPVEFKDFFLGDIICSLTYTLSDLAIFA 586
           + +I   PYW +  ++RK++ T+ IRLV SG +PV+F DFFLGDI+CSLTY++S  A   
Sbjct: 481 FQVIQPWPYWYETFQSRKYIFTSFIRLVFSGFFPVQFGDFFLGDIVCSLTYSMSQFATLG 540

Query: 587 CYYAPKTRKDPLGMCGSSHSKAMGVLSCLPSFWRFMQCVRRFFDSNDWFPHLPNAAKYLL 646
           C     +++D    C       +G+LSCLPS+WRF+QCVRR+FDS DWFPHL NA KYLL
Sbjct: 541 CLTFNDSKEDK---CRYEKLMWIGILSCLPSYWRFVQCVRRYFDSYDWFPHLLNAFKYLL 597

Query: 647 GVAYNATLCAYRLSNHSPAKRNPFIIFATLNSISTSIWDLVMDWSVLQSSIGNENLFLRK 706
           G+++NA+L  Y+        +   I+F  LNS  TSIWDL+MDWS+LQ+   ++N  LR 
Sbjct: 598 GISFNASLYWYKSWPQMQKFKVLLIVFGCLNSTLTSIWDLIMDWSLLQTK--SKNFLLRD 655

Query: 707 DLYLAGKRNWETGKYDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQT-IQQSAVTSFALAV 765
           DLYL GK+NW++GKY   +K +YY  MV DVV+R++W+ Y V   T   +  + + A+A 
Sbjct: 656 DLYLCGKKNWKSGKYSSKKKCIYYFIMVFDVVVRYEWVFYMVKNNTDYVRHPLIALAMAT 715

Query: 766 TEVCRRFIWVIFRVENEHVANVHLFRVTGEAL-LPYPNQDVVDFSGKATTDLYDDQHFQQ 824
            E+ RRF+WVI RVENEHVANVHLF+VT +   LP+P  +         ++L+ ++ +  
Sbjct: 716 LEILRRFVWVILRVENEHVANVHLFKVTDDNWQLPFPTIE--------DSELHMEEDYSA 767

Query: 825 GRDSIESSRPXXXXXXXXXXXXINNKFEEPTATYH-SIVRRRTAIFDNISRSIPWAHAKD 883
             +++++               + ++ + P +T     + R+ ++F+     IPWAHA D
Sbjct: 768 AAENMDN-----IAMLSVMKSDLESQQQRPRSTSAVPKLNRKASVFE----IIPWAHATD 818

Query: 884 FQRPLTQHNGESS 896
           FQRP+   +  S+
Sbjct: 819 FQRPIETASVNSA 831

>KLLA0A02057g 186220..187374 gi|1169545|sp|P41771|ERD1_KLULA
           Kluyveromyces lactis ERD1 PROTEIN, start by similarity
          Length = 384

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 96/224 (42%), Gaps = 8/224 (3%)

Query: 568 LGDIICSLTYTLSDLAIFA--CYYAPKTRKDPLGMCGSSHSKAMGVL-SCLPSFWRFMQC 624
           + D + S +  L DLAI+A   ++ P   K  +    ++ S  + VL   LPS  R +Q 
Sbjct: 154 ISDTLTSYSKPLVDLAIYATFLFHDPTNVKCQVERYENAISLNIDVLVGVLPSLVRMIQS 213

Query: 625 VRRFFDSNDW---FPHLPNAAKYLLGVAYNATLCAYRLSNHSPAKRNPFIIFATLNSIST 681
           +R F            L NA KY   +         R  N  P     + +F   NS  +
Sbjct: 214 LREFTRGRSQKKDGSQLFNAFKYAGNIPIMLVTVYTRYYNLGPLGMMYWFMF--WNSAYS 271

Query: 682 SIWDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWETGKYDWSRKAVYYIAMVLDVVIRF 741
             WD+ MDW +      N +  +  +               + + A YY AM LD ++RF
Sbjct: 272 FWWDVTMDWKLELFDFVNGDTSVNNNNSSNKADGLLRSILLYRKNAWYYSAMALDFILRF 331

Query: 742 QWIVYAVAPQTIQQSAVTSFALAVTEVCRRFIWVIFRVENEHVA 785
            W    ++  ++    +  F L + E+ RR+IW+ F+VE E++A
Sbjct: 332 VWFWEYISGHSVFYGELNIFWLQILEIIRRWIWLFFKVEVEYIA 375

>Kwal_47.18721
          Length = 383

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/246 (23%), Positives = 106/246 (43%), Gaps = 29/246 (11%)

Query: 553 LVLSGLYPVEFKD--FFLGDIICSLTYTLSDLAIFACYYAPKTRKDPLGMCGSSHSKAMG 610
           L L  + P   ++    + D + S +  L D   + C+       DP+         AMG
Sbjct: 145 LALGNIEPKPLRNNYILISDSLTSYSKPLIDFGFYLCHLV----VDPISENCIISRTAMG 200

Query: 611 -------VLSCLPSFWRFMQCVRRFFDS---NDWFPHLPNAAKYLLGVAYNATLCAYRLS 660
                  ++   P   R +QC+R +  S    D    + NA KY L +     +CA    
Sbjct: 201 SAINLDLMIGTAPVIIRLLQCLREWRRSRTLGDARSSIFNALKYSLHLP--IVMCAVYSR 258

Query: 661 NHSPAKRNPFII-FATLNSISTSIWDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWETG 719
           +    K   ++  F  LNS  +  WDL MDW++   + G   +   ++  L  +R++ + 
Sbjct: 259 SFPDVKPGNYVYWFMLLNSFYSFWWDLTMDWNLGVFNFGRSGM--GRNEVLRARRHFPS- 315

Query: 720 KYDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQTIQQSAVTSFALAVTEVCRRFIWVIFRV 779
                   +Y++AM  D  +RF W+   +A ++  +     F L + E+ RR+IW+  ++
Sbjct: 316 -------YMYFLAMSADFTLRFMWLWELLAGRSAFEGEANIFFLQILEILRRWIWIFVKL 368

Query: 780 ENEHVA 785
           + E ++
Sbjct: 369 DAEAIS 374

>Sklu_2440.13 YDR414C, Contig c2440 19959-21104 reverse complement
          Length = 381

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 91/198 (45%), Gaps = 24/198 (12%)

Query: 594 RKDPLGMCGSSHSKAMGVLSCLPSFWRFMQCVR---RFFDSNDWFPHLPNAAKYLLG--- 647
           RKDPLG+  S +   M  +   P+  R +QC+R   R   S D    L NA KY      
Sbjct: 191 RKDPLGI--SLNLDLM--IGITPATIRLIQCLREYKRSTSSADARAALFNALKYSCQFPI 246

Query: 648 VAYNATLCAYRLSNHSPAKRNPFIIFATLNSISTSIWDLVMDWSVLQSSIGNENLFLRKD 707
           + Y     AY     +P+    +++   LNS+ T  WDL MDW     +  N  + L + 
Sbjct: 247 LVYTVVTRAY--PGETPSANIYWLLL--LNSMYTFWWDLTMDWKFGFFNFTNSGMKLNEV 302

Query: 708 LYLAGKRNWETGKYDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQTIQQSAVTSFALAVTE 767
                       +  +S K  Y  A+ +D ++RF W+   V+  ++ +  +  F L   E
Sbjct: 303 ---------SRAQRHFSIKTCY-CAIFVDFILRFAWLWELVSGVSVFKGEMNVFWLQFLE 352

Query: 768 VCRRFIWVIFRVENEHVA 785
           + RR+IW+ F+VE E ++
Sbjct: 353 IVRRWIWIFFKVEAEFLS 370

>AAR127C [314] [Homologous to ScYDR414C (ERD1) - SH]
           (568957..570102) [1146 bp, 381 aa]
          Length = 381

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 111/261 (42%), Gaps = 33/261 (12%)

Query: 539 LVETRKFLVTTTIRLVLSGLY---PVEFKDFFLGDIICSLTYTLSDLAIFACYYAPKTRK 595
           ++ + + +     R++L G     P+      L D + S    L D   +          
Sbjct: 131 ILRSSRMVRRCVARMLLGGGIEGKPLRTNYILLADTLTSYGKPLMDFTAYLVLLFRTPLA 190

Query: 596 DPLGMCGSSHSKAMG---VLSCLPSFWRFMQCVRRFFDSND-WFPH---LPNAAKYLLGV 648
           DPL +     + A+    V+  +PS  R +QC+R +    D W      L NA KY    
Sbjct: 191 DPLAVRDLPSNAALHIDLVVGAIPSVIRLVQCLREYRRKEDAWAARRASLFNALKY---- 246

Query: 649 AYNATLCAYRLSNHSPAKRNP--FIIFATL-NSISTSIWDLVMDWSVLQ---SSIGNENL 702
           +    +  + L + S A      ++ +A L NS+ +  WD+ MDW +     SS G E  
Sbjct: 247 SSQLPILVHALLSRSGAAHGGQRWVRWAMLLNSVYSFWWDVTMDWKLGLFNFSSAGME-- 304

Query: 703 FLRKDLYLAGKRNWETGKYDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQTIQQSAVTSFA 762
              +D  L  +R +   KY       YY A++ D V++F W+      + + +  +    
Sbjct: 305 ---RDEVLRHRRLYSV-KY-------YYGAVLYDFVMKFMWLWELHVGRALFRRDLNPVW 353

Query: 763 LAVTEVCRRFIWVIFRVENEH 783
           L + EV RR+IW  F++E E+
Sbjct: 354 LHLLEVIRRWIWTFFKIEAEY 374

>CAGL0F02871g complement(278122..279228) similar to sp|P16151
           Saccharomyces cerevisiae YDR414c ERD1 required for
           retention of luminal ER proteins, hypothetical start
          Length = 368

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 77/185 (41%), Gaps = 37/185 (20%)

Query: 612 LSCLPSFWRFMQCVRRFFDSNDWFPHLPNAAKYLLGVAYNATLC-----AYRLSNHSPAK 666
           L+ +P   R  QC++ +  + + F  L NA KY         LC      Y   + +   
Sbjct: 193 LAVIPPLIRLCQCLKEYKTTKE-FTLLANALKY--SCHLPVVLCLWYSRVYGDDSLTIRD 249

Query: 667 RNPFIIFATLNSISTSIWDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWETGKYDWSR- 725
            N   +   + S  + IWD+  DW++   S                     + +Y  SR 
Sbjct: 250 YNILKVMMFIQSTYSYIWDVRKDWTITSIS---------------------SIRYQKSRV 288

Query: 726 ---KAVYYIAMVLDVVIRFQWI-VYAVAPQTIQQSAVTSF---ALAVTEVCRRFIWVIFR 778
              K  Y+IA+V+D ++R+ W+ +  +AP  +       F        E+ RR  WV+F+
Sbjct: 289 LFPKFYYHIAIVMDGIMRYWWLWIIILAPYDVSGKPTALFFEKEAQFIELIRRAGWVVFK 348

Query: 779 VENEH 783
           +E+E+
Sbjct: 349 LESEY 353

>Scas_570.8
          Length = 353

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 75/182 (41%), Gaps = 35/182 (19%)

Query: 612 LSCLPSFWRFMQCVRRFFDSNDWFPHLPNAAKYLLGVAYNATLCAYRLSNHSPAKRNPFI 671
           ++ LP   R  QC++ +    D    L N  KY   +   A +   R+   S        
Sbjct: 192 VASLPVLIRIFQCLKEYRAVGD-KSMLGNTVKYCSNLPILACVWYSRVHGGSSEWNQTLT 250

Query: 672 IFATLNSISTSI-WDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWETGKYDWSRKAVYY 730
           ++  L   S S+ WD+ MDW +  SS                 R   + K       +YY
Sbjct: 251 MWLRLFHSSYSLFWDVKMDWFIDISS-----------------RRLRSTKLA-LPTTIYY 292

Query: 731 IAMVLDVVIRFQWIVYAVAPQTIQQSAVTSF--------ALAVTEVCRRFIWVIFRVENE 782
           + +++D +IR+ W+        +Q    +S+         L   EV RR IWV+F++E+E
Sbjct: 293 VGILIDFIIRYWWV-------WVQWYGASSYFNFIFFDSELQYLEVFRRAIWVVFKLESE 345

Query: 783 HV 784
           +V
Sbjct: 346 YV 347

>AFR628C [3820] [Homologous to ScYJL198W (PHO90) - SH; ScYCR037C
           (PHO87) - SH] (1576713..1579322) [2610 bp, 869 aa]
          Length = 869

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 28/39 (71%)

Query: 236 RALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKT 274
           R++L   +++ Y+ L  +KSY ++N +GF KI KKFDKT
Sbjct: 230 RSILKKKIIDLYVELSQLKSYIELNRIGFFKITKKFDKT 268

>Kwal_33.13618
          Length = 891

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 236 RALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKT--CKT-QELAGFMRFVRANYT 292
           +A++   L++ Y+ L  +KS+ ++N +GF KI KKFDKT  C   ++L     F    Y 
Sbjct: 252 KAIVKKNLVDLYVDLAQLKSFIELNRIGFLKITKKFDKTLDCNIRRDLIESGEFFNTTYV 311

Query: 293 IFKHDAVSTEATI 305
              H  V+ +A I
Sbjct: 312 FQPHTFVALDAKI 324

>YCR037C (PHO87) [571] chr3 complement(194409..197180) Member of the
           phosphate permease family of membrane transporters,
           appears to play a supporting role in phosphate uptake
           under high phosphate growth conditions [2772 bp, 923 aa]
          Length = 923

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 234 HARALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKT---QELAGFMRFVRAN 290
             ++LL   ++  Y+ L  +KS+ ++N +GF KI KK DK       QEL     F +  
Sbjct: 283 QKKSLLKQTIINLYIDLCQLKSFIELNRMGFSKITKKSDKVLHMNTRQELIESEEFFKDT 342

Query: 291 YTIFKHDAVST 301
           Y IF+H+ +S+
Sbjct: 343 Y-IFQHETLSS 352

>YDR414C (ERD1) [1239] chr4 complement(1295586..1296674) Protein
           required for retention of luminal ER proteins [1089 bp,
           362 aa]
          Length = 362

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 78/183 (42%), Gaps = 31/183 (16%)

Query: 612 LSCLPSFWRFMQCVRRFFDSNDWFPHLPNAAKYLLGVAYNATLCAYRLSNHSPAKRNPFI 671
           ++ LP   R +QC+R +   ++    L NA KY          C +R   +  +     +
Sbjct: 193 VALLPVLVRLLQCLREYRLLHE-ATLLFNALKY--SCNLPILFCTWRSRVYEGSINEERL 249

Query: 672 -----IFATLNSISTSIWDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWETGKYDWSRK 726
                 F  +NS  T  WD+ MDWS L S              L   R+         +K
Sbjct: 250 HHVQRWFMLINSSYTLFWDVRMDWS-LDS--------------LTSLRSRSKSAVT-LKK 293

Query: 727 AVYYIAMVLDVVIRFQWIVYAVAPQTIQQSAVTS------FALAVTEVCRRFIWVIFRVE 780
            +Y+ A+++D ++RF W+ +    Q ++  A  S        +   EV RR IWV+F+++
Sbjct: 294 KMYHSAILVDFLLRFWWL-WVYLSQNLKLVAADSDYIFFQGEMQYFEVIRRGIWVVFKLD 352

Query: 781 NEH 783
            E+
Sbjct: 353 AEY 355

>Scas_625.16
          Length = 932

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 232 LKHARALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANY 291
           L+H +  L   L+  Y  L  +K + ++N  GF KI KKFDK+  T   + ++  ++   
Sbjct: 271 LQH-KVTLKKRLVAIYTQLSELKEFIELNQTGFSKICKKFDKSLNTSIKSSYLETIKKKS 329

Query: 292 TIFKHDAV 299
           ++FK + +
Sbjct: 330 SVFKPETL 337

>ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH]
           (1193040..1195463) [2424 bp, 807 aa]
          Length = 807

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 7/102 (6%)

Query: 238 LLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKHD 297
           LL   L+  Y  L  +KSY ++N  GF KI KKFDK+ +T     +M+ +     +F   
Sbjct: 171 LLKKRLVMAYTRLAELKSYFELNHTGFSKICKKFDKSLETNIRGNYMQSLPKKTHMFSQG 230

Query: 298 AVSTEAT-------IKASKAKTLTDDDIGEDSSTITDTNVSL 332
            +   +T       + AS    +  D IG +     +  +SL
Sbjct: 231 RIEYISTCIQETIMMYASLIHGVNHDSIGPEELQEAEGELSL 272

>CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces
           cerevisiae YNR013c, start by similarity
          Length = 886

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 64/141 (45%), Gaps = 8/141 (5%)

Query: 227 NPHKELKHARALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRF 286
           NP  +L+H +  L   L+  Y  L  +K + D+N  GF KI KKFDK+  T     +++ 
Sbjct: 200 NP--QLQH-KVTLKKRLVMVYTQLSELKDFIDLNKTGFTKICKKFDKSLDTAIKKPYLKQ 256

Query: 287 VRANYTIFKHDAVS-TEATIKASKAKTLTDDDIGEDSSTITDTNVSLTSTTIDPLRAWEA 345
           +     +F  +  +  E TI+ +    +T   + ED   IT  ++S  +   D +     
Sbjct: 257 LELKTHVFNPETFAKIEQTIRET---IITYARLSEDQLPITIESISQQTGNPD-VEHQAL 312

Query: 346 KLTKWYTVDVVNSLSEKKRHL 366
            L +   VD  N+  E   HL
Sbjct: 313 ALEEDELVDYENAEKELSEHL 333

>YNR013C (PHO91) [4596] chr14 complement(649027..651711) Member of
           the phosphate permease family of membrane transporters,
           has similarity to Pho87p and Pho90p [2685 bp, 894 aa]
          Length = 894

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%)

Query: 236 RALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFK 295
           R  L   L+  Y  L  +K + ++N  GF KI KKFDK+  T     ++ +++ +  +F 
Sbjct: 207 RLSLKKRLISIYTQLSELKDFIELNQTGFSKICKKFDKSLNTNLKQNYLNYIKFHSHVFN 266

>KLLA0C03454g 311611..314313 similar to sp|P25360 Saccharomyces
           cerevisiae YCR037c PHO87 member of the phosphate
           permease family, start by similarity
          Length = 900

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 27/39 (69%)

Query: 236 RALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKT 274
           R++L   +++ Y+ L  +KS+ ++N +GF KI KKFDK 
Sbjct: 260 RSILKKNVIDLYVDLAQLKSFIELNRIGFSKISKKFDKV 298

>Kwal_23.6129
          Length = 816

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%)

Query: 232 LKHARALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANY 291
           L   R  L   L+  Y  L  +KS+ ++N  GF KI KKFDK+      + +M  + +  
Sbjct: 167 LVEDRINLKKRLVVAYTQLSELKSFIELNQTGFSKICKKFDKSLDANIKSEYMAKLSSRV 226

Query: 292 TIFKHDAVST 301
            +F  + +ST
Sbjct: 227 RVFSPEILST 236

>CAGL0K08008g 793765..796437 similar to tr|Q06825 Saccharomyces
           cerevisiae YPR090w, hypothetical start
          Length = 890

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 24/122 (19%)

Query: 41  IPAVGYVSGRGTPKKKYNDFQVECINDFIEDWLIPNQLYKCN--EFYLWLLSQCQEKYLI 98
           IP +  +  RG   + Y       I D I +    N   + N  EFY +   Q +E++  
Sbjct: 778 IPEMTDIYARGVDHESYQPLLPVSIQDMIYEIHSENAKLRMNASEFYDY---QNEEQH-- 832

Query: 99  LSQQLDCYREHKKEFREISS------------RVTYQTSSTSVLQAYGSISNAPEEDIEE 146
             Q++D    H+  ++E SS            R  YQT  T  + ++     AP+ED EE
Sbjct: 833 -EQEVDNEEAHEDSYKENSSANEDNDLDNNNDRFEYQTVDTPAVASHW----APKEDFEE 887

Query: 147 DP 148
           +P
Sbjct: 888 NP 889

>CAGL0L12012g complement(1290397..1291278) similar to sp|P32643
           Saccharomyces cerevisiae YER175c, start by similarity
          Length = 293

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query: 218 DEHGNKILKNPHKELKHARALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKT 277
           D+ G  IL+N ++ ++    L  D         + V +  D+   GF +I K++   C T
Sbjct: 175 DQPGKTILRNKYEAVQIDTGLFKDVE-------RHVLTPTDIRKPGF-EISKEYLPICTT 226

Query: 278 QELAGFMRFVR--ANYTIFKHDAVSTE 302
             L+G M ++R  + Y  +KHD  + +
Sbjct: 227 MPLSGLMDYIRTWSGYHNWKHDPANAD 253

>CAGL0L05082g complement(573480..574643) similar to sp|P36081
           Saccharomyces cerevisiae YKL077w, start by similarity
          Length = 387

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 16/88 (18%)

Query: 221 GNKILKNPHKELKHARALLSD----------------ALLEFYLFLQLVKSYRDVNVVGF 264
           G K+ K    EL+   A +SD                AL+  Y FL L K  RD + +  
Sbjct: 288 GTKVAKKTKDELRLEDAGISDDTWYYVALTIPTLVVVALVFMYFFLYLNKGNRDFSDITM 347

Query: 265 RKIVKKFDKTCKTQELAGFMRFVRANYT 292
           +++ KK     K  ++ GF +F    Y+
Sbjct: 348 QEMKKKHRVLGKISDMKGFKKFKNHKYS 375

>Scas_689.1
          Length = 691

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 26/39 (66%)

Query: 236 RALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKT 274
           ++LL  +++  ++ L  +KS+ ++N +GF KI KK DK 
Sbjct: 42  KSLLKQSIVNLFIDLSQLKSFIELNKMGFSKITKKGDKV 80

>CAGL0F02387g complement(229207..232065) similar to sp|P25360
           Saccharomyces cerevisiae YCR037c PHO87 or sp|P39535
           Saccharomyces cerevisiae YJL198w, start by similarity
          Length = 952

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 26/38 (68%)

Query: 236 RALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDK 273
           +++L  +++  Y+ L  +KS+ ++N +GF KI KK DK
Sbjct: 307 KSILKQSIINLYVDLCQLKSFIELNRMGFSKITKKSDK 344

>Scas_634.15
          Length = 916

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 9/79 (11%)

Query: 237 ALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQ---ELAGFMRFVRANYTI 293
           +LL  ++   Y+ L  +KS+ ++N +GF KI KK DK        E+     F +  Y I
Sbjct: 275 SLLKQSITNLYIDLCQLKSFIELNRLGFNKITKKCDKVLHLNIRDEMIQTEEFFKDTY-I 333

Query: 294 FKHDAVSTEATIKASKAKT 312
           F+ D      T+K SK  T
Sbjct: 334 FQKD-----TTLKLSKKIT 347

>KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces
           cerevisiae YNR013c, start by similarity
          Length = 859

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 8/75 (10%)

Query: 249 FLQL--VKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKHDAVS------ 300
           F QL  +KS+ ++N  GF KI KKFDK+  +     +++ +     +F    +       
Sbjct: 219 FTQLSELKSFIELNQTGFAKICKKFDKSLDSNIKTDYLKSLSKKSHVFNEHTIENLSNDI 278

Query: 301 TEATIKASKAKTLTD 315
            E  +  +KA  L D
Sbjct: 279 NEVIVMYAKAIGLMD 293

>CAGL0I04906g 448237..448854 highly similar to sp|P25451
           Saccharomyces cerevisiae YER094c PUP3, start by
           similarity
          Length = 205

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 48/114 (42%), Gaps = 17/114 (14%)

Query: 507 HFDHLTPYGYIYFIVVGLL--FITPYDLIPYWD---KLVETRKFLVTTTIRLVLSGLYPV 561
           +F+ +  YG+++F + GL     T  +L  Y     KL E R     T  +LV S LY  
Sbjct: 39  NFEKVFNYGHVFFGITGLATDVTTLNELFRYKTNLYKLREDRPIEPETFTQLVSSTLYER 98

Query: 562 EFKDFFLGDIICSLTYT-----LSDLAIFAC------YYAPKTRKDPL-GMCGS 603
            F  +F+G ++  +        ++   +  C      +    T  D L GMC S
Sbjct: 99  RFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCES 152

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 57/134 (42%), Gaps = 7/134 (5%)

Query: 185 PEALKPKSINTKLKETFAYSXXXXXXXXXMRNKDEHGNKILKNPHKELKHARALLS---D 241
           PE  K + +  KL ET   +         ++   E  +  LK   + ++H    L    D
Sbjct: 10  PEEQKKRHL--KLFETIDINHTGKIDIRTLQQAFEKSDHPLKGSPEAIEHIFKSLDQNKD 67

Query: 242 ALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKHDAVST 301
           ++++F  F + V +      VGF+KI K  D   K +EL+ ++   R ++ I   D   +
Sbjct: 68  SVIDFNDFEKYVTTAETQIKVGFQKIDKDNDGRIKMEELSKYLSQFREDHDI--KDVADS 125

Query: 302 EATIKASKAKTLTD 315
           +   K SK     D
Sbjct: 126 KQRKKPSKISNFVD 139

>Scas_595.9
          Length = 1148

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%)

Query: 241 DALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKHDAVS 300
           DA L+    L  ++ Y ++N  GF K +KK+DK   + E   ++  V     IF  + V+
Sbjct: 131 DAFLKLQTDLNELEQYIELNRTGFSKALKKWDKRSHSHEKEFYLATVVTVQPIFTRNKVA 190

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.137    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,880,621
Number of extensions: 1165293
Number of successful extensions: 3456
Number of sequences better than 10.0: 45
Number of HSP's gapped: 3507
Number of HSP's successfully gapped: 49
Length of query: 898
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 787
Effective length of database: 12,753,511
Effective search space: 10037013157
Effective search space used: 10037013157
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 66 (30.0 bits)