Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L00715g1144112760570.0
Scas_704.381161113545560.0
YIL048W (NEO1)1151113645550.0
Sklu_2193.11143114744200.0
KLLA0C08393g1148114042210.0
Kwal_23.57891133113341180.0
ADL079C1166112040010.0
Scas_89.127125712061e-157
KLLA0A04015g134399211621e-138
Kwal_26.7070131593711501e-137
CAGL0G06270g1328102311401e-135
YAL026C (DRS2)135593511051e-130
ADR350W131186310741e-126
YER166W (DNF1)15718918991e-101
KLLA0C17644g15768938846e-99
CAGL0G08085g15788898812e-98
AGR120C15478678731e-97
YDR093W (DNF2)16128958742e-97
CAGL0L11814g15768668696e-97
Scas_576.815918628634e-96
Scas_636.1615549008607e-96
CAGL0H04477g16264245533e-57
KLLA0E01650g15504095498e-57
Kwal_23.355615974075373e-55
AFL191W15753565283e-54
YMR162C (DNF3)16565255151e-52
Scas_669.316383874927e-50
Scas_505.410252153424e-32
AFL011W12427042371e-19
AFR567W14497212381e-19
Kwal_23.316011007292352e-19
CAGL0A00517g11228022333e-19
YDR038C (ENA5)10917872281e-18
YDR039C (ENA2)10917872281e-18
Scas_665.3014395362262e-18
YDR040C (ENA1)10917222262e-18
KLLA0B08217g14397062253e-18
KLLA0A08910g12807652243e-18
CAGL0K12034g10877722182e-17
YOR291W14725352173e-17
Kwal_47.1754712407652154e-17
CAGL0I04312g9517422092e-16
Kwal_26.920714696062074e-16
KLLA0E14630g10824921975e-15
YGL167C (PMR1)9507481975e-15
KLLA0F20658g10824931958e-15
Kwal_14.14989396681912e-14
AGL097C10967171903e-14
KLLA0A03157g9386791886e-14
Scas_707.48*7416761868e-14
CAGL0J01870g9467421814e-13
CAGL0M11308g14525311798e-13
AEL301W9576651715e-12
YGL006W (PMC1)11733591653e-11
CAGL0L01419g12144251412e-08
AFR354C12105601412e-08
YGL008C (PMA1)9181571198e-06
KLLA0E22352g12062921181e-05
YEL031W (SPF1)12156781101e-04
Scas_583.14*8752951081e-04
YPL036W (PMA2)9471571036e-04
AGL085C909275970.003
KLLA0A09031g899378960.004
Scas_688.1913369950.006
Scas_227.0d307254890.017
Kwal_47.17522899381900.022
Scas_297.1800193890.026
KLLA0D04092g115241850.076
CAGL0M08602g101297840.099
CAGL0A00495g90286840.11
Scas_710.41904196840.11
AGL041C123371820.19
KLLA0F07447g97547810.22
Scas_569.0d468118780.44
Kwal_55.2157598948790.45
CAGL0B04103g27759740.95
Kwal_47.1821929352741.2
YDR270W (CCC2)100463751.4
YBR295W (PCA1)121644741.7
Kwal_33.14284441116678.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L00715g
         (1127 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...  2337   0.0  
Scas_704.38                                                          1759   0.0  
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...  1759   0.0  
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement        1707   0.0  
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...  1630   0.0  
Kwal_23.5789                                                         1590   0.0  
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...  1545   0.0  
Scas_89.1                                                             469   e-157
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   452   e-138
Kwal_26.7070                                                          447   e-137
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   443   e-135
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   430   e-130
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   418   e-126
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   350   e-101
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   345   6e-99
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   343   2e-98
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   340   1e-97
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   341   2e-97
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   339   6e-97
Scas_576.8                                                            337   4e-96
Scas_636.16                                                           335   7e-96
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   217   3e-57
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   216   8e-57
Kwal_23.3556                                                          211   3e-55
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   207   3e-54
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   202   1e-52
Scas_669.3                                                            194   7e-50
Scas_505.4                                                            136   4e-32
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    96   1e-19
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    96   1e-19
Kwal_23.3160                                                           95   2e-19
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    94   3e-19
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    92   1e-18
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    92   1e-18
Scas_665.30                                                            92   2e-18
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    92   2e-18
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    91   3e-18
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    91   3e-18
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    89   2e-17
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    88   3e-17
Kwal_47.17547                                                          87   4e-17
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    85   2e-16
Kwal_26.9207                                                           84   4e-16
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    80   5e-15
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    80   5e-15
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    80   8e-15
Kwal_14.1498                                                           78   2e-14
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    78   3e-14
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    77   6e-14
Scas_707.48*                                                           76   8e-14
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    74   4e-13
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    74   8e-13
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    70   5e-12
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    68   3e-11
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    59   2e-08
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    59   2e-08
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    50   8e-06
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    50   1e-05
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    47   1e-04
Scas_583.14*                                                           46   1e-04
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    44   6e-04
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    42   0.003
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    42   0.004
Scas_688.1                                                             41   0.006
Scas_227.0d                                                            39   0.017
Kwal_47.17522                                                          39   0.022
Scas_297.1                                                             39   0.026
KLLA0D04092g complement(344666..348124) some similarities with s...    37   0.076
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    37   0.099
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    37   0.11 
Scas_710.41                                                            37   0.11 
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    36   0.19 
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    36   0.22 
Scas_569.0d                                                            35   0.44 
Kwal_55.21575                                                          35   0.45 
CAGL0B04103g 400331..401164 similar to tr|Q06104 Saccharomyces c...    33   0.95 
Kwal_47.18219                                                          33   1.2  
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    33   1.4  
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    33   1.7  
Kwal_33.14284                                                          30   8.8  

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 2337 bits (6057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1127/1127 (100%), Positives = 1127/1127 (100%)

Query: 1    MSASPHNLNSRNSVSLDSFENSFDEALDNIEINPVRGYHIDNSLNNSNRITDFDIDENFE 60
            MSASPHNLNSRNSVSLDSFENSFDEALDNIEINPVRGYHIDNSLNNSNRITDFDIDENFE
Sbjct: 1    MSASPHNLNSRNSVSLDSFENSFDEALDNIEINPVRGYHIDNSLNNSNRITDFDIDENFE 60

Query: 61   MRSVLEDEEHFDNDGHPLMRDRTRSNASTLNSRYNKYNNVSGSRSVTGYTPSTIGVGLKK 120
            MRSVLEDEEHFDNDGHPLMRDRTRSNASTLNSRYNKYNNVSGSRSVTGYTPSTIGVGLKK
Sbjct: 61   MRSVLEDEEHFDNDGHPLMRDRTRSNASTLNSRYNKYNNVSGSRSVTGYTPSTIGVGLKK 120

Query: 121  WFVNVKTAISSGWKDYSTSVALGDEHTEREVHPGTTQVYDRHRFPSNEVSNAKYNAVTFL 180
            WFVNVKTAISSGWKDYSTSVALGDEHTEREVHPGTTQVYDRHRFPSNEVSNAKYNAVTFL
Sbjct: 121  WFVNVKTAISSGWKDYSTSVALGDEHTEREVHPGTTQVYDRHRFPSNEVSNAKYNAVTFL 180

Query: 181  PTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRR 240
            PTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRR
Sbjct: 181  PTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRR 240

Query: 241  RDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQ 300
            RDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQ
Sbjct: 241  RDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQ 300

Query: 301  LDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDN 360
            LDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDN
Sbjct: 301  LDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDN 360

Query: 361  TLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILS 420
            TLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILS
Sbjct: 361  TLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILS 420

Query: 421  ILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVR 480
            ILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVR
Sbjct: 421  ILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVR 480

Query: 481  TSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKND 540
            TSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKND
Sbjct: 481  TSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKND 540

Query: 541  SVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESV 600
            SVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESV
Sbjct: 541  SVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESV 600

Query: 601  GLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGAD 660
            GLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGAD
Sbjct: 601  GLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGAD 660

Query: 661  TVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQE 720
            TVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQE
Sbjct: 661  TVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQE 720

Query: 721  MANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSIS 780
            MANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSIS
Sbjct: 721  MANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSIS 780

Query: 781  AKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVV 840
            AKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVV
Sbjct: 781  AKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVV 840

Query: 841  HLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQA 900
            HLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQA
Sbjct: 841  HLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQA 900

Query: 901  SLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIA 960
            SLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIA
Sbjct: 901  SLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIA 960

Query: 961  LYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVAL 1020
            LYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVAL
Sbjct: 961  LYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVAL 1020

Query: 1021 SFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALIFNELIMVALEIYTWNKTMIITEIVT 1080
            SFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALIFNELIMVALEIYTWNKTMIITEIVT
Sbjct: 1021 SFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALIFNELIMVALEIYTWNKTMIITEIVT 1080

Query: 1081 LAIYVFSVPFLGEYFDLKYISTLKFITELILILVVSIFPVWLTKAIY 1127
            LAIYVFSVPFLGEYFDLKYISTLKFITELILILVVSIFPVWLTKAIY
Sbjct: 1081 LAIYVFSVPFLGEYFDLKYISTLKFITELILILVVSIFPVWLTKAIY 1127

>Scas_704.38
          Length = 1161

 Score = 1759 bits (4556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 857/1135 (75%), Positives = 969/1135 (85%), Gaps = 27/1135 (2%)

Query: 9    NSRNSVSLDSFENSFDEALDNIEINPVRGYHIDNSLNNSNRITDFD------IDENFEMR 62
            NS +S  L  FE+SFD  LDNIE+N     + +N+L N+  I          + E+FEM+
Sbjct: 21   NSADSFDL-QFEDSFDAVLDNIELN-TDTRNQNNTLPNNQNINKASSENKDKLQESFEMK 78

Query: 63   SV------LEDEEHFDN-DGHPLMRDRTRSNASTLNSRYNKYNNVSGSRSVTGYTPSTIG 115
            S+      L    +  N D  PLM D    +AS  +    KY NVS S ++  ++ +   
Sbjct: 79   SLNARNGGLGHSRNSSNGDRQPLMHD----SASNPDGSPYKYTNVSES-ALNLHSNNR-- 131

Query: 116  VGLKKWFVNVKTAISSGWKDYST--SVALGDEHTEREVHPGTTQVYDRHRFPSNEVSNAK 173
                 W   +K   +  WK + T  SV L D H ERE+HP TT VYDR+R+P NE+SNAK
Sbjct: 132  --FSNWITKLKMVGAQKWKKFHTMGSVELDDRHMEREIHPSTTPVYDRNRYPGNEISNAK 189

Query: 174  YNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTVTMAKEAS 233
            YNA TF+PTLLYEQFKFF+NLYFL+VALSQAIPALRIGYLSSYVVPLAFVLTVTM+KEA 
Sbjct: 190  YNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFVLTVTMSKEAM 249

Query: 234  DDIQRRRRDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGE 293
            DDIQRRRRD ESN ELY VL + + V SKDLKVGDLIKISKG R+PADL+LLQSSEPSGE
Sbjct: 250  DDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGE 309

Query: 294  AFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNT 353
             FIKTDQLDGETDWKLRIA  LTQNL E DL+ K++ITASAPEK+IH+FLG+VTYKDT++
Sbjct: 310  TFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSS 369

Query: 354  SGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILC 413
            + L+IDNTLWANTVLAS+GFCIGCV+YTGRDTRQAMNTT+A VKTGLLELEIN ISKILC
Sbjct: 370  NPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILC 429

Query: 414  ACVFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKT 473
            A VF LSI+LVVFAG HN DWY+D+MRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD T
Sbjct: 430  ASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDT 489

Query: 474  IPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQG 533
            IPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK+HLG VSYT+ET DIVSDY+  
Sbjct: 490  IPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDA 549

Query: 534  MIESKNDS-VTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIA 592
            ++ S N +  +     ST+RKD +  V D++ TLAICHNVTPTFEDDELTYQAASPDEIA
Sbjct: 550  LVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIA 609

Query: 593  IVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQY 652
            IVKFTESVGLSLFKRDRHS+SLLH HSG+IL Y++L +FPFNSD+KRMGIIV+D+QKD+Y
Sbjct: 610  IVKFTESVGLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVHDEQKDEY 669

Query: 653  WFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSA 712
            WF+QKGADTVM RIV NNDWLEEETGNMAREGLRTLV+GRKKL++ IY+QFKK+Y++ S 
Sbjct: 670  WFMQKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASL 729

Query: 713  SMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVE 772
            SM NR+Q+M   I+KYLE+DLELLGLTGVEDKLQ DVKSSIELLRNAGIKIWMLTGDKVE
Sbjct: 730  SMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVE 789

Query: 773  TARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYR 832
            TARCVSISAKLISRGQYVH++TKL+KPEGA NQLEYLKVNK ACLLIDGESLGMFL+YY+
Sbjct: 790  TARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYK 849

Query: 833  QEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGI 892
            +EFFDVV+ LPTV+ACRCTPQQKADVAL+IRE TGKRVCCIGDGGNDVSMIQCADVGVGI
Sbjct: 850  REFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGI 909

Query: 893  VGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSV 952
            VGKEGKQASLAADFSIT+FCHLTELLLWHGRNSYKRSAKLAQF+MHRGL+IAICQAV+S+
Sbjct: 910  VGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSI 969

Query: 953  CSQFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKMYPELYKDLTEGKSLSYK 1012
            CS+FEPI LYQG+LMVGYATCYTMAPVFS+TLDHDI+ESLTK+YPELYKDLTEGKSLSYK
Sbjct: 970  CSKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTKIYPELYKDLTEGKSLSYK 1029

Query: 1013 TFFVWVALSFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALIFNELIMVALEIYTWNKT 1072
            TFFVW ALS +QG VIQG SQ F+SL E+DFTKMVAIGFTALI NELIMVALEIYTWNK 
Sbjct: 1030 TFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIGFTALILNELIMVALEIYTWNKI 1089

Query: 1073 MIITEIVTLAIYVFSVPFLGEYFDLKYISTLKFITELILILVVSIFPVWLTKAIY 1127
            M+ TEI+T   YV SVPFLGEYFDLKY+ TL+F  EL+ IL+VS+FPVW  KAI+
Sbjct: 1090 MVFTEILTFLCYVISVPFLGEYFDLKYMMTLRFYGELLFILLVSVFPVWAAKAIH 1144

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score = 1759 bits (4555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 862/1136 (75%), Positives = 978/1136 (86%), Gaps = 37/1136 (3%)

Query: 9    NSRNSVSLDSFE----NSFDEALDNIEINPVRGYHIDNSLNNSNRITDFDIDENFEMRSV 64
            N++++ S+DSF+    +SFD ALD+++IN     +    L+  N + D    E+FEMR+V
Sbjct: 19   NNQHANSVDSFDLHLDDSFDAALDSLQIN-----NNPEPLSKHNTVGD---RESFEMRTV 70

Query: 65   LEDEEHFDN------------DGHPLMRDRTRSNASTLNSRYNKYNNVSGSRSVTGYTPS 112
             +D ++F N            D HPLM D   S          K+ N++ S   +     
Sbjct: 71   -DDLDNFSNHSSDSHRKSSNTDTHPLMYDNRLSQDDNF-----KFTNIASSPPSSSNNI- 123

Query: 113  TIGVGLKKWFVNVKTAISSGWKDYSTSVALGDEHTEREVHPGTTQVYDRHRFPSNEVSNA 172
                   K    +K + +  W  + + + L D+H ERE+HP TT VYDR+R+ SNE+SNA
Sbjct: 124  -----FSKALSYLKVSNTKNWSKFGSPIELSDQHIEREIHPDTTPVYDRNRYVSNELSNA 178

Query: 173  KYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTVTMAKEA 232
            KYNAVTF+PTLLYEQFKFF+NLYFL+VALSQA+PALRIGYLSSY+VPLAFVLTVTMAKEA
Sbjct: 179  KYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFVLTVTMAKEA 238

Query: 233  SDDIQRRRRDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSG 292
             DDIQRRRRDRESN ELY V+ R R + SKDLKVGDLIK+ KG R+PADL+LLQSSEPSG
Sbjct: 239  IDDIQRRRRDRESNNELYHVITRNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSG 298

Query: 293  EAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTN 352
            E+FIKTDQLDGETDWKLR+AC LTQNL+E+DL+ +I+ITASAPEKSIH FLG+VTYKD+ 
Sbjct: 299  ESFIKTDQLDGETDWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDST 358

Query: 353  TSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKIL 412
            ++ L++DNTLWANTVLASSGFCI CV+YTGRDTRQAMNTT+AKVKTGLLELEIN ISKIL
Sbjct: 359  SNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKIL 418

Query: 413  CACVFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDK 472
            CACVF LSILLV FAG HNDDWY+DI+RYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDK
Sbjct: 419  CACVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDK 478

Query: 473  TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQ 532
            TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK+HLG VSYT+ET DIVSDY+Q
Sbjct: 479  TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQ 538

Query: 533  GMIESKNDSVTNLG-PRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEI 591
             ++ SKNDS+ N     STTRKD +  V D+I TLAICHNVTPTFEDDELTYQAASPDEI
Sbjct: 539  SLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEI 598

Query: 592  AIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQ 651
            AIVKFTESVGLSLFKRDRHS+SLLHEHSG  LNY++L +FPFNSD+KRMGIIV D+Q D+
Sbjct: 599  AIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDE 658

Query: 652  YWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVS 711
            YWF+QKGADTVM++IV +NDWLEEETGNMAREGLRTLVIGRKKL KKIYEQF+KEY + S
Sbjct: 659  YWFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDAS 718

Query: 712  ASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKV 771
             SM NR+Q+M+  I+KYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKV
Sbjct: 719  LSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKV 778

Query: 772  ETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYY 831
            ETARCVSISAKLISRGQYVH +TK+++PEGAFNQLEYLK+N+NACLLIDGESLGMFLK+Y
Sbjct: 779  ETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHY 838

Query: 832  RQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVG 891
             QEFFDVVVHLPTVIACRCTPQQKADVAL+IR++TGKRVCCIGDGGNDVSMIQCADVGVG
Sbjct: 839  EQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVG 898

Query: 892  IVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFS 951
            IVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAV+S
Sbjct: 899  IVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYS 958

Query: 952  VCSQFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKMYPELYKDLTEGKSLSY 1011
            +CS FEPIALYQGWLMVGYATCYTMAPVFSLTLDHDI+ESLTK+YPELYK+LTEGKSLSY
Sbjct: 959  ICSLFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTKIYPELYKELTEGKSLSY 1018

Query: 1012 KTFFVWVALSFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALIFNELIMVALEIYTWNK 1071
            KTFFVWV LS +QG VIQ FSQ FTSL + DFT+MVAI FTAL+ NELIMVALEIYTWNK
Sbjct: 1019 KTFFVWVLLSLFQGSVIQLFSQAFTSLLDTDFTRMVAISFTALVVNELIMVALEIYTWNK 1078

Query: 1072 TMIITEIVTLAIYVFSVPFLGEYFDLKYISTLKFITELILILVVSIFPVWLTKAIY 1127
            TM++TEI TL  Y+ SVPFLG+YFDL Y++T+ +   L++IL++SIFPVW  KAIY
Sbjct: 1079 TMLVTEIATLLFYIVSVPFLGDYFDLGYMTTVNYYAGLLVILLISIFPVWTAKAIY 1134

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 1707 bits (4420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 827/1147 (72%), Positives = 949/1147 (82%), Gaps = 52/1147 (4%)

Query: 1    MSASPHNLNSRNSV-SLD-SFENSFDEALDNIEINPVRGYHIDNSLNNSNRITDFDIDEN 58
            ++ +P + N R+S+ S D  FE+S D AL++++IN        NSLN S         EN
Sbjct: 12   LNQAPSSNNGRSSIDSFDLQFEDSLDAALESLQIN--------NSLNTSG--------EN 55

Query: 59   FEMRSVLEDEEHFDNDGHPLMRDRTRSNASTLNSRYNKYNNVSGSRSVTGYTPSTIGVGL 118
            FEMR++ +D +   +  H        S  S+LN    K  ++S  R     T   IG   
Sbjct: 56   FEMRTIDQDGDDTQSFKH--------SRVSSLNDS-AKNTHLSSGRD----TQPLIGTTQ 102

Query: 119  KKWFVNVKTAISSGWKDY------------------STSVALGDEHTEREVHPGTTQVYD 160
            + W  N + +  S W  +                  ++S+ L D+H ERE+HP TT +YD
Sbjct: 103  EPWSNNQQGSNQSPWSKFIRLIKTPTTTDLSKYRSTNSSIELTDQHVEREIHPDTTPIYD 162

Query: 161  RHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPL 220
            ++++PSN +SNAKYN +TF+P +LYEQFKFFFNLYFLLVALSQAIPALRIGYLSSY+VPL
Sbjct: 163  KNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPL 222

Query: 221  AFVLTVTMAKEASDDIQRRRRDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPA 280
            AFVL VTM+KEA DDIQRR+RD+ESN ELYEVL + + V SKDLKVGDLIKI KG R+PA
Sbjct: 223  AFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTRIPA 282

Query: 281  DLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIH 340
            DL+LLQSSEPSGE+FIKTDQLDGETDWKLR+AC+LTQNL+ DDLL KI+ITAS+PEKSIH
Sbjct: 283  DLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIH 342

Query: 341  SFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGL 400
             FLG++TYKD++++ L++DNT+WANTVLAS G CIGCV+YTG DTRQAMNTT + VKTGL
Sbjct: 343  RFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGL 402

Query: 401  LELEINDISKILCACVFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLA 460
            LELEIN +SKILCACVF+LSI+LV FAG  N DWYVDIMRYLILFSTIIPVSLRVNLDL 
Sbjct: 403  LELEINSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLG 462

Query: 461  KSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYT 520
            KSVYA QIEHD TIP+TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK+HLG VSYT
Sbjct: 463  KSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYT 522

Query: 521  TETADIVSDYIQGMIESKNDSVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDE 580
             +T DIV+DY+Q ++ S   S T   P+ST +KD    V DL+ TLAICHNVTPTFED E
Sbjct: 523  MDTMDIVTDYVQELVSS---STTTPMPQSTAKKDLPNRVRDLVVTLAICHNVTPTFEDGE 579

Query: 581  LTYQAASPDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRM 640
            LTYQAASPDEIAIVKFTESVGLSLFKRDRHS+SL H+HS T   YD+L +FPFNSDTKRM
Sbjct: 580  LTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRM 639

Query: 641  GIIVYDKQKDQYWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIY 700
            GIIVYDK K ++WF+QKGADTVM RIV +NDWL+EE GNMAREGLRTLVIGRKKL+ K Y
Sbjct: 640  GIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSY 699

Query: 701  EQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAG 760
            EQF+KEY + S SM NR++ M++ I K+LEH+LELLGLTGVEDKLQ DVKSSIELLRNAG
Sbjct: 700  EQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAG 759

Query: 761  IKIWMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLID 820
            +KIWMLTGDKVETARCVSISAKLISRGQYVH VTKLS+PEGA N LEYLK+NK++CLLID
Sbjct: 760  VKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLID 819

Query: 821  GESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDV 880
            GESLGMFL YY+QEFFD+VV LP VIACRCTPQQKADVAL+IRE+TGKRVCCIGDGGNDV
Sbjct: 820  GESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDV 879

Query: 881  SMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRG 940
            SMIQCADVGVGIVGKEGKQASLAADFS+TQFCHLT+LLLWHGRNSYKRSAKLAQFV+HRG
Sbjct: 880  SMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRG 939

Query: 941  LIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKMYPELY 1000
            LII++CQAV+SVCS+FEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTK+YPELY
Sbjct: 940  LIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKIYPELY 999

Query: 1001 KDLTEGKSLSYKTFFVWVALSFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALIFNELI 1060
            K+LT G SLSYKTFFVWV LS +QG  IQG SQ FTSL E+DF K+VA+ FTAL+ NELI
Sbjct: 1000 KELTAGTSLSYKTFFVWVILSLFQGCAIQGISQYFTSLDEVDFKKLVALSFTALVINELI 1059

Query: 1061 MVALEIYTWNKTMIITEIVTLAIYVFSVPFLGEYFDLKYISTLKFITELILILVVSIFPV 1120
            MVALEIYTWNKTM+ITEIVT  IYV SVPFL EYFDL ++S L F  +LI IL VS+FPV
Sbjct: 1060 MVALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQLPFYAKLIFILAVSVFPV 1119

Query: 1121 WLTKAIY 1127
            W  KAI+
Sbjct: 1120 WAAKAIH 1126

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score = 1630 bits (4221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 793/1140 (69%), Positives = 940/1140 (82%), Gaps = 41/1140 (3%)

Query: 3    ASPHNLNSRNSVSLD-SFENSFDEALDNIEINPVRGYHIDNSLNNSNRITDFDIDENFEM 61
            ++ H   S +  S D  FE+S D AL+++++ P   +  +NS           + E+FEM
Sbjct: 18   SNQHQAQSTDRDSFDLQFEDSLDAALESLQL-PEHSHRRENS----------TVFEDFEM 66

Query: 62   RSVLEDEE----HFDNDGHPLMRDRTRSNASTLNSRYNKYNNVSGSRSVTGYTPSTIGVG 117
            +S+  D +    H D D  PL+ + + +     NS  N  N    + ++T ++ +     
Sbjct: 67   KSMHGDHQTGMLHSDADTAPLITNHSNNGRMLSNSDRNAQN----TNNITVWSKA----- 117

Query: 118  LKKWFVNVKTAISSGWKD---YSTS-------VALGDEHTEREVHPGTTQVYDRHRFPSN 167
             K WF +  T   S       YS++       + L D + ERE+HP TT +YDR ++PSN
Sbjct: 118  -KSWFEHSFTKAKSKPSSLSVYSSTNSVDGNKIELNDHNVEREIHPATTPIYDRKKYPSN 176

Query: 168  EVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTVT 227
             +SNAKYN  TF+P +LYEQFKFFFNLYFL+VALSQAIP LRIGYLSSY+VPLAFVLTVT
Sbjct: 177  VISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFVLTVT 236

Query: 228  MAKEASDDIQRRRRDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQS 287
            M+KEA DDI RR+RDRE+N ELYEV+ +P P+ SKDLKVGD+IK+ KGARVPAD+++LQ+
Sbjct: 237  MSKEAMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVGDIIKLKKGARVPADVVVLQT 296

Query: 288  SEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVT 347
            +EP+GE+FIKTDQLDGETDWKLR+AC+LTQ+L E+DLL  ITITASAPE SIH+FLG++T
Sbjct: 297  NEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKIT 356

Query: 348  YKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEIND 407
            YKD+ +S L++DNT+W NTVLASS  CI C++YTGR+TRQA+NTT +K KTGLLELEIN 
Sbjct: 357  YKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLELEING 416

Query: 408  ISKILCACVFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQ 467
            +SKILCACVF+LSI+LV FAG +N+DWYVDIMRYLILFSTIIPVSLRVNLDL KSVYA++
Sbjct: 417  LSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYK 476

Query: 468  IEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIV 527
            IEHDK I +TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK+HLG VSYT ET DIV
Sbjct: 477  IEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMDIV 536

Query: 528  SDYIQGMIESKNDSVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAAS 587
            +D+IQ M    N   +N  P +TTRK+ +  VIDL+TTLAICHNVTPTFED ELTYQAAS
Sbjct: 537  TDFIQSM----NSRTSNSTP-TTTRKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAAS 591

Query: 588  PDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDK 647
            PDEIAIVKFTESVGLSLF+RDRHS+SL H+HSG  L YD+  +FPFNSD+KRMG+I++DK
Sbjct: 592  PDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDK 651

Query: 648  QKDQYWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEY 707
             K +YWFLQKGADTVM+ IV  NDWLEEET NMA EGLRTLVIGRKKL+  ++EQF+KEY
Sbjct: 652  LKQEYWFLQKGADTVMSSIVVRNDWLEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEY 711

Query: 708  EEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 767
             E S +M +RE  M N + K+LE+DLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT
Sbjct: 712  SEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 771

Query: 768  GDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMF 827
            GDKVETARCVSISAKLISRGQYVH VTK++KPEGA + LEYL+VN+N+CLLIDGESLG++
Sbjct: 772  GDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLY 831

Query: 828  LKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCAD 887
            L+Y+  EFFD+VV+LPTV+ACRCTPQQKADVA+ IR+ TGKRVCCIGDGGNDVSMIQCAD
Sbjct: 832  LQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCAD 891

Query: 888  VGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQ 947
            VGVGIVGKEGKQASLAADFSITQFCHLT+LLLWHGRNSYK SAKL+QFV+HRGLII++CQ
Sbjct: 892  VGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQ 951

Query: 948  AVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKMYPELYKDLTEGK 1007
            AV+S+CS FEP+ALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLT +YPELYK+LT GK
Sbjct: 952  AVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTTLYPELYKELTLGK 1011

Query: 1008 SLSYKTFFVWVALSFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALIFNELIMVALEIY 1067
            SLS+KTFFVWVALS +QG VIQ  SQ FTSL + DFTKMVAI FTAL+ NELIMV LEI 
Sbjct: 1012 SLSFKTFFVWVALSVFQGCVIQMASQFFTSLNDSDFTKMVAISFTALVLNELIMVGLEIN 1071

Query: 1068 TWNKTMIITEIVTLAIYVFSVPFLGEYFDLKYISTLKFITELILILVVSIFPVWLTKAIY 1127
            TWNK M ITE+VTL IY+ S+PFLGEYFDL Y+ST KF   +++ILV+S+ PVW  K+IY
Sbjct: 1072 TWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVSTTKFPLRVLVILVISVVPVWAAKSIY 1131

>Kwal_23.5789
          Length = 1133

 Score = 1590 bits (4118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 785/1133 (69%), Positives = 924/1133 (81%), Gaps = 42/1133 (3%)

Query: 5    PHNLNSRNSVSL--DSFENSFDEALDNIEIN----PVRGYHIDNSLNNSNRITDFDIDEN 58
            PHN N  NS  L     E+S D AL++++I+    P R                    E+
Sbjct: 15   PHN-NRHNSFDLLDPQLEDSLDAALESLQIHTGGSPAR--------------------ED 53

Query: 59   FEMRSVLEDEEHFD---NDGHPLMRDRTRSNASTLNSRYNKYNNVSGSRSVTGYTPSTIG 115
            FEM S+  +E   +   +D  PL+     +N +T  + ++        RS    +P    
Sbjct: 54   FEMTSLRSNESQKNARQSDTEPLI-----NNGATAPNSWSHDPRHDSDRSTASGSP--FW 106

Query: 116  VGLKKWFVNVKTAISSGWKDYSTSVALGDEHT-EREVHPGTTQVYDRHRFPSNEVSNAKY 174
              + K+  +  +   S +K  S S+ L D+   +RE+HP TT VYDR+++  N +SNAKY
Sbjct: 107  SRITKFMRSSHSPKVSTYKATSNSIQLKDDQQLDREIHPSTTPVYDRYKYAPNAISNAKY 166

Query: 175  NAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTVTMAKEASD 234
            N VTF+P +LYEQFKFFFNLYFLLVALSQAIPALRIGYLSSY+VPLAFVLTVTM+KEA D
Sbjct: 167  NPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLTVTMSKEALD 226

Query: 235  DIQRRRRDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEA 294
            DIQRRRRDRESN ELYEVL + + V SKDLKVGDLIKI KGAR PADL+LLQSSEPSGE 
Sbjct: 227  DIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEI 286

Query: 295  FIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTS 354
            FIKTDQLDGETDWKLRIAC LTQ+L++DDLL +I+ITAS PEKSI++FLG++T+ +  + 
Sbjct: 287  FIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQ 346

Query: 355  GLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCA 414
             L++DNT+WANTV AS+G  I CV+YTG DTRQAMNT+ + VKTGLLELEIN +SKILCA
Sbjct: 347  PLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCA 406

Query: 415  CVFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTI 474
            CVFILS+ LV FAG +N+DWYVDIMRYLILFSTIIPVSLRVNLDL KSVYAHQIEHD TI
Sbjct: 407  CVFILSVALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTI 466

Query: 475  PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGM 534
            PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM+LKK+HLG VSYT +T DIV+DY++ M
Sbjct: 467  PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAM 526

Query: 535  IESKNDSVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIV 594
             ++ N S       S ++KD    V DL+ TLA+CH VTPTFED ELTYQAASPDEIAIV
Sbjct: 527  SDNLNSSAVP----SASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIV 582

Query: 595  KFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWF 654
            KFTESVGL+LF+RDRHS++LLH+ SGT   YD+L +FPFNSD KRMGI+++DKQKD+YWF
Sbjct: 583  KFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWF 642

Query: 655  LQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASM 714
            LQKGAD VM++IV  NDWLEEETGN+AREGLRTLVIGRK+L+KK+ + F K+YE+ S  M
Sbjct: 643  LQKGADVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMM 702

Query: 715  YNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETA 774
             NRE  M+N ISK+LEHDLE+LGLTGVEDKLQ+DVKSSIELLRNAGIKIWMLTGDKVETA
Sbjct: 703  LNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETA 762

Query: 775  RCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQE 834
            RCVSISAKL+SRGQYVH VTK++KPEGA   LE LK+N N+CLLIDGESLG++L+YYRQ+
Sbjct: 763  RCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQ 822

Query: 835  FFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVG 894
            FF++VV+LP VIACRCTPQQKADVA  IRE+TGKRVCCIGDGGNDVSMIQ ADVGVGIVG
Sbjct: 823  FFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVG 882

Query: 895  KEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCS 954
            KEGKQASLAADFSITQFCHL++LLLWHGRNSYKRSAKLAQFV+HRGL+I++CQAV+S+ S
Sbjct: 883  KEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISS 942

Query: 955  QFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKMYPELYKDLTEGKSLSYKTF 1014
            +FEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTK YPELYK+LT GKSLSYKTF
Sbjct: 943  KFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTAGKSLSYKTF 1002

Query: 1015 FVWVALSFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALIFNELIMVALEIYTWNKTMI 1074
            FVWV LS +QG VIQG SQ FTSL E+DF ++VA+ FT LI NELIMVA+EIYTWNKTM+
Sbjct: 1003 FVWVVLSLFQGCVIQGLSQGFTSLDELDFKRLVALSFTVLILNELIMVAIEIYTWNKTMV 1062

Query: 1075 ITEIVTLAIYVFSVPFLGEYFDLKYISTLKFITELILILVVSIFPVWLTKAIY 1127
            ++E+VT  I+V SVP L EYFDL Y+S  ++  +L +IL +SI PVW  KA++
Sbjct: 1063 VSEVVTFLIFVGSVPLLEEYFDLTYMSRPEYYGKLAIILSLSIIPVWAAKALH 1115

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score = 1545 bits (4001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 765/1120 (68%), Positives = 907/1120 (80%), Gaps = 20/1120 (1%)

Query: 15   SLDSFENSFDEALDNIEINPVRGYHIDNSLNNSNRITDFDIDENFEMRSVLEDEEHFDND 74
            SLDSFE  FD++LD      +    I  S ++  R +     E+FE++S+       D+ 
Sbjct: 43   SLDSFELEFDDSLDA----ALESLQIKRSASH-ERHSGIRGAEDFELKSM----GRVDDG 93

Query: 75   GHPLMRDRTRSNASTLNSRYN-KYNNVSGSRSVTGY-TPSTIGVGLKKWFVNVKTA---I 129
            GH      T  +   L S+ +  Y  V   RS  G+  P +    LK W +    A   +
Sbjct: 94   GHSPSGVLTNQDTQPLISQDSWDYGQVKRLRS--GWLGPQSSWQRLKSWVLPGAKAGAPL 151

Query: 130  SSGWKDYST--SVALGDEHTEREVHPGTTQVYDRHRFPSNEVSNAKYNAVTFLPTLLYEQ 187
                  YS+  S+ L D+H +RE+H  TT +YD+ ++P+N +SNAKYNA+TFLP +LYEQ
Sbjct: 152  LGVTATYSSTHSIELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQ 211

Query: 188  FKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRESNM 247
            FKFFFNLYFLLV+LSQ+IPALRIGYLSSY+VPLAFVL VTM+KEA DDIQRRRRDRE+N 
Sbjct: 212  FKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNN 271

Query: 248  ELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDW 307
            ELYEVL   + V SK+L+VGDL+K+ K +R+PAD+ILLQSSEPSGE F+KTDQLDGETDW
Sbjct: 272  ELYEVLNNSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDW 331

Query: 308  KLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTV 367
            KLR+A +LTQNL +D++L K+ ITASAPEKSIH F G++TYK + ++ L++DNTLWANTV
Sbjct: 332  KLRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGS-SAPLSVDNTLWANTV 390

Query: 368  LASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFA 427
            LASSG C+ CVIYTG DTRQAMNT+ + VKTGLLELEIN +SKILC CVF LSILLVV  
Sbjct: 391  LASSGTCVACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIG 450

Query: 428  GLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPED 487
            GL +D WYVDIMRYLILFSTIIPVSLRVNLDL KSVYA QIE DK+IP+TIVRTSTIPED
Sbjct: 451  GLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPED 510

Query: 488  LGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGP 547
            LGRIEYLLSDKTGTLTQNDMQL+K+HLG VSYT ET D+V+DYIQ +    N     +  
Sbjct: 511  LGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAV 570

Query: 548  RSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKR 607
             + +RK+ +  V DL+ TLA CHNVTP FED+EL YQAASPDEIAIVKFTE VGLSLFKR
Sbjct: 571  -TGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKR 629

Query: 608  DRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGADTVMNRIV 667
            DRHS++L HE+SG  L YD+L +FPF SDTKRMGIIV D+ K++ WFLQKGADTVM++IV
Sbjct: 630  DRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIV 689

Query: 668  ANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISK 727
             +NDWLEEE  NMAREGLRTLVI RKKL+ ++YEQF KEY++ S SM NR++ M   + +
Sbjct: 690  QSNDWLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKR 749

Query: 728  YLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRG 787
            +LEH+LELLGLTGVEDKLQKDVK+SIELLRNAG+KIWMLTGDKVETARCV +SAKLISRG
Sbjct: 750  HLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRG 809

Query: 788  QYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTVIA 847
            QYVH +TKL++ +GA ++LEYLK N+N+CLLIDG+SL +++ +YR EFF++V+ LP VIA
Sbjct: 810  QYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIA 869

Query: 848  CRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 907
            CRCTPQQKADVAL+IRE+TGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAAD+S
Sbjct: 870  CRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYS 929

Query: 908  ITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLM 967
            ITQFCHLT+LLLWHGRNSYKRSAKL+QFV+HRGL+I++CQAV+S+ S  +PIALYQGWLM
Sbjct: 930  ITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLM 989

Query: 968  VGYATCYTMAPVFSLTLDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLV 1027
            VGYATCYTMAPVFSLTLDHDIDESLTK YPELYK+LTEG+SLSYKTFFVWV LS +QG V
Sbjct: 990  VGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAV 1049

Query: 1028 IQGFSQTFTSLAEIDFTKMVAIGFTALIFNELIMVALEIYTWNKTMIITEIVTLAIYVFS 1087
            IQGFSQ F  +    F KMVA+ FTAL+ NELIMVALEIYTWNKTM I+EIVT AIYV S
Sbjct: 1050 IQGFSQLFIGVGSEVFKKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLS 1109

Query: 1088 VPFLGEYFDLKYISTLKFITELILILVVSIFPVWLTKAIY 1127
            +P LGEYFDL  +  L F  +L +IL VSIFPVW  K I+
Sbjct: 1110 IPLLGEYFDLTSMLALPFFIQLTIILTVSIFPVWAAKTIH 1149

>Scas_89.1
          Length = 271

 Score =  469 bits (1206), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/257 (83%), Positives = 241/257 (93%)

Query: 700 YEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNA 759
           Y++F+KEY + S SM N ++ M++ I K+LEH+LELLGLTGVEDKLQ DVKSSIELLRNA
Sbjct: 2   YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 760 GIKIWMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLI 819
           G+KIWMLTGDKVETARCVSISAKLISRGQYVH VTKLS+PEGA N LEYLK+NK++CLLI
Sbjct: 62  GVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLI 121

Query: 820 DGESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGND 879
           DGESLGMFL YY+QEFFD+VV LP VIACRCTPQQKADVAL+IRE+TGKRVCCIGDGGND
Sbjct: 122 DGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGND 181

Query: 880 VSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHR 939
           VSMIQCADVGVGIVGKEGKQASLAADFS+TQFCHLT+LLLWHGRNSYKRSAKLAQFV+HR
Sbjct: 182 VSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHR 241

Query: 940 GLIIAICQAVFSVCSQF 956
           GLII++CQAV+SVCS+ 
Sbjct: 242 GLIISVCQAVYSVCSKL 258

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  452 bits (1162), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 318/992 (32%), Positives = 512/992 (51%), Gaps = 61/992 (6%)

Query: 161  RHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPL 220
            R  +  N +S  KYNA TFLP  L+++F  + NL+FL  ++ Q +P +      + +  L
Sbjct: 199  RFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTL 258

Query: 221  AFVLTVTMAKEASDDIQRRRRDRESNMELYEVLG-RPRPVASK---DLKVGDLIKISKGA 276
              VL V+  KE+ +D++R   D+E N  L +VL  R      K   D+ VGD+I++    
Sbjct: 259  LVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEE 318

Query: 277  RVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKI--TITASA 334
             +PADLI+L SSEP G  +I+T  LDGET+ K++ A   T N  ++  L K+   + +  
Sbjct: 319  AIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEH 378

Query: 335  PEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSA 394
            P  S++++ G +T  + +T  L+ D  L     L ++ +  G +++TG +T+   N T+ 
Sbjct: 379  PNSSLYTYEGTMTL-NGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATAT 437

Query: 395  KVKTGLLELEINDISKILCACVFILSIL------------------LVVFAGLHNDDWYV 436
             +K   +E  IN     L   + +L+++                  L +        ++ 
Sbjct: 438  PIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFK 497

Query: 437  DIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGR 490
            DI+ + ILFS ++P+SL V +++ K   A+ I       H+++   T+VRTS++ E+LG+
Sbjct: 498  DILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQ 557

Query: 491  IEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGPRST 550
            IEY+ SDKTGTLT+N M+ K V +    Y     +     ++  IE    S  +L  + T
Sbjct: 558  IEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKMT 617

Query: 551  -TRKDAATHVIDLITTLAICHNVTP-TFEDDELTYQAASPDEIAIVKFTESVGLSLFKRD 608
                D A  VI+ +T LA CH V P T  D  + YQAASPDE A+V+    +G     R 
Sbjct: 618  DPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADLGFRFDIRR 677

Query: 609  RHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGADTV-MNRIV 667
             +S+S+    S   L Y +L +  FNS  KRM  I +           KGADTV + R+ 
Sbjct: 678  PNSVSISTPFSEQ-LEYQLLNICEFNSTRKRMSAI-FRMPDGSIKLFCKGADTVILERLD 735

Query: 668  AN-NDWLEEETGNM---AREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMAN 723
            +  N +++    ++   A EGLRTL I  + + +K YE++ K YE  S +M +R +E+ +
Sbjct: 736  SEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEEL-D 794

Query: 724  TISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKL 783
              ++ +EHDL  LG T +EDKLQ+ V  +I  L+ AG+K+W+LTGD+ ETA  + +S +L
Sbjct: 795  RAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRL 854

Query: 784  ISRGQYVHVVTKLSKP------EGAFNQLEYLKVNK----NACLLIDGESLGMFLKYYRQ 833
            +S    + +V + +K       +   N +E  ++++    +  L+IDG+SLG  L+   +
Sbjct: 855  LSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLE 914

Query: 834  EFFDVVVHL-PTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGI 892
            + F  +  L   VI CR +P QKA V  +++  T   +  IGDG NDVSMIQ A VGVGI
Sbjct: 915  DQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGI 974

Query: 893  VGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSV 952
             G EG QA+ +ADF+I QF  L +LL+ HG  SY+R +    +  ++ + + + Q  +  
Sbjct: 975  SGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVF 1034

Query: 953  CSQFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKMYPELYKDLTEGKSLSY 1011
             + F   ++ + W +  Y   +T+ P F + + D  +   L   YP+LYK   +G+  S 
Sbjct: 1035 ANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSV 1094

Query: 1012 KTFFVWVALSFYQGLVI-------QGFSQTFTSLAEIDFTKMVAIG-FTALIFNELIMVA 1063
              F+ WV   FY   V+         +        E     +  +G +T  I   L   A
Sbjct: 1095 TIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAA 1154

Query: 1064 LEIYTWNKTMIITEIVTLAIYVFSVPFLGEYF 1095
            L    W K  ++    +L I++   PF    F
Sbjct: 1155 LITSQWTKFTLVAIPGSLVIWLLFFPFYSAVF 1186

>Kwal_26.7070
          Length = 1315

 Score =  447 bits (1150), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 302/937 (32%), Positives = 489/937 (52%), Gaps = 60/937 (6%)

Query: 144  DEHTEREVHPGTTQVYDRHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQ 203
            D+ + R+++    +      F SN +S  KYN  TF+P  L+++F  + NL+FL  +  Q
Sbjct: 177  DKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQ 236

Query: 204  AIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRESNMELYEVLGRPRP--VAS 261
             +P +      + +  L  VL V+  KE  +D++R + D E N    +V          S
Sbjct: 237  QVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLS 296

Query: 262  K--DLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQN- 318
            K  ++ VGD+IK++    +PAD+I++ SSEP G  +I+T  LDGET+ K++ A   T   
Sbjct: 297  KWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKF 356

Query: 319  LNEDDLLE-KITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGC 377
            +++DDL   +  + +  P  S++++ G +     N S L+ +  +     L ++ +  G 
Sbjct: 357  IDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNIS-LSPEQMVLRGATLRNTAWIYGL 415

Query: 378  VIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHN------ 431
            V++TG +T+   N T+  +K   +E  IN    +    +F + I+L + + + N      
Sbjct: 416  VVFTGHETKLMRNATATPIKRTAVERVIN----MQIVALFGVLIVLALISSIGNVIKVTS 471

Query: 432  ----------------DDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIP 475
                              ++ DI+ Y ILFS ++P+SL V +++ K   A+ I  D  + 
Sbjct: 472  DAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLY 531

Query: 476  E------TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSD 529
            +      T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y     +  + 
Sbjct: 532  DEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAA 591

Query: 530  YIQGMIESKNDSVTNLGPRSTTRKDAATHVI-DLITTLAICHNVTPTF-EDDELTYQAAS 587
              +  IE       ++       +D  +H+I D +T LA CH V P F ED  + YQAAS
Sbjct: 592  TTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAAS 651

Query: 588  PDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDK 647
            PDE A+V+   S+G     R  +S+S+L E  G    Y +L +  FNS  KRM  I    
Sbjct: 652  PDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLP 711

Query: 648  QKDQYWFLQKGADTV-MNRIVAN-NDWLEEETGNM---AREGLRTLVIGRKKLTKKIYEQ 702
              +   F  KGADTV + R+ A  N ++E    ++   A EGLRTL +  + +T+  Y +
Sbjct: 712  NGEIKLFC-KGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAE 770

Query: 703  FKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIK 762
            +K  Y+  S ++ +R Q++ +  ++ +E DL LLG T +EDKLQ  V  +I  L++AGIK
Sbjct: 771  WKDIYDAASTTLDDRAQKLDDA-AELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIK 829

Query: 763  IWMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKV----------N 812
            +W+LTGD+ ETA  + +S +L+S    + ++ +  K     N  E LK            
Sbjct: 830  VWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDM 889

Query: 813  KNACLLIDGESLGMFLKYYRQEFFDVVVHL-PTVIACRCTPQQKADVALIIRELTGKRVC 871
             +  L+IDG+SLG  L+   +++   +  L   VI CR +P QKA V  +++  T   + 
Sbjct: 890  NSLALVIDGKSLGFALEADLEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLL 949

Query: 872  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAK 931
             IGDG NDVSMIQ A VGVGI G EG QA+ +ADF+I QF +L +LLL HG  SY+R ++
Sbjct: 950  AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQ 1009

Query: 932  LAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDE 990
               +  ++ + + + Q  +   + +   ++ + W M  Y   +T+ P F +   D  +  
Sbjct: 1010 AILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSS 1069

Query: 991  SLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLV 1027
             L   YP+LYK    G+  S + F+ WV   FY   V
Sbjct: 1070 RLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAV 1106

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  443 bits (1140), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 319/1023 (31%), Positives = 510/1023 (49%), Gaps = 70/1023 (6%)

Query: 144  DEHTEREVHPGTTQVYDRHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQ 203
            D    RE+H    +  +R  +  N +S  KYNA TFLP  L+++F  + NL+FL  +  Q
Sbjct: 161  DSGEPREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQ 220

Query: 204  AIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRE---SNMELY-EVLGRPRPV 259
             +P +      + +  L  VL V+  KE+ +D++R   D E   S  E+Y E  G     
Sbjct: 221  QVPHVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQK 280

Query: 260  ASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNL 319
               D+KVGD+I+++    +PAD+I+L SSEP G  +I+T  LDGET+ K++ A T T  +
Sbjct: 281  RWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKI 340

Query: 320  NEDDLLEKI--TITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGC 377
             +   L  I   I++  P  S++++ G +    T    L+ +  +     L ++G+  G 
Sbjct: 341  MDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIP-LSPEQMILRGATLRNTGWIFGI 399

Query: 378  VIYTGRDTRQAMNTTSAKVKTGLLELEIN----DISKILCACVFILSILLVVF------- 426
            VI+TG +T+   N T+  +K   +E  IN     +  +L   + I SI  V+        
Sbjct: 400  VIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKH 459

Query: 427  -----------AGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD---- 471
                       AGL    ++ D + + ILFS ++P+SL V ++L K   A  I  D    
Sbjct: 460  LSYLYLQGTNKAGL----FFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLY 515

Query: 472  --KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSD 529
              +T   T+V+TS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y     +  + 
Sbjct: 516  YEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAA 575

Query: 530  YIQGMIESKNDSVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFE-DDELTYQAASP 588
              +  IE    S  +L  + TT  D    + + +T LA CH V P F+ D  + YQAASP
Sbjct: 576  TFEDGIEVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASP 635

Query: 589  DEIAIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQ 648
            DE A+V+    +G     R  +S+++L         Y +L +  FNS  KRM  I +   
Sbjct: 636  DEGALVEGGALLGYKFLIRKPNSVTILINEEEE-REYQLLNICEFNSTRKRMSAI-FRFP 693

Query: 649  KDQYWFLQKGADTV-MNRIVANNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQF 703
             D    L KGAD+V + R+    ++  + T     + A EGLRTL +  K + +  Y  +
Sbjct: 694  DDSIKLLCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAW 753

Query: 704  KKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKI 763
             K+Y + + ++ +R +++ + +++ +E  L L+G T +EDKLQ+ V  +I  L+ AGIKI
Sbjct: 754  NKKYMDAATTLDHRAEKL-DAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKI 812

Query: 764  WMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKV----------NK 813
            W+LTGDK ETA  + +S +L+S    + ++++ +K     N  E L              
Sbjct: 813  WVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMN 872

Query: 814  NACLLIDGESLGMFLKYYRQEFFDVVVHL-PTVIACRCTPQQKADVALIIRELTGKRVCC 872
               L+IDG SL   L+   +++F  +  +   VI CR +P QKA V  +++  T   +  
Sbjct: 873  TLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLA 932

Query: 873  IGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKL 932
            IGDG NDVSMIQ A VGVGI G EG QA+ +AD S+ QF  L +LLL HG  SY+R +  
Sbjct: 933  IGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVA 992

Query: 933  AQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDES 991
              +  ++   + + Q  +   + F   ++ + W M  Y   +T+ P F +   D  ++  
Sbjct: 993  ILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSR 1052

Query: 992  LTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLVI---------QGFSQTFTSLAEID 1042
            L + YP+LYK   +G+  S   F+ W+   FY   V+          GF+          
Sbjct: 1053 LLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADH 1112

Query: 1043 FTKMVAIGFTALIFNELIMVALEIYTWNKTMIITEIVTLAIYVFSVPFLGEYFDLKYIST 1102
            ++  +AI +T+ +   L   AL    W K  +     +L  ++   P  G  F    IS 
Sbjct: 1113 WSWGIAI-YTSSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKISR 1171

Query: 1103 LKF 1105
              F
Sbjct: 1172 EYF 1174

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  430 bits (1105), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 294/935 (31%), Positives = 477/935 (51%), Gaps = 64/935 (6%)

Query: 149  REVHPGTTQVYDRHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPAL 208
            R +H   +       +  N +S  KYN  TFLP  L+++F  + NL+FL  +  Q +P +
Sbjct: 183  RVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 242

Query: 209  RIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRESNMELYEVLGRPRP--VASK--DL 264
                  + +  L  VL V+  KE  +DI+R   D+E N    E+        V  +  D+
Sbjct: 243  SPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDI 302

Query: 265  KVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDL 324
            +VGD+I++     +PAD I+L SSEP G  +I+T  LDGET+ K++ +   T    +   
Sbjct: 303  RVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKT 362

Query: 325  LEKIT--ITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTG 382
            L+ +   + +  P  S++++ G +T  D     L+ D  +     L ++ +  G VI+TG
Sbjct: 363  LKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIP-LSPDQMILRGATLRNTAWIFGLVIFTG 421

Query: 383  RDTRQAMNTTSAKVKTGLLELEIND----ISKILCACVFILSILLVVF------------ 426
             +T+   N T+  +K   +E  IN     +  +L   + I SI  V+             
Sbjct: 422  HETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADAKHLSYLY 481

Query: 427  ------AGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD------KTI 474
                  AGL    ++ D + + ILFS ++P+SL V ++L K   A  I  D      KT 
Sbjct: 482  LEGTNKAGL----FFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTD 537

Query: 475  PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGM 534
              T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y  +  +  +  ++  
Sbjct: 538  TPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDG 597

Query: 535  IESKNDSVTNLGPRSTTRKDAATHVI-DLITTLAICHNVTPTFEDD-ELTYQAASPDEIA 592
            IE       +L  +     D  + +I D +T LA CH V P F+ D  + YQAASPDE A
Sbjct: 598  IEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGA 657

Query: 593  IVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQY 652
            +V+    +G     R  +S+++L E +G    Y +L +  FNS  KRM  I         
Sbjct: 658  LVQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIK 717

Query: 653  WFLQKGADTVMNRIVAN--NDWLEEETGNM---AREGLRTLVIGRKKLTKKIYEQFKKEY 707
             F  KGADTV+   + +  N ++E    ++   A EGLRTL +  + +++  YE++   Y
Sbjct: 718  LFC-KGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIY 776

Query: 708  EEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 767
             E + ++ NR +++ +  +  +E +L L+G T +EDKLQ  V  +I  L+ AGIKIW+LT
Sbjct: 777  NEAATTLDNRAEKL-DEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLT 835

Query: 768  GDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVN------------KNA 815
            GD+ ETA  + +S +L+S    + ++ + ++ +   N LE  K+N            K+ 
Sbjct: 836  GDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLE--KINALNEHQLSTHDMKSL 893

Query: 816  CLLIDGESLGMFLKYYRQEFFDVVVHL-PTVIACRCTPQQKADVALIIRELTGKRVCCIG 874
             L+IDG+SLG  L+   +++   V  L   VI CR +P QKA V  +++  +   +  I 
Sbjct: 894  ALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIA 953

Query: 875  DGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQ 934
             G NDVSMIQ A VGVGI G EG QA+ +AD ++ QF  L +LLL HG  SY+R +    
Sbjct: 954  SGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAIL 1013

Query: 935  FVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLT 993
            +  ++   + + Q  +   + F   ++ + W M  Y   +T+ P F +   D  +   L 
Sbjct: 1014 YSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLL 1073

Query: 994  KMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLVI 1028
            + YP+LYK   +G+  S   F+ W+   F+   ++
Sbjct: 1074 ERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIV 1108

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  418 bits (1074), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 284/863 (32%), Positives = 459/863 (53%), Gaps = 51/863 (5%)

Query: 164  FPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFV 223
            +  N +S  KYNA TFLP  L+++F  + NL+FL  ++ Q +P +      + +  L  V
Sbjct: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFTTIGTLIVV 253

Query: 224  LTVTMAKEASDDIQRRRRDRESNMELYEV----LGRPRPVASKDLKVGDLIKISKGARVP 279
            L V+  KE+ +D++R   D+E N    +V    +G+       D+ VGD+I++     +P
Sbjct: 254  LVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313

Query: 280  ADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKI--TITASAPEK 337
            ADLI+L SSEP G  +I+T  LDGET+ K++ A   T  + +   L  +   I +  P  
Sbjct: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373

Query: 338  SIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVK 397
            S++++ G +   + N   L+ D  L     L ++ +  G VI+TG +T+   N T+  +K
Sbjct: 374  SLYTYEGTMILHN-NRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432

Query: 398  TGLLELEINDISKILCACVFILSI------LLVVFAGLHNDDW------------YVDIM 439
               +E  IN     L   +  LS+      L+V++    N  +            + +I+
Sbjct: 433  RTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNIL 492

Query: 440  RYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGRIEY 493
             + ILFS ++P+SL V +++ K   A+ I       H+++   T+VRTS++ E+LG+IEY
Sbjct: 493  TFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEY 552

Query: 494  LLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGPRSTTRK 553
            + SDKTGTLTQN M+ K   +    Y     +         IE    +  ++     T  
Sbjct: 553  IFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRTYDDMHELLHTPG 612

Query: 554  DAATHVID-LITTLAICHNVTPTF-EDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHS 611
                 +ID  +T L+ICH V P F E+  + YQAASPDE A+V+    +G     R  +S
Sbjct: 613  SGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFIIRKPNS 672

Query: 612  MSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGADTV-MNRIVANN 670
            +++L E     + Y++L +  FNS  KRM  I +    +    L KGADTV + R+ A +
Sbjct: 673  VTILREDITEEVVYELLNICEFNSTRKRMSAI-FRFPDNSIRLLCKGADTVILERLAATS 731

Query: 671  DWLEEET----GNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTIS 726
            +     T     + A EGLRTL I  + + +  YE++ K Y+  + +M+NR +E+ + ++
Sbjct: 732  NPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEEL-DKVA 790

Query: 727  KYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISR 786
            + +E  L LLG T +EDKLQ  V  +I  L+ AGIK+W+LTGD+ ETA  + +S KL+S 
Sbjct: 791  EMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSE 850

Query: 787  GQYVHVVTKLSKPEGAFNQLEYLK-VNKNA---------CLLIDGESLGMFLKYYRQEFF 836
               + +V + +K     N ++ L+ +N +           L+IDG+SLG  L+   +EF 
Sbjct: 851  DMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFL 910

Query: 837  DVVVHL-PTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGK 895
              +  +   VI CR +P QKA V  +++  T   +  IGDG NDVSMIQ A VGVGI G 
Sbjct: 911  LAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGM 970

Query: 896  EGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQ 955
            EG QA+ +ADF++ QF +L +LLL HG  SY+R ++   +  ++ + + + Q  + + + 
Sbjct: 971  EGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNA 1030

Query: 956  FEPIALYQGWLMVGYATCYTMAP 978
            F   ++ + W +  Y    T AP
Sbjct: 1031 FSGQSIMESWTLTFYNWGGTAAP 1053

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  350 bits (899), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 258/891 (28%), Positives = 438/891 (49%), Gaps = 131/891 (14%)

Query: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLR--IACTLTQNL 319
            K +KVGD+++I     +PAD+ILL +S+  G  +++T  LDGET+ K+R  + CT T   
Sbjct: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458

Query: 320  NEDDLLEKITITASAPEKSIHSFLGRVTYK-----DTNTSGLTIDNTLWANTVLASSGFC 374
            ++D    K  I +  P  +++++ G + ++     +     +TI+N L     L ++ + 
Sbjct: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518

Query: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHND-- 432
            +G V++TG DT+  +N+     K   +  E+N    I    +FIL  +  +  G++ D  
Sbjct: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK 578

Query: 433  ------------------DWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD--- 471
                              + +V     +IL+ +++P+SL +++++ K+  A  I  D   
Sbjct: 579  GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 638

Query: 472  ---KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSY--------- 519
               K       ++  I +DLG++EY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 639  YNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 698

Query: 520  --------------TTETADIVSD-----------------YIQGMIESKNDSVTNL-GP 547
                            E A+I  D                 Y + +     + V +L G 
Sbjct: 699  GLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGA 758

Query: 548  RSTTRKDAATHVIDLITTLAICHNVTPTFEDD---ELTYQAASPDEIAIVKFTESVGLSL 604
                ++    H    +  LA+CH+V      D   +L  +A SPDE A+V     VG S 
Sbjct: 759  SGEVQQRCCEH---FMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSF 815

Query: 605  FKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWFLQKGA 659
              + +    L+ E  G    +++L +  FNS  KRM  IV         + +   + KGA
Sbjct: 816  VGKTKKG--LIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGA 873

Query: 660  DTVM-----NRIVANNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKKEYEEV 710
            D+++      +  +N++ + E+T       A EGLRTL I +++L+   YE++ ++Y+  
Sbjct: 874  DSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIA 933

Query: 711  SASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDK 770
            +AS+ NRE E+   ++  +E +L LLG T +ED+LQ  V   IELL  AGIK+W+LTGDK
Sbjct: 934  AASLANREDEL-EVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDK 992

Query: 771  VETARCVSISAKLISRGQYVHVVTKL--------SKPEGAFNQL--EYLK---------- 810
            VETA  +  S  L++    + V+           S+P    + L  +YLK          
Sbjct: 993  VETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEE 1052

Query: 811  -----------VNKNACLLIDGESLGMFL--KYYRQEFFDVVVHLPTVIACRCTPQQKAD 857
                          N  ++IDG++L + L  +  R++F  +  +   V+ CR +P QKA 
Sbjct: 1053 EIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAA 1112

Query: 858  VALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTEL 917
            V  ++++        IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I QF +L  L
Sbjct: 1113 VVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARL 1172

Query: 918  LLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMA 977
            +L HGR SYKR A++     ++ +I A+    + + + F+   LY+   M+ Y   +T  
Sbjct: 1173 VLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSL 1232

Query: 978  PVFSL-TLDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLV 1027
            PV  L  LD D++++++ + P+LY+     K  + + F  ++    YQ ++
Sbjct: 1233 PVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSII 1283

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%)

Query: 163 RFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAF 222
           ++P N++   KY  +TFLP  +  QF  F N+YFL++ +  A     +       VPL  
Sbjct: 190 QYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVV 249

Query: 223 VLTVTMAKEASDDIQRRRRDRESN 246
           ++ +T  K+A +D +R   D E N
Sbjct: 250 IVIITAIKDAIEDSRRTVLDLEVN 273

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  345 bits (884), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 259/893 (29%), Positives = 442/893 (49%), Gaps = 138/893 (15%)

Query: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLR--IACTLTQNL 319
            K + VGD++++     +PAD+ILL SS+  G  +++T  LDGET+ K+R  + C+     
Sbjct: 444  KSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKCSHMIRN 503

Query: 320  NEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTS-----GLTIDNTLWANTVLASSGFC 374
            + +    K  + +  P  +++S+ G + + D  T       + I+N L     L ++ + 
Sbjct: 504  SRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWA 563

Query: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVF---AGLHN 431
            +G V++TG DT+  +N        G+   +++ IS+ L   VF+   LL V    AG+ N
Sbjct: 564  MGIVVFTGPDTKIMLNA-------GVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVN 616

Query: 432  DDWY------------------------VDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQ 467
              +Y                        V     LIL+ +++P+SL +++++ K+  A  
Sbjct: 617  GVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALF 676

Query: 468  IEHDKTI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYT 520
            I  D  +       P T  ++ TI +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY 
Sbjct: 677  IYGDVALYNERLDYPCT-PKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYG 735

Query: 521  TETADIVSDY---------------IQGMIESKNDSVTNL---GPRSTTRKDAATHVI-- 560
                + ++                  +G+ + K   + NL   G  S  R +  T V   
Sbjct: 736  RAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKE 795

Query: 561  ------------------DLITTLAICHNVTPTFEDDE---LTYQAASPDEIAIVKFTES 599
                              + +  LA+CH V      D+   + ++A SPDE A+V     
Sbjct: 796  FVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARD 855

Query: 600  VGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWF 654
            +G S   R ++   ++ +  G    Y +L +  FNS  KRM  I+        ++ +   
Sbjct: 856  MGFSFVGRTKNG--VIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALL 913

Query: 655  LQKGADTVM-NRIVANNDW-LEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKKEYE 708
            + KGAD+++ +R+  NND  L E+T       A EGLRTL I +++L+ K Y+++ +++E
Sbjct: 914  ICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHE 973

Query: 709  EVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTG 768
              +A++ +RE EM   ++  +E +L LLG T +ED+LQ  V  SI  L  AGIK+W+LTG
Sbjct: 974  IAAAALVDREDEM-EKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTG 1032

Query: 769  DKVETARCVSISAKLISRGQYVHVVTKL--------SKP------------------EGA 802
            DKVETA  +  S  L++    + V+           SKP                   G+
Sbjct: 1033 DKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGS 1092

Query: 803  FNQLEYLK-----VNKNACLLIDGESLGMFLKY--YRQEFFDVVVHLPTVIACRCTPQQK 855
            + +LE  K        N  ++IDG++L + L+    ++EF  +      V+ CR +P QK
Sbjct: 1093 YEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQK 1152

Query: 856  ADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLT 915
            A V  +++         IGDG NDV+MIQ AD+GVGI G+EG+QA +++D++I QF +LT
Sbjct: 1153 AAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLT 1212

Query: 916  ELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYT 975
             L+L HGR SYKR A++     ++ +I  +    + V + ++   L++   +  +   +T
Sbjct: 1213 RLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFT 1272

Query: 976  MAPVFSL-TLDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLV 1027
              PV  L  LD D+++ ++ + P+LY+        +   F++++  + YQ ++
Sbjct: 1273 SLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVI 1325

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query: 154 GTTQVYDRHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYL 213
           G + +Y    +P N++   KY  +TF P  +  QFK   N+YFL++ +        +   
Sbjct: 234 GNSTIY----YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANP 289

Query: 214 SSYVVPLAFVLTVTMAKEASDDIQRRRRDRESN 246
               VPL  ++ +T  K+A +D +R   D E N
Sbjct: 290 GLATVPLIVIVVLTSFKDAIEDSRRTILDMEVN 322

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  343 bits (881), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 259/889 (29%), Positives = 439/889 (49%), Gaps = 128/889 (14%)

Query: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNE 321
            K++KVGD+++I     +PAD+ILL +S+  G  +++T  LDGET+ K+R +   T ++  
Sbjct: 406  KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465

Query: 322  --DDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGL-----TIDNTLWANTVLASSGFC 374
              D    +  I +  P  +++S+ G   +     + L      I+N L     L ++ + 
Sbjct: 466  SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525

Query: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHND-- 432
            +G V +TG DT+  +N      K   +  E+N       A +F+L  +  ++ G++++  
Sbjct: 526  MGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKH 585

Query: 433  ------------------DWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD--- 471
                                +V     +IL+ +++P+SL +++++ K+  A  I  D   
Sbjct: 586  PRSRDFFDFGTGTGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMM 645

Query: 472  ---KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSY--------- 519
               K       ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 646  YNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 705

Query: 520  ---------TTETADIVSDYIQGMIESKNDSVTNLGPRSTTRKDAATHV----IDLIT-- 564
                         + I  + I+   E   + + NL   S   +D  T V    +D +T  
Sbjct: 706  GLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGG 765

Query: 565  --------------TLAICHNV--TPTFEDD-ELTYQAASPDEIAIVKFTESVGLSLFKR 607
                           LA+CH+V   P+ ED  +L  +A SPDE A+V     +G S  K+
Sbjct: 766  SGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKK 825

Query: 608  DRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWFLQKGADTV 662
             +  M L  E  G    + +L +  FNS  KRM  IV         K +   + KGAD+V
Sbjct: 826  TKEGMVL--EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSV 883

Query: 663  ----MNRIVANNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASM 714
                +++   N + L E+T       A EGLRTL + +++L+ + YE++ K+Y+  +A++
Sbjct: 884  IYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAV 943

Query: 715  YNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETA 774
             +RE+E+   +S  +E  L LLG T +ED+LQ  V  SI LL  AGIK+W+LTGDKVETA
Sbjct: 944  VDREEELEK-VSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETA 1002

Query: 775  RCVSISAKLISRGQYVHVVTKLSKPE---------------------------GAFNQLE 807
              +  S  L++    + V+ K + P+                           G+  +L+
Sbjct: 1003 INIGFSCNLLNNDMELLVI-KTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELK 1061

Query: 808  YLKVNKNA-----CLLIDGESLGMFL--KYYRQEFFDVVVHLPTVIACRCTPQQKADVAL 860
              K   +       ++IDGE+L   L  +  +++F  +  +  +V+ CR +P QKA V  
Sbjct: 1062 KAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVK 1121

Query: 861  IIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLW 920
            +++         IGDG NDV+MIQ A++GVGI G+EG+QA +++D++I QF +LT LLL 
Sbjct: 1122 LVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLV 1181

Query: 921  HGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVF 980
            HG+  YKR A++     ++ +I  +    F + + ++   L++   +  Y   +T  PV 
Sbjct: 1182 HGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVI 1241

Query: 981  SLTL-DHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVAL-SFYQGLV 1027
             L + D D+ ++++ ++P+LY+     K  S +T F+W  L   YQ ++
Sbjct: 1242 LLGIFDQDVSDTISLVFPQLYRVGILRKEWS-QTKFLWYMLDGLYQSVI 1289

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%)

Query: 164 FPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFV 223
           +P N++   KY  +TFLP  +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLIVI 255

Query: 224 LTVTMAKEASDDIQRRRRDRESN 246
           + +T  K+  +D +R   D E N
Sbjct: 256 IIITAIKDGIEDSRRTVLDLEVN 278

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  340 bits (873), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 264/867 (30%), Positives = 425/867 (49%), Gaps = 137/867 (15%)

Query: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNL-N 320
            KD++VGD+++I     +PAD+ILL +S+  G  +++T  LDGET+ K+R +   +  + N
Sbjct: 406  KDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKCSHRIRN 465

Query: 321  EDDLLE-KITITASAPEKSIHSFLGRVTYKDTNTS-----GLTIDNTLWANTVLASSGFC 374
              D+   K  + +  P  +++S+ G   + D+ T       + I+N L     L ++ + 
Sbjct: 466  SKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSLRNTKWA 525

Query: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHNDDW 434
            +G V++TG DT+  +N      K   +  E+N  S IL    F+   +L + AGL N  +
Sbjct: 526  MGIVMFTGTDTKIMLNAGVTPTKRSRISRELN-YSVILN---FVFLFVLCLAAGLVNGIY 581

Query: 435  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEH 470
            Y                        +     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 582  YRRDATSRTFFEFGTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAFIYG 641

Query: 471  D------KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSY----- 519
            D      K       RT  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 642  DVLLYNPKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 701

Query: 520  -------TTETADI----------VSDYIQGMIE-----SKNDS-------------VTN 544
                     +  DI          + +  + M+E      KN               V +
Sbjct: 702  EALAGLRKRQGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKELVQD 761

Query: 545  LG-PRSTTRKDAATHVIDLITTLAICHNVT---PTFEDDELTYQAASPDEIAIVKFTESV 600
            LG   S  +K+A  H    + +LA+CH+V         ++L  +A SPDE A+V+    +
Sbjct: 762  LGGANSQEQKEAVEH---FMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDM 818

Query: 601  GLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWFL 655
            G S   R ++ + +  E  G    + +L +  FNS  KRM  IV      +  K +   L
Sbjct: 819  GFSFVGRTKNGVII--EIQGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLL 876

Query: 656  QKGADTVM-NRI--VANNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKKEYE 708
             KGAD+V+ +R+    N+  L E T       A EGLRTL + ++++    Y  + +  E
Sbjct: 877  CKGADSVIYSRLDRSRNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRE 936

Query: 709  EVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTG 768
              +AS+ NRE+ +   ++  +E  L LLG T +ED+LQ  V  SI +L +AGIK+W+LTG
Sbjct: 937  LAAASLDNREEALER-VADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTG 995

Query: 769  DKVETARCVSISAKLI----------SRGQYV---------------------HVVTKLS 797
            DKVETA  +  S  L+          S G+ V                     H   K S
Sbjct: 996  DKVETAINIGFSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGS 1055

Query: 798  KPEGAFNQLEYLKVNKNACLLIDGESLGMFL--KYYRQEFFDVVVHLPTVIACRCTPQQK 855
              E A  + ++        ++IDG++L + L  +  R++F  +  +   V+ CR +P QK
Sbjct: 1056 PEELAAARKDHTPPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQK 1115

Query: 856  ADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLT 915
            A V  +++E        IGDG NDV+MIQ ADVG+GI G+EG+QA ++AD++I QF +LT
Sbjct: 1116 AAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLT 1175

Query: 916  ELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYT 975
             L+L HGR SYKR A++     ++ +   +    F +CS ++   L++   ++ Y   +T
Sbjct: 1176 RLVLVHGRWSYKRLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAFT 1235

Query: 976  MAPVFSL-TLDHDIDESLTKMYPELYK 1001
              PV  L  +D D  + L+ + P+LYK
Sbjct: 1236 SLPVIFLGIMDQDASDVLSVVVPQLYK 1262

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%)

Query: 164 FPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFV 223
           +P N++   KY  ++FLP  L  QFK   N+YFLL+     +    +   +   +PL  +
Sbjct: 203 YPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCLSFVSIFGVTNPALAAIPLIAI 262

Query: 224 LTVTMAKEASDDIQRRRRDRESN 246
           + +T  K+A +D +R   D E N
Sbjct: 263 VVITGLKDAFEDSRRTILDLEVN 285

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  341 bits (874), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 268/895 (29%), Positives = 441/895 (49%), Gaps = 141/895 (15%)

Query: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLR--IACTLTQNL 319
            K++KVGD++++     +PAD+ILL +S+  G  +++T  LDGET+ K+R  + C+     
Sbjct: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503

Query: 320  NEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGL-----TIDNTLWANTVLASSGFC 374
            + D    K  + +  P  +++S+ G   ++DT    +      I+N L     L ++ + 
Sbjct: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563

Query: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHNDDW 434
            +G VI+TG DT+  +N      K   +  E+N  S IL    F+L  +L   AG+ N  +
Sbjct: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELN-FSVILN---FVLLFILCFTAGIVNGVY 619

Query: 435  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEH 470
            Y                        V     +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 620  YKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYT 679

Query: 471  D------KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETA 524
            D      K       ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 680  DVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY----G 735

Query: 525  DIVSDYIQGMIESKNDSVTNLGPRSTTR--KDAATHVIDL-------------------- 562
               ++ + G+ + +   V + G R      KD  T + +L                    
Sbjct: 736  RAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKE 795

Query: 563  --------------------ITTLAICHNV--TPTFED-DELTYQAASPDEIAIVKFTES 599
                                +  LA+CH+V   P  +D  +L  +A SPDE A+V     
Sbjct: 796  IVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQ 855

Query: 600  VGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWF 654
            +G S     +    L+ E  G    + VL +  FNS  KRM  I+       K + +   
Sbjct: 856  LGYSFVGSSKSG--LIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALL 913

Query: 655  LQKGADTVM-NRI--VANNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKKEY 707
            + KGAD+V+ +R+    N+  L E+T       A EGLRTL + +++LT   YE++ K Y
Sbjct: 914  ICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTY 973

Query: 708  EEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 767
            +  +AS+ NRE+E+ + ++  +E +L LLG T +ED+LQ  V  SI LL  AGIK+W+LT
Sbjct: 974  DVAAASVTNREEEL-DKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLT 1032

Query: 768  GDKVETARCVSISAKLI----------SRGQYV------------HVVTK-LSKPEGAFN 804
            GDKVETA  +  S  ++          + G+ V            ++VTK L +  G   
Sbjct: 1033 GDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSG 1092

Query: 805  QLEYLKVNK--------NACLLIDGESLGMFL--KYYRQEFFDVVVHLPTVIACRCTPQQ 854
              E LK  K        N  ++IDG++L + L  +  R++F  +  +   V+ CR +P Q
Sbjct: 1093 SEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQ 1152

Query: 855  KADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHL 914
            KA V  ++++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF ++
Sbjct: 1153 KAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYV 1212

Query: 915  TELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCY 974
            T L+L HG+  YKR A++     ++ +I  +    + + + F+   L++   +  Y   +
Sbjct: 1213 TRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAF 1272

Query: 975  TMAPVFSLT-LDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVAL-SFYQGLV 1027
            T  PV  L  LD D+ ++++ + P+LY+     K  + +T F+W  L   YQ ++
Sbjct: 1273 TSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWN-QTKFLWYMLDGVYQSVI 1326

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%)

Query: 164 FPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFV 223
           +P N++   KY  +TF P  +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288

Query: 224 LTVTMAKEASDDIQRRRRDRESN 246
           + +T  K+  +D +R   D E N
Sbjct: 289 VIITAIKDGIEDSRRTVLDLEVN 311

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  339 bits (869), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 255/866 (29%), Positives = 423/866 (48%), Gaps = 133/866 (15%)

Query: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIA--CTLTQNL 319
            K +KVGD+++I     +PAD+ILL +S+  G  +++T  LDGET+ K+R A  C+     
Sbjct: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454

Query: 320  NEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGL-----TIDNTLWANTVLASSGFC 374
            + D    +  I +  P  +++S+ G + +KD+  + L     TI+N L     L ++ + 
Sbjct: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514

Query: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHND-- 432
            +G V++TG DT+  +N      K   +  E+N    I    +FIL  +  +  G+  D  
Sbjct: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574

Query: 433  ------------------DWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD--- 471
                              + +V     +IL+ +++P+SL +++++ K+  A  I  D   
Sbjct: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634

Query: 472  ---KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSY--------- 519
               K       ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 694

Query: 520  --------------TTETADIVSDYIQGMIESKN---------DSVTNL---------GP 547
                            E  +I  D    + + +N         D +T +         G 
Sbjct: 695  GLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGR 754

Query: 548  RSTTRKDAATHVIDLITTLAICHNV----TPTFEDDELTYQAASPDEIAIVKFTESVGLS 603
                +K    H    +  LA+CH+V    +PT   ++L  +A SPDE A+V     +G  
Sbjct: 755  NGDIQKKCCEH---FMLALALCHSVLTEPSPT-NPNKLEMKAQSPDEAALVTTARDLGFC 810

Query: 604  LFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWFLQKG 658
               + +  M +  E  G    +++L +  FNS  KRM  I+         + +   + KG
Sbjct: 811  FMGKTKTGMVV--EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKG 868

Query: 659  ADTVM-----NRIVANNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKKEYEE 709
            AD+V+      +   N++ L E+T       A EGLRTL + +++LT   Y ++   Y+ 
Sbjct: 869  ADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDI 928

Query: 710  VSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGD 769
             +AS+ NRE+++   +S  +E DL LLG T +ED+LQ  V  SI LL  AGIK+W+LTGD
Sbjct: 929  AAASLTNREEQL-EIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGD 987

Query: 770  KVETARCVSISAKLISRGQYVHVVTKLSK--------PEGAFNQL--EYLKVN------- 812
            KVETA  +  S  L++    + VV    +        P    N L  +YL+         
Sbjct: 988  KVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSE 1047

Query: 813  ---KNA-----------CLLIDGESLGMFLKY--YRQEFFDVVVHLPTVIACRCTPQQKA 856
                NA            ++IDG++L + L     +++F  +  +   V+ CR +P QKA
Sbjct: 1048 MELDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKA 1107

Query: 857  DVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTE 916
             V  +++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I QF +LT 
Sbjct: 1108 AVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTR 1167

Query: 917  LLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTM 976
            LLL HGR SYKR +++     ++ +I  +    + + + F+   L++   ++ Y   +T 
Sbjct: 1168 LLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTS 1227

Query: 977  APVFSL-TLDHDIDESLTKMYPELYK 1001
             PV  L  LD D++++++ + P+LY+
Sbjct: 1228 IPVILLGILDQDVNDTISLVVPQLYR 1253

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%)

Query: 164 FPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFV 223
           +P N++   KY  ++F P  L  QF+ F N+YFL++ +  A     +       VPL  +
Sbjct: 184 YPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVI 243

Query: 224 LTVTMAKEASDDIQRRRRDRESN 246
           + +T  K+  +D +R   D E N
Sbjct: 244 VIITAIKDGIEDSRRTILDLEVN 266

>Scas_576.8
          Length = 1591

 Score =  337 bits (863), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 254/862 (29%), Positives = 425/862 (49%), Gaps = 125/862 (14%)

Query: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLR--IACTLTQNL 319
            K++KVGD+++I     +PAD+ILL +S+  G  +++T  LDGET+ K+R  + C+ +   
Sbjct: 415  KNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKCSHSIRN 474

Query: 320  NEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGL-----TIDNTLWANTVLASSGFC 374
            + D    K  + +  P  +++S+ G V + D+    L     TI+N L     L ++ + 
Sbjct: 475  SRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTLRNTKWA 534

Query: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHND-- 432
            +G V++TG DT+  +N+ +   K   +  E+N    +    +FI+  +  +  G+  D  
Sbjct: 535  MGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIINGVDYDKH 594

Query: 433  ------------------DWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD--- 471
                              + +V     +IL+ +++P+SL +++++ K+  A  I  D   
Sbjct: 595  PRSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 654

Query: 472  ---KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVS 528
               K       ++  I +D+G+IEY+ SDKTGTLTQN M+ KK  +  +SY     + ++
Sbjct: 655  YNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGRAYTEALA 714

Query: 529  DYI--QGM------------IESKNDSV----TNLGPRSTTRKDAATH-----VIDL--- 562
                 QG+            I    D++     NL   S    D  T      V DL   
Sbjct: 715  GLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKEFVNDLKGA 774

Query: 563  ------------ITTLAICHNV--TPTFEDDE-LTYQAASPDEIAIVKFTESVGLSLFKR 607
                        +  LA+CH+V   P   D + L  +A SPDE A+V     VG S   +
Sbjct: 775  SGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARDVGFSFIGK 834

Query: 608  DRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWFLQKGADTV 662
             +    L+ E  G    + +L    FNS  KRM  IV         + +   + KGAD++
Sbjct: 835  TK--TGLIIEVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSI 892

Query: 663  M-----NRIVANNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSAS 713
            +      +  AN++ L E+T       A EGLRTL I +++L+   Y ++ K Y+  +AS
Sbjct: 893  IYSRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAAS 952

Query: 714  MYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET 773
            + NRE+++   +S  +E +L LLG T +ED+LQ  V  SI +L  AGIK+W+LTGDKVET
Sbjct: 953  VTNREEQL-EAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVET 1011

Query: 774  ARCVSISAKLISRGQYVHVV----------------------TKLSKPEGAF--NQLEYL 809
            A  +  S  L++    + VV                      TK  + +     +++E  
Sbjct: 1012 AINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEMELA 1071

Query: 810  KVNKNA-------CLLIDGESLGMFL--KYYRQEFFDVVVHLPTVIACRCTPQQKADVAL 860
               KN         ++IDGE+L + L  +  R++F  +  +   V+ CR +P QKA V  
Sbjct: 1072 DAKKNHDFPRGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVK 1131

Query: 861  IIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLW 920
            ++          IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF +LT L+L 
Sbjct: 1132 LVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLVLV 1191

Query: 921  HGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPV- 979
            HGR SY+R A++     ++ +I  +    + + + F+   L++   ++ Y   +T  PV 
Sbjct: 1192 HGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFTSLPVI 1251

Query: 980  FSLTLDHDIDESLTKMYPELYK 1001
            F   +D D+ ++++ + P+LY+
Sbjct: 1252 FMGIMDQDVSDTVSLVMPQLYR 1273

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%)

Query: 164 FPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFV 223
           +P N++   KY+ + F P  +  QF+ F N+YFL++ +  A     +       VPL  +
Sbjct: 201 YPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVLIILGAFQIFGVTNPGLAAVPLIVI 260

Query: 224 LTVTMAKEASDDIQRRRRDRESN 246
           + +T  K+A +D +R   D E N
Sbjct: 261 VIITAIKDAIEDSRRTLLDMEVN 283

>Scas_636.16
          Length = 1554

 Score =  335 bits (860), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 259/900 (28%), Positives = 436/900 (48%), Gaps = 141/900 (15%)

Query: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLR--IACTLTQNL 319
            K+++VGD+++I     +PAD+ILL +S+  G  +++T  LDGE++ K+R  + CT     
Sbjct: 378  KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437

Query: 320  NEDDLLEKITITASAPEKSIHSFLGRVTYKD-----TNTSGLTIDNTLWANTVLASSGFC 374
            + D    K  + +  P  +++ + G + + D     T+   +TI+N L     L ++ + 
Sbjct: 438  SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497

Query: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHNDDW 434
            +G V++TG DT+  +N      K   +  E+N    +L   VF+   +L + AG+ N  +
Sbjct: 498  MGIVVFTGDDTKTMINAGVTPTKKSRISRELN--FSVLINFVFLF--ILCLIAGVANGAY 553

Query: 435  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEH 470
            Y                        V     +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 554  YRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYL 613

Query: 471  DKTI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTET 523
            D  +       P T  ++ +I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY    
Sbjct: 614  DVLLYNERLDYPCT-PKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAY 672

Query: 524  ADIVSDY---------IQGMIE--------------------------------SKNDSV 542
             + ++            +G IE                                SK  S 
Sbjct: 673  TEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQ 732

Query: 543  TNLGPRSTTRKDAATHVIDLITTLAICHNV--TPTFED-DELTYQAASPDEIAIVKFTES 599
              LG     ++    H    +  LA+CH+V   P   D ++L   A SPDE A+V     
Sbjct: 733  DLLGNNGEVQQKRCQH---FMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARD 789

Query: 600  VGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWF 654
            +G S   + +    LL E  G    + +L +  FNS  KRM  IV      +K + +   
Sbjct: 790  MGFSFIGKTKQG--LLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALL 847

Query: 655  LQKGADTVMNRIVA-----NNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKK 705
            + KGAD+V+   ++     N++ L E+T       A EGLRTL +G+++++   Y+++ +
Sbjct: 848  ICKGADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNE 907

Query: 706  EYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWM 765
            +Y   +AS+  RE+E+ + ++  +E DL LLG T +ED+LQ  V  SI LL  AGIK+W+
Sbjct: 908  KYNIAAASLAGREEEL-DHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWV 966

Query: 766  LTGDKVETARCVSISAKLISRGQYVHVVTKLSK--------PEGAFNQL--EYL--KVNK 813
            LTGDKVETA  +  S  L++    + V+    +        P    N L  +YL  K N 
Sbjct: 967  LTGDKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNM 1026

Query: 814  NA-------------------CLLIDGESLGMFL--KYYRQEFFDVVVHLPTVIACRCTP 852
                                  ++IDGE+L + L     +++F  +  +   V+ CR +P
Sbjct: 1027 TGSEEELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSP 1086

Query: 853  QQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFC 912
             QKA V  ++++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF 
Sbjct: 1087 AQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFR 1146

Query: 913  HLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYAT 972
            ++T L+L HG+  YKR A++     ++ +I  +    + V + F+   L++   +  Y  
Sbjct: 1147 YVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNL 1206

Query: 973  CYTMAPVFSL-TLDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLVIQGF 1031
             +T  PV  L  LD D+  +++ + P+LY+     +  +   F  ++    YQ ++   F
Sbjct: 1207 AFTSLPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFF 1266

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 45/93 (48%)

Query: 164 FPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFV 223
           +P N++   KY  +TF P  +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGLAAVPLIVI 227

Query: 224 LTVTMAKEASDDIQRRRRDRESNMELYEVLGRP 256
           + +T  K+A +D +R   D E N     +L  P
Sbjct: 228 IILTAIKDAIEDSRRTLLDMEVNNTRTHILQGP 260

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  217 bits (553), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 146/424 (34%), Positives = 224/424 (52%), Gaps = 35/424 (8%)

Query: 655  LQKGADTVMNRI-----VANNDWLEEET----GNMAREGLRTLVIGRKKLTKKIYEQFKK 705
            +  G D ++N I     ++N +++ E+T     + + EGLRTL+   K ++ + +EQ++ 
Sbjct: 934  VSNGNDVLLNYIGSDALISNEEYVLEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRT 993

Query: 706  EYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWM 765
             Y E   S+  R+Q++ + +   +E +L LLG T +EDKLQ+ V  +IE +R AGIK+WM
Sbjct: 994  RYHEAKTSLSERKQKI-DEVGAQIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWM 1052

Query: 766  LTGDKVETARCVSISAKLISRGQYVHVVTK-----LSKPEGAFNQLEYLKVNKNACLLID 820
            LTGDK ETA  +  S KLI     V ++T      +SK      +++   V  +  ++ID
Sbjct: 1053 LTGDKRETAINIGYSCKLIHDYSTVVILTTSDENIISKMNAISQEVDSGNV-AHCVIVID 1111

Query: 821  GESLGMFL--KYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVC--CIGDG 876
            G +L MF         F ++     +V+ CR +P QKA +   IR  T K +    IGDG
Sbjct: 1112 GATLAMFEDNPTLMSVFTELCTKTDSVVCCRASPAQKALMVSNIRN-TDKSIVTLAIGDG 1170

Query: 877  GNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFV 936
             ND++MIQ AD+GVGI GKEG QAS +AD+SI QF  + +LLL HGR +Y R+AK     
Sbjct: 1171 ANDIAMIQSADIGVGIAGKEGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTAKFILCT 1230

Query: 937  MHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKM 995
             ++ L   + Q ++   + F   +LY+ W +  Y T +T  PV  + + + D+       
Sbjct: 1231 FYKELTFYLTQLIYQRYTMFSGTSLYEPWSLSMYNTLFTSLPVLCVGMFEKDLKPVTLLT 1290

Query: 996  YPELYKDLTEGKSLSYKTFFVWVALSFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALI 1055
             PELY      K+ ++  F  WV L     L+I              F  +VA G T+L 
Sbjct: 1291 VPELYSMGRLSKAFNWSIFAEWVFLGTANALIIT-------------FLNIVAWGETSLS 1337

Query: 1056 FNEL 1059
             N L
Sbjct: 1338 DNTL 1341

 Score =  177 bits (448), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 144/588 (24%), Positives = 267/588 (45%), Gaps = 108/588 (18%)

Query: 36  RGYHIDNSLNNSNRITDFDIDENFEMRSVLEDEEHFDNDGHPLMRDRTRSNASTLNSRYN 95
           R + +   + N +   ++  D+N EM  +  DEE  +++GH                   
Sbjct: 10  RSWSLRTQMFNKHLFENYHNDDNVEMNDI--DEETENDEGH-----------------IG 50

Query: 96  KYNNVSGSRSVTGYTPSTIGVGLKKWFVNVKTAISSGWKDYSTSVALGDEHTEREVHPGT 155
            +N++ G   +  +    +   +     + +T + S        ++L       +++P  
Sbjct: 51  DFNSIDGQTKIRNHQSPRLVTKILDMLFDRRTQVHSV-DGRHIPISLDHSSAISDIYP-- 107

Query: 156 TQVYDRH----------RFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAI 205
               DRH           + +N +++++Y  ++F P  LY QF    N+YF +VA+ Q I
Sbjct: 108 ---VDRHGNLVDERYGYAYCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQMI 164

Query: 206 PALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRESNMELYEVL------------ 253
           P        + +VPL   + ++MA+EA DD +R + D+E N +L +VL            
Sbjct: 165 PGWSTTGTYTTIVPLCVFMAISMAREAYDDYRRHKLDKEENNKLTKVLQILHEREDNDLD 224

Query: 254 ---------GRPRPVAS----------------------KDLKVGDLIKISKGARVPADL 282
                      P  +++                      KD++VGD + + +   VPAD+
Sbjct: 225 LENNAQHSANNPESISNLYFNNFDLLAKKYNVRIVEKKWKDIRVGDFVLLQQDDWVPADI 284

Query: 283 ILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNED-DLLEKIT--ITASAPEKSI 339
           ++L S   + E FI+T  LDGET+ K ++       L +    L  I   +T   P   +
Sbjct: 285 LILTSDGDNSEVFIETMALDGETNLKGKVPHPEINKLTKSASGLANINAQVTVEDPNNDL 344

Query: 340 HSFLGRVTYKDTNTSG----LTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNT-TSA 394
           ++F G +     ++S     L  DN ++  +++ ++  C+G VI+TG +++  MN   + 
Sbjct: 345 YNFEGNLELNSGSSSKKKYPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKIRMNALRNP 404

Query: 395 KVKTGLLELEINDISKILC---ACVFILSIL---LVVFAGLHNDD-WYV---------DI 438
           + K   L+ +IN I   +    AC+ + S L   + +   ++N+  WY+          I
Sbjct: 405 RTKAPKLQRKINMIVVFMVFVVACMSLFSYLGHTIQIKRYVNNNKAWYLLQEDAGTAPTI 464

Query: 439 MRYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGRIE 492
           M ++I+++TIIP+SL V ++L K   +  +E      H ++     VRT+TI E+LG++ 
Sbjct: 465 MSFIIMYNTIIPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVS 524

Query: 493 YLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKND 540
           Y+ SDKTGTLT N M  +K+     S+       +S++    + +KND
Sbjct: 525 YIFSDKTGTLTDNKMLFRKLSFCGTSWVHNATQDISEFKPAQLSNKND 572

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 67/130 (51%), Gaps = 16/130 (12%)

Query: 546 GPRSTTRKDAATHVIDLITTLAICHNVTPTF------EDDELTYQAASPDEIAIVKFTES 599
            P+S   K A   ++    +LAICH   P        EDD + YQ++SPDE+A+V     
Sbjct: 666 NPKSLFAKKAKMFIL----SLAICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARD 721

Query: 600 VGLSLFKRDRHSMSLLHEHSG-----TILNYDVLTMFPFNSDTKRMGIIV-YDKQKDQYW 653
           +G  ++ R+ + ++L     G        N+++L +  FNS  KRM +IV   ++KD+  
Sbjct: 722 MGYIVYNRNANILTLKTFPDGFDELPRFENFEILELVDFNSQRKRMSVIVRVPEEKDRVL 781

Query: 654 FLQKGADTVM 663
              KGAD V+
Sbjct: 782 LFCKGADNVI 791

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  216 bits (549), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 138/409 (33%), Positives = 225/409 (55%), Gaps = 20/409 (4%)

Query: 665  RIVANNDWLEEETGN----MAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQE 720
            +++ N +++ E+T N     + EGLRTL+   K +  + Y+ ++ +Y E   S+ NR  +
Sbjct: 928  KLIKNEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQ 987

Query: 721  MANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSIS 780
            +A  +  ++E DLELLG T +EDKLQ+ V  +I+ +R AGIK+WMLTGDK ETA  +  +
Sbjct: 988  IAE-VGGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYA 1046

Query: 781  AKLISRGQYVHVVTK-----LSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLK--YYRQ 833
             KLI     V ++ K     +SK      +L+  K+  +  L+IDG SL +F        
Sbjct: 1047 CKLIYDYSTVVILKKNDDNLISKMTALGEELDTGKI-AHCVLVIDGASLAVFENNPTMMS 1105

Query: 834  EFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVC--CIGDGGNDVSMIQCADVGVG 891
             F ++     +VI CR +P QKA +   IR L  K +    IGDG ND++MIQ AD+GVG
Sbjct: 1106 VFIELCTKTDSVICCRASPSQKALIVTNIR-LKNKDLVTLAIGDGANDIAMIQSADIGVG 1164

Query: 892  IVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFS 951
            I GKEG QAS ++D+SI QF +L +LL  HGR +Y R++K      ++ ++  + Q ++ 
Sbjct: 1165 ITGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSKFVLCTFYKEVLFYLTQMIYQ 1224

Query: 952  VCSQFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKMYPELYKDLTEGKSLS 1010
              + F   +LY+ W +  + T +T  PV  + + + D+        PELY    + ++ +
Sbjct: 1225 RQTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKPMTLLAVPELYTMGQKCQAFN 1284

Query: 1011 YKTFFVWVALSFYQGLVIQGFS---QTFTSLAEIDFTKMVAIGFTALIF 1056
             K F VW+  +    ++I   +     FT+ ++     +  I FT++ F
Sbjct: 1285 LKIFLVWMLTAAGISVLITFLNFEIWGFTAQSDNSIYPIGVINFTSICF 1333

 Score =  138 bits (348), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 137/532 (25%), Positives = 231/532 (43%), Gaps = 123/532 (23%)

Query: 262 KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLR-----IACTLT 316
           KDLKVG+ + ++    VPAD++LL +   + EAF++T  LDGET+ K +     +A  +T
Sbjct: 275 KDLKVGEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMT 334

Query: 317 QNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIG 376
                   +   T T   P   +++F G V   D     L  DN ++  ++L ++   +G
Sbjct: 335 SATGLS--MHSATTTLEDPNNDLYNFEGTVEI-DGELYPLGSDNVVYRGSILRNTQSIVG 391

Query: 377 CVIYTGRDTRQAMNT-TSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLH----- 430
            VI+TG +T+  MN   + + K   L+ +IN I  +L     + ++ +  + G H     
Sbjct: 392 IVIFTGEETKIRMNAIKNPRTKAPKLQGKINLI--VLFMVFVVAAMAMFSYLGQHILKKN 449

Query: 431 ----NDDWYV---------DIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HD 471
               N  WY+          IM ++I+++T+IP+SL V  ++ K++ +  +E      H 
Sbjct: 450 YVDNNRAWYLFQEDAGTAPTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHI 509

Query: 472 KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQN-------------------------- 505
           ++      RT+TI E+LG++ Y+ SDKTGTLT N                          
Sbjct: 510 ESDTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSICGSSWLHEIDEDLIDPI 569

Query: 506 ----------------DMQLKKVHLGN----VSYTTETADIVSDYI--------QGMIES 537
                           +  L+  H  N    + Y   +  + S           Q + E 
Sbjct: 570 DDDIDVISIEDRSFLNEFDLRSTHSKNPRTSIEYKGNSGAVYSGRPSMALQIQRQELAED 629

Query: 538 KNDSVTNLGPRSTTRKDAATHVIDL-------------------ITTLAICHNVTPTFED 578
            N + TN   RS+  K+     +DL                   I +LA+CH   P    
Sbjct: 630 LNTTRTN-SSRSSEEKNGLKTTVDLLLYIQKHPNTEFSIRAKFFILSLALCHTCLPKKTH 688

Query: 579 D---ELTYQAASPDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSG-----TILNYDVLTM 630
           D    + YQ++SPDE+A+V     +G  +  R+  ++S+    +G      + +Y+VL  
Sbjct: 689 DGTDSILYQSSSPDELALVTAARDMGFVVTNRNSSTLSIATYPNGFDDQPIVEDYEVLEY 748

Query: 631 FPFNSDTKRMGIIV-YDKQKDQYWFLQKGADTVM-----NRIVANNDWLEEE 676
             F+S  KRM + V      D+   + KGAD V+     N  +A N  LE++
Sbjct: 749 INFDSQRKRMSVAVKMPNDDDRVLLICKGADNVILERLRNSELAQNKVLEQQ 800

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 67/121 (55%), Gaps = 13/121 (10%)

Query: 133 WKDYSTSVALGDEHTEREVHPGTTQVYDRHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFF 192
           ++ Y+ S  L DE T+R              +  N +++++Y   +FLP  LY QF    
Sbjct: 98  YQQYARSNLLIDERTDRP-------------YRDNVITSSRYTVYSFLPRQLYAQFSKLA 144

Query: 193 NLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRESNMELYEV 252
           N YFLLVA+ Q IP+       + +VPL+  L+++MA+EA DD +R R D+E N +  +V
Sbjct: 145 NAYFLLVAILQMIPSWSTTGTYTTIVPLSIFLSISMAREAWDDFKRHRLDKEENNKSTKV 204

Query: 253 L 253
           L
Sbjct: 205 L 205

>Kwal_23.3556
          Length = 1597

 Score =  211 bits (537), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 139/407 (34%), Positives = 218/407 (53%), Gaps = 20/407 (4%)

Query: 666  IVANNDWLEEET----GNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEM 721
            ++ N +++ E T     + +  GLRTL+   K +  + YE++ K+Y     S+ NR+++M
Sbjct: 949  LIQNEEFVLERTLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKM 1008

Query: 722  ANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISA 781
             +++ + +E  L LLG T +EDKLQ+ V  +I+ +R AGIK+WMLTGDK ETA  +  S 
Sbjct: 1009 -HSVGELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSC 1067

Query: 782  KLISRGQYVHVVTKLSKPEGAFNQL-----EYLKVNKNACLL-IDGESLGMFLK--YYRQ 833
             LI    Y  VV   +K E   ++L     E  + N   C++ IDG +L  F        
Sbjct: 1068 NLIH--DYSTVVILSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESNPTLMS 1125

Query: 834  EFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVC-CIGDGGNDVSMIQCADVGVGI 892
             F ++     +VI CR +P QKA +   IR    K V   IGDG ND++MIQ AD+GVGI
Sbjct: 1126 VFVELCTKTDSVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGI 1185

Query: 893  VGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSV 952
             GKEG QAS ++D+SI QF  L +LLL HGR +Y R+ K      ++ L+  + Q ++  
Sbjct: 1186 AGKEGLQASRSSDYSIAQFRFLLKLLLVHGRYNYVRTTKFVLCTFYKELLFYLTQMIYQR 1245

Query: 953  CSQFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKMYPELYKDLTEGKSLSY 1011
             + F   +LY+ W +  + T +T  PV  + + + D+        PELY      +S + 
Sbjct: 1246 HTMFSGTSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRLSQSFNL 1305

Query: 1012 KTFFVWVALSFYQGLVIQGFSQTFTSLAEIDFTKMVAIG---FTALI 1055
            + F  W+ L+    L+I   +    +++ +    +  IG   FTA+I
Sbjct: 1306 RVFLYWMFLAALNSLIITFLNWKIWAVSSLSDNTVYPIGVINFTAII 1352

 Score =  132 bits (333), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 120/446 (26%), Positives = 199/446 (44%), Gaps = 95/446 (21%)

Query: 166 SNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLT 225
           SN +++++Y   TFLP  LY QF    N YF LVA+ Q IP        + +VPL   + 
Sbjct: 110 SNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTYTTIVPLLIFMG 169

Query: 226 VTMAKEASDDIQRRRRDRESNMELYEVL----------GRPRPVAS-------------- 261
           ++M++EA DD +R + DRE N +   VL           RP  + S              
Sbjct: 170 ISMSREAWDDFRRHKLDREENDKTARVLVKSSSPHTEFSRPNSLYSLPQWQQSATSTSML 229

Query: 262 ----------------KDLKVGDLIKISKGARV---------PADLILLQSSE--PS--- 291
                            D    DL+K   G              D ++L+  E  P+   
Sbjct: 230 TNPTLESTAEAATSQNDDHTNWDLLKSKYGVEAVEKKWKDIKVGDYVVLEQDEWVPADML 289

Query: 292 --------GEAFIKTDQLDGETDWKLRIACTLTQNLNED--DLLE-KITITASAPEKSIH 340
                    E F++T  LDGET+ K +   T    + +    L E K  +T   P   +H
Sbjct: 290 VLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKTAAGLTEFKAKVTVEDPNIDLH 349

Query: 341 SFLGRVTYKDTNTSGLTI--DNTLWANTVLASSGFCIGCVIYTGRDTRQAMNT-TSAKVK 397
           +F G +     N   LTI  D+ ++  +++ ++   +G V++TG +T+  MN   + ++K
Sbjct: 350 NFEGNLELLGENRK-LTIGPDHIIYRGSIIRNTSNAVGMVVFTGEETKIRMNAIKNPRIK 408

Query: 398 TGLLELEINDISKILCACVFILSILLVVFAGL---------HNDDWYV---------DIM 439
              L+  IN I  +L     + S+ L    G          +N  WY+          +M
Sbjct: 409 APKLQRAINLI--VLFMVFVVASMALFSLLGQRIIKKKYVDNNRAWYLFNSDAGLAPTVM 466

Query: 440 RYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGRIEY 493
            ++I+++T+IP+SL V +++ K++ +  +E      H +T      RT+TI E+LG++ Y
Sbjct: 467 SFIIMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQVSY 526

Query: 494 LLSDKTGTLTQNDMQLKKVHLGNVSY 519
           + SDKTGTLT N M  + + +   S+
Sbjct: 527 IFSDKTGTLTDNKMVFRALSVCGSSW 552

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 79/158 (50%), Gaps = 23/158 (14%)

Query: 535 IESKNDSVTNLGPRSTT------RKDAATH----VIDLITTLAICHNVTPTFE-----DD 579
           IE +  S T L  RS+T      +++  TH    V   I +LA+CH   P        +D
Sbjct: 633 IEPEKSSKTGL--RSSTELIRYIQQNPNTHFAKKVSFFILSLALCHACLPKSSSGVEGED 690

Query: 580 ELTYQAASPDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSG-----TILNYDVLTMFPFN 634
            + YQA+SPDE+A+V     +G ++  R+   +++    +G      +  Y++L    F+
Sbjct: 691 CVEYQASSPDELALVTAARDMGYAVMNRNSDVLTIKTYPNGFDAEPHLDKYEILNNIEFS 750

Query: 635 SDTKRMGIIV-YDKQKDQYWFLQKGADTVMNRIVANND 671
           S  KRM ++V    ++++   + KGAD V+   + N+D
Sbjct: 751 SHRKRMSVLVRLPHEENRILLICKGADNVILERLHNSD 788

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  207 bits (528), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 126/356 (35%), Positives = 195/356 (54%), Gaps = 13/356 (3%)

Query: 683  EGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVE 742
            EGLRTL+   K +  + YE +   Y    A++ NR ++M +T+ + +E DL LLG  G+E
Sbjct: 951  EGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQM-DTVGEIIERDLTLLGTIGIE 1009

Query: 743  DKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGA 802
            DKLQ+ V  +I+ LR AGIK+WMLTGDK ETA  +  S +LI    Y  V+      E  
Sbjct: 1010 DKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIH--DYSTVIILAPNDENM 1067

Query: 803  FNQL-----EYLKVNKNACLL-IDGESLGMFLK--YYRQEFFDVVVHLPTVIACRCTPQQ 854
             +++     E    N   C++ IDG +L +F         F ++     +VI CR +P Q
Sbjct: 1068 ASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFIELCTKTDSVICCRSSPSQ 1127

Query: 855  KADVALIIRELTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCH 913
            KA +   IR+   K V   IGDG ND++MIQ AD+GV I GKEG QAS ++D+SI QF +
Sbjct: 1128 KALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIAQFRY 1187

Query: 914  LTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATC 973
            L +LLL HGR +Y R++K      ++  +  + Q +F + + F   + Y+ W +  + T 
Sbjct: 1188 LLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTVFNTL 1247

Query: 974  YTMAPVFSLTL-DHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLVI 1028
            +T  PV  + + + D+        PELY    + ++ +   F  W+A++    ++I
Sbjct: 1248 FTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALSSVII 1303

 Score =  148 bits (374), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 123/467 (26%), Positives = 220/467 (47%), Gaps = 69/467 (14%)

Query: 140 VALGDEHTEREVHPGTTQVYDRHRFP--SNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFL 197
           VALG      E   G   V  R   P   N +++++Y+  +FLP  L  QF    N YF 
Sbjct: 85  VALG-RRGFAESAGGGGYVDRRSGLPYIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFF 143

Query: 198 LVALSQAIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRESNMELYEVL---- 253
            +A+ Q +P        + +VPL+  + +++A+E  +D +R + DRE N +L +VL    
Sbjct: 144 GMAILQMVPNWSTTGQYTTIVPLSIFMGISIAREGWEDFRRHKLDREENNKLVKVLAQAH 203

Query: 254 ----GRPRPVAS--------------------------KDLKVGDLIKISKGARVPADLI 283
               G  + +++                          KD++VG+ + +++   VPADL 
Sbjct: 204 DSEFGDNKDISAEARAASFTDFETLQANHGVAVVEKQWKDVEVGEFVLLNQDDWVPADLF 263

Query: 284 LLQSSEPSGEAFIKTDQLDGETDWKLR--IACTLTQNLNEDDLLE-KITITASAPEKSIH 340
           LL +   + E +++T  LDGET+ K +  +    +Q      L   +   T   P   ++
Sbjct: 264 LLATDGDNNECYVETMALDGETNLKCKHVLPKIASQTRTASGLATFRGMTTVEDPNIDLY 323

Query: 341 SFLGRVTYK----DTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNT-TSAK 395
           +F G++  +    +     + +DN L+  +++ ++   +G V++TG +T+  MN   + +
Sbjct: 324 NFEGKIEVETDSGEQQAYSIGLDNVLFRGSIIRNTQTVVGMVVFTGEETKIRMNAIKNPR 383

Query: 396 VKTGLLELEINDISKILCACVFILSILLV----VFAGLHNDD---WYV---------DIM 439
           +K+  L+ +IN I   +   V I S L       F     D    WY+          IM
Sbjct: 384 IKSPKLQTQINLIVLFMILVVAIFSFLSFGLQRFFKNREVDSDRAWYLMKVDAGLAPTIM 443

Query: 440 RYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGRIEY 493
            ++I+++T+IP+SL V +++ K + +  +E      H +T      RT+TI E+LG++ Y
Sbjct: 444 SFIIMYNTLIPLSLYVTMEIIKDMQSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSY 503

Query: 494 LLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKND 540
           + SDKTGTLT N M  +K      ++  + A    D   G  ++K D
Sbjct: 504 IFSDKTGTLTDNRMIFRKFSFCGTAWEHDVAR--KDQETGCSQTKKD 548

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 64/128 (50%), Gaps = 13/128 (10%)

Query: 562 LITTLAICHNVTP-------TFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSMSL 614
            I  LA+CH   P       + + D + YQ++SPDE+A+V     +G  +  R+   +++
Sbjct: 653 FILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGDELTI 712

Query: 615 LHEHSG-----TILNYDVLTMFPFNSDTKRMGIIVYDKQ-KDQYWFLQKGADTVMNRIVA 668
                G      +  Y+VL    F+SD KRM ++V   Q  ++   + KGAD V+   + 
Sbjct: 713 KTYPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQHPEKVLLICKGADNVILERLH 772

Query: 669 NNDWLEEE 676
           N+D  +++
Sbjct: 773 NSDLAQQK 780

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  202 bits (515), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 158/525 (30%), Positives = 257/525 (48%), Gaps = 42/525 (8%)

Query: 629  TMFPFNS---DTKRMGIIVYDKQKDQYWFLQKGADTVMNRIVANNDWLEEET----GNMA 681
            T FP N+   DT++ G+       D       G+D     ++ N +++ E T       +
Sbjct: 977  THFPNNNVPIDTRKEGL---QHDYDTEILEHIGSD----ELILNEEYVIERTLQAIDEFS 1029

Query: 682  REGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGV 741
             EGLRTLV   K +    YE + K Y +   S+ +R+ ++    ++ +E  L LLG+T +
Sbjct: 1030 TEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAE-IEDGLNLLGVTAI 1088

Query: 742  EDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHVVTK-----L 796
            EDKLQ  V  +IE +R AGIK+WMLTGDK ETA  +  S  LI     V ++T      +
Sbjct: 1089 EDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDYSTVVILTTTDENII 1148

Query: 797  SKPEGAFNQLEYLKVNKNACLLIDGESLGMFL--KYYRQEFFDVVVHLPTVIACRCTPQQ 854
            SK      +++   +  +  ++IDG ++ MF     Y   F ++     +VI CR +P Q
Sbjct: 1149 SKMNAVSQEVDSGNI-AHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQ 1207

Query: 855  KADVALIIRELTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCH 913
            KA +   IR      V   IGDG ND++MIQ AD+GVGI GKEG QAS  +D+SI QF  
Sbjct: 1208 KALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRF 1267

Query: 914  LTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATC 973
            L +LL  HGR +Y R++K      ++ +     Q ++   + F   +LY+ W +  + T 
Sbjct: 1268 LLKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTL 1327

Query: 974  YTMAPVFSLTL-DHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLVIQGFS 1032
            +T  PV  + + + D+        PELY      +  ++  F  WV L+    L+I   +
Sbjct: 1328 FTSLPVLCIGMFEKDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLN 1387

Query: 1033 QTFTSLAEIDFTKMVAIG---FTALIFNELIMVA---LEIYTWNKTMIITEIVTLA---I 1083
                 ++ +    M  +G   FTA++   LI V    +E++  N     + +++     +
Sbjct: 1388 VVMWGMSSLSDNTMYPLGLINFTAIV--ALINVKSQFVEMHNRNWLAFTSVVLSCGGWLV 1445

Query: 1084 YVFSVPFLG---EYFDLKYISTLKF---ITELILILVVSIFPVWL 1122
            +  ++P L    + +D+ Y     F   IT     LV+++ P+ L
Sbjct: 1446 WCCALPILNNTDQIYDVAYGFYNHFGKDITFWCTSLVLALLPITL 1490

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 120/455 (26%), Positives = 198/455 (43%), Gaps = 109/455 (23%)

Query: 167 NEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTV 226
           N +++++Y   +FLP  LY QF    N YF +VA+ Q IP        + ++PL   + +
Sbjct: 141 NRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTGTYTTIIPLCVFMGI 200

Query: 227 TMAKEASDDIQRRRRD------------RESNMELYEVLGRPRPVAS------------- 261
           +M +EA DD +R R D            ++ N +  EV   P  V S             
Sbjct: 201 SMTREAWDDFRRHRLDKEENNKPVGVLVKDGNNDAQEVYTLPSSVVSSTAYLTKSAAAEN 260

Query: 262 ---------------------------------------KDLKVGDLIKISKGARVPADL 282
                                                  + L+VGD + +++   VPADL
Sbjct: 261 NPPLNDDRNSSQGHFLDTHFNNFELLKNKYNVHIHQKKWEKLRVGDFVLLTQDDWVPADL 320

Query: 283 ILLQSSEPSGEAFIKTDQLDGETDWK----------LRIACTLTQNLNEDDLLEKITITA 332
           +LL     + E F++T  LDGET+ K          L  A +   N+N         +T 
Sbjct: 321 LLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAASGLANINAQ-------VTV 373

Query: 333 SAPEKSIHSFLGRVTYKDTNTS-----GLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQ 387
             P   +++F G +  K+          L  DN ++  ++L ++   +G VI++G +T+ 
Sbjct: 374 EDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNVVGMVIFSGEETKI 433

Query: 388 AMNT-TSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLH-------NDDWYV--- 436
            MN   + + K   L+ +IN I   +   V  +S+   +   LH       N  WY+   
Sbjct: 434 RMNALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHKKKYIDQNKAWYLFQA 493

Query: 437 ------DIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTI 484
                  IM ++I+++T+IP+SL V +++ K V +  +E      H +T      RT+TI
Sbjct: 494 DAGVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTATI 553

Query: 485 PEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSY 519
            E+LG++ Y+ SDKTGTLT N M  +K  L   S+
Sbjct: 554 LEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSW 588

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 58/111 (52%), Gaps = 12/111 (10%)

Query: 565 TLAICHNVTP------TFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSMSLLHEH 618
           +LA+CH+  P      +  +D + YQ++SPDE+A+V     +G  +  R+   +++    
Sbjct: 734 SLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQILTIKTFP 793

Query: 619 SG-----TILNYDVLTMFPFNSDTKRMGIIV-YDKQKDQYWFLQKGADTVM 663
            G      + NY++L    FNS  KRM ++V    Q +Q   + KGAD V+
Sbjct: 794 DGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVI 844

>Scas_669.3
          Length = 1638

 Score =  194 bits (492), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 136/387 (35%), Positives = 202/387 (52%), Gaps = 22/387 (5%)

Query: 683  EGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVE 742
            EGLRTLV   K +  + Y+Q++  Y +   S+ NR+ ++A  + + +E DL+LLG T +E
Sbjct: 1005 EGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAE-VGEEIEQDLQLLGATAIE 1063

Query: 743  DKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHVVTK-----LS 797
            DKLQ+ V  +IE +R AGIKIWMLTGDK ETA  +  S KLI     V ++ K     +S
Sbjct: 1064 DKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIYDYSTVVILAKGDENIIS 1123

Query: 798  KPEGAFNQLEYLKVNKNACLLIDGESLGMFL--KYYRQEFFDVVVHLPTVIACRCTPQQK 855
            K      +++   V  +  ++IDG +L MF         F ++     +VI CR +P QK
Sbjct: 1124 KMNAISQEVDSGNV-AHCVIIIDGSTLAMFEGNPTLMSVFIELCTKTDSVICCRASPSQK 1182

Query: 856  ADVALIIRELTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHL 914
            + +   IR      V   IGDG ND++MIQ AD+G+GI GKEG QAS  AD+SI QF  +
Sbjct: 1183 SLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGIGGKEGLQASRTADYSIAQFRFI 1242

Query: 915  TELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCY 974
             +LLL HGR +Y R+AK       + +   + Q +F   + F   +LY+ W +  + T +
Sbjct: 1243 LKLLLVHGRYNYIRTAKFILCTFFKEITFYLTQLIFQRYTMFSGSSLYEPWSLSMFNTLF 1302

Query: 975  TMAPVFSLTL-DHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLVIQGFS- 1032
            T  PV  + + + D+        PELY      +  +   F  WV  +    L+I   + 
Sbjct: 1303 TSLPVLCIGMFEKDLKPMTLLTIPELYSMGRLSQGFNLIIFGEWVIQAAAYALLITFLNI 1362

Query: 1033 ----------QTFTSLAEIDFTKMVAI 1049
                       T   L  I+FT +VA+
Sbjct: 1363 IIWGETALSDHTMYPLGVINFTAIVAL 1389

 Score =  168 bits (426), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 127/464 (27%), Positives = 218/464 (46%), Gaps = 91/464 (19%)

Query: 164 FPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFV 223
           + +N +++++Y   +F P  LY QF    N+YF +VA+ Q IP        + +VPL   
Sbjct: 140 YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTGTYTTIVPLCIF 199

Query: 224 LTVTMAKEASDDIQRRRRDRESNMELYEVL-----GRPRPVASK---------------- 262
           + ++MA+EA DD +R R D+E N +   +L      +P P  ++                
Sbjct: 200 MGISMAREAWDDFRRHRLDKEENNKTCSILTKEFSNKPMPDDAQLPSRQNIDNLSNDSNT 259

Query: 263 ---------------------------DLKVGDLIKISKGARVPADLILLQSSEPSGEAF 295
                                      +L VGD + + +   VPAD+++L S   + E F
Sbjct: 260 DYLNTKFNNFPFLEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNECF 319

Query: 296 IKTDQLDGETDWKLR--------IACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVT 347
           ++T  LDGET+ K++        +AC+ +   N + L     IT   P   +++F G + 
Sbjct: 320 VETMALDGETNLKVKQPHPELNKLACSASGLANINAL-----ITVEDPNSDLYNFEGNLE 374

Query: 348 YKDTNTSGLT-----IDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNT-TSAKVKTGLL 401
             D N + L       DN  +  +++ ++   IG VIYTG++T+  MN   + + K   L
Sbjct: 375 LTDNNNNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALNNPRTKAPKL 434

Query: 402 ELEINDISKILCACVFILSILLVVFAGLHNDD-------WYV---------DIMRYLILF 445
           +  IN I   +   V ++S+   +   L N         WY+          IM ++I++
Sbjct: 435 QKNINIIITFMVFVVAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAAPTIMSFIIMY 494

Query: 446 STIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGRIEYLLSDKT 499
           +TIIP+SL V +++ K++ +  +E      H +T      RT+TI E+LG++ Y+ SDKT
Sbjct: 495 NTIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKT 554

Query: 500 GTLTQNDMQLKKVHLGNVSYTTETADIVSDYI-QGMIESKNDSV 542
           GTLT N M  +K  +   S+   T D+ S+ + +G   S N  +
Sbjct: 555 GTLTDNKMIFRKFSICGSSWLHST-DLGSNALYKGSPNSNNSDI 597

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 12/114 (10%)

Query: 562 LITTLAICHNVTPTFE------DDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSMSLL 615
            I +LA+CH   P         +D + YQ++SPDE+A+V     +G  +  ++   +++ 
Sbjct: 702 FILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNKNADVLTIK 761

Query: 616 -----HEHSGTILNYDVLTMFPFNSDTKRMGIIVY-DKQKDQYWFLQKGADTVM 663
                 E+     +Y +L    FNS  KRM ++V    + ++   + KGAD ++
Sbjct: 762 TYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLVKTPDEPNKVLLICKGADNMI 815

>Scas_505.4
          Length = 1025

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 116/215 (53%), Gaps = 2/215 (0%)

Query: 816  CLLIDGESLGMFLKYYRQEFFDVVVHL-PTVIACRCTPQQKADVALIIRELTGKRVCCIG 874
             L+IDG+SL   L+   +++   +  +   V+ CR +P QKA V  +++  T   +  IG
Sbjct: 559  ALVIDGKSLSYALESDLEDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIG 618

Query: 875  DGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQ 934
            DG NDVSMIQ A VGVGI G EG QA+ +AD ++ QF  L +LLL HG  SY+R +    
Sbjct: 619  DGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISVAIL 678

Query: 935  FVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLT 993
            +  ++   + + Q  F   + F   ++ + W M  Y   +T+ P F +   D  +   L 
Sbjct: 679  YSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSSRLL 738

Query: 994  KMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLVI 1028
            + YP+LYK   +GK  S + F+ W+   FY   V+
Sbjct: 739  ERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV 773

 Score =  131 bits (329), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/299 (29%), Positives = 151/299 (50%), Gaps = 11/299 (3%)

Query: 139 SVALGDEHTEREVHPGTTQVYDRHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLL 198
           +V   D+ T RE++           +  N +S  KYN  TFLP  L+++F  + NL+FL 
Sbjct: 212 NVGASDDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLC 271

Query: 199 VALSQAIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRE---SNMELY-EVLG 254
            A  Q +P +      + V  L  VL V+  KE+ +DI+R   D+E   S  E+Y E  G
Sbjct: 272 TAAIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENG 331

Query: 255 RPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACT 314
                   D++ GD+I++     +PADLI++ SSEP G  +I+T  LDGET+ K++ A  
Sbjct: 332 DFIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARP 391

Query: 315 LTQNLNEDDLLE--KITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSG 372
            T  + +   L   K  + +  P  S++++ G + + +     L+ +  +     L ++ 
Sbjct: 392 ETAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKIP-LSPEQMILRGATLRNTS 450

Query: 373 FCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHN 431
           +  G VI+TG +T+   N T+  +K   +E  IN    +    +F + I+LV+ + L N
Sbjct: 451 WMFGLVIFTGHETKLMRNATATPIKRTAVERVIN----LQIVALFGVLIVLVLISSLGN 505

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 159/704 (22%), Positives = 282/704 (40%), Gaps = 129/704 (18%)

Query: 259 VASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQN 318
           ++  DL VGDL+ +  G  VP D IL++     G+       + GE+D   +++  ++  
Sbjct: 196 ISVHDLLVGDLLSLQTGDVVPVDCILVE-----GKCECDESGITGESDTIKKVSLAMSLQ 250

Query: 319 LNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASS-GFCIGC 377
           +         T+ A  P   I S          N   L  D  L + + L S  G  +  
Sbjct: 251 VYR-------TVAADNPSADIGS--------SDNGHSLVPDPMLISGSKLLSGIGHAVVT 295

Query: 378 VIYTGRDTRQAMNTTSAKVKTGLLELEIN----DISKILCACVFILSILLVV--FAGLHN 431
            +       + M    ++ +T  L+  +N    DIS       F+L ++L +   + L  
Sbjct: 296 AVGPHSVHGKMMLALKSEPETTPLQERLNTLADDISIYGSVAAFLLFVVLFLRFLSYLPK 355

Query: 432 DDWYVDI------MRYLILFSTII-------PVSLRVNLDLAKSVYAHQIEHDKTIPETI 478
              Y D+       R++ +F T +       P  L + + LA +    ++  D  +    
Sbjct: 356 GRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNL---- 411

Query: 479 VRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETAD---IVSDYI-QGM 534
           VR     E +G    + SDKTGTLTQN M + K  LG+  +   + D     SD + Q M
Sbjct: 412 VRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGFLGSSHFDDISEDSNCAQSDALRQDM 471

Query: 535 IE-SKNDSVTNLGPRSTTRKDAATHVIDLITTLAICH----NVTPTFEDDELTYQAASPD 589
            + + ND + N+   ST  ++    V D + T    H    ++ P   +++  Y A    
Sbjct: 472 SQHTLNDILANIALNSTAFEN--KQVADPVITENPYHKPRRSLFPWSRNNKPKYPAPKDS 529

Query: 590 EIAIVKF-----TESVGLSLFKRD--RHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGI 642
            +   +F     TE+  LSL K      S+  L +    I    ++ M PF S  K  G+
Sbjct: 530 SVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRDDPHHIGIASIVQMIPFESSRKWAGL 589

Query: 643 IVYDKQKDQYWFLQKGADTVMNRI----VANNDWLE---EETG-------NMAREGLRTL 688
           +V     +  +F++  ++T+         +N+D ++   ++ G       N+A + LRT+
Sbjct: 590 VVRLVDGNYRFFIKGASETIFKSCHYMRSSNDDVIKLSPQKHGEIFGLINNLASDALRTI 649

Query: 689 VIGRKKLTKKIYEQFKKEYEEVS----------------ASMYNREQEMANTISKYLEHD 732
            +  K  T  I      E  + S                 +  +R   + N  S  +   
Sbjct: 650 SLAHKDFT-DISSWPPAELRDASDPSTASPDLLLGDEYVPTATDRPSIITNNNSGLI--- 705

Query: 733 LELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHV 792
             L G+ G+ D L+  VK S++  + +G+ + M+TGD + T R ++ +  ++S  +Y   
Sbjct: 706 --LDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILSESEYADH 763

Query: 793 VTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTVIACRCTP 852
              +  P                          +F K  R++  D    L   +  R +P
Sbjct: 764 ECAMEGP--------------------------VFRKLSRRQMMDAAPKLK--VLARSSP 795

Query: 853 QQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVG--VGIVG 894
           + K     I++++  + V   GDG ND   +  ADVG  +GI G
Sbjct: 796 EDKRIFVDILKKMN-EVVAVTGDGTNDAPALTLADVGFSMGISG 838

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 169/721 (23%), Positives = 290/721 (40%), Gaps = 143/721 (19%)

Query: 259  VASKDLKVGDLIKISKGAR--VPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLT 316
            V S DL  GD+ +++  +   +P D IL+     SG+  +    L GE+    ++A T  
Sbjct: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGESVPVSKVAATRE 606

Query: 317  QNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIG 376
              L    LL+                     + DT  S     + L+  T L       G
Sbjct: 607  TMLQ---LLDD--------------------FMDTQLSSFVSKSFLFNGTKLIRVRATAG 643

Query: 377  CVIYTGRDTRQAMNTTSAKV--------KTGL--LELEINDISKILCACVFILSILLVVF 426
              I  G   R   +TT   +         TG    E     I  I    +F  ++  + F
Sbjct: 644  QSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQF 703

Query: 427  AGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPE 486
              L  D   + I+R L + + ++P +L  +L +      ++++       +  R +    
Sbjct: 704  LRLGLDKRTM-ILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV--- 759

Query: 487  DLGRIEYLLSDKTGTLTQNDMQLKKVH----LGNVSYTTETADIVSDYIQGMIESKNDSV 542
              G+I+ +  DKTGTLT++ + +  VH    L      ++    V D +Q +  S +D V
Sbjct: 760  -GGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSL--SLSDCV 816

Query: 543  TNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT----- 597
                  ST    A   ++ L+T    CH++     D EL      P +  +V+FT     
Sbjct: 817  ------STRDMKAKNFLVSLLT----CHSLR--MVDGELL---GDPFDFKMVQFTKWSDE 861

Query: 598  ESVG----LSLFKRDRHSMSLLHEHS------------GTILNYD------VLTMFPFNS 635
            E  G     SL++ +RH  S + E+S            G  +  +      ++  F F S
Sbjct: 862  EETGNRKVHSLYE-ERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLS 920

Query: 636  DTKRMGIIVYDKQKDQYWFLQKGADTVMNRIVANNDW---LEEETGNMAREGLRTLVIGR 692
            + +RM +IV    ++ +    KGA  V+  + +        E    +    G R +    
Sbjct: 921  NLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAG 980

Query: 693  KKLTKK--IYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVK 750
            KKLT++  +Y Q K   EE+                   E +LE LG    E+KL+   K
Sbjct: 981  KKLTRQSWLYSQ-KVSREEI-------------------ESNLEFLGFIIFENKLKGTTK 1020

Query: 751  SSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHVVTKL-SKPEG------- 801
             ++E L  A I+  M TGD V TA  V   A L+   + +V V+  + +  EG       
Sbjct: 1021 ETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQN 1080

Query: 802  ---AFNQLEYLKVNK------NACLLIDGESLGMFLKYYRQEFFDVV--VHLPTVIACRC 850
               + + L+ + +        +  L + GE   +  K  + +  +V+  + L T I  R 
Sbjct: 1081 VANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARM 1140

Query: 851  TPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQ 910
            +P +K ++   ++ + G +V   GDG ND   ++ AD+G+ +   E   AS+AA F+   
Sbjct: 1141 SPDEKHELVERLQSI-GYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFTSRL 1196

Query: 911  F 911
            F
Sbjct: 1197 F 1197

>Kwal_23.3160
          Length = 1100

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 178/729 (24%), Positives = 287/729 (39%), Gaps = 159/729 (21%)

Query: 254 GRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQ--LDGETDWKLRI 311
           G    + SK L  GDL  +  G  VPADL L++          +TD+  L GE+    + 
Sbjct: 142 GNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVN------FETDEALLTGESLPIAKE 195

Query: 312 ACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNT------SGLTIDNTLWAN 365
           A  +     +  + +++ +  ++   S     G V     NT        L  DN+L + 
Sbjct: 196 ASQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISK 255

Query: 366 ----TVLASSGFCIGCVI--YTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFIL 419
               T  A++G  +   I  + G  T   ++                 +SK+     FI 
Sbjct: 256 DENKTFWANAGITLAATIGSFLGTTTGTPLH---------------RKLSKLAVLLFFIA 300

Query: 420 SILLVVFAGLHNDDWYVDIMRYLILFS-TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETI 478
            +  +V           ++  Y I  + ++IP SL V L +  SV A +I   + +   +
Sbjct: 301 VVFAIVVMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGA-KIMATRNV---V 356

Query: 479 VRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNV-SYTTETADIVSDYIQGMIE- 536
           VR     E LG +  + SDKTGTLTQ  M +K+  + +  + T   +    D   G IE 
Sbjct: 357 VRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIEL 416

Query: 537 --------SKNDSVTNLGPRSTTRKD----------AATHVIDLITTLAICHNVTPTFED 578
                    K+DS  ++G  ++ +             +   ++ + T A+  N+   ++D
Sbjct: 417 IPRFSPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALA-NIAHVYQD 475

Query: 579 DELTYQAA--SPDEIAIVKFTESVGL---SLFKRDR------HSMSLLHEHSGTILNYDV 627
            E     A   P EIAI  F   + +   +L   D+         +L  + S    +Y  
Sbjct: 476 PETEEWKAHGDPTEIAIQVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVEPHYKH 535

Query: 628 LTMFPFNSDTKRMGIIVYDKQKDQ-YWFLQKGADTVMNRIV-ANNDWL------------ 673
           +  FPF+S  KRM  +     +D  +    KGA     R++     WL            
Sbjct: 536 IAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGA---FERVLDCCTKWLPDGCNESDAKPM 592

Query: 674 -----EEETGN---MAREGLRTLVIGRKKLTK----KIYEQFKKEYEEVSASMYNREQEM 721
                EE   N   ++ EGLR L    K  T+    K+ E  +K          NR+   
Sbjct: 593 TEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRK----------NRD--- 639

Query: 722 ANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISA 781
                 ++E DL   GL G+ D  +++   +++    AGI + MLTGD   TA+ ++   
Sbjct: 640 ------FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEV 693

Query: 782 KLISRGQYVH---VVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDV 838
            ++ R  Y +   VV  +      F+QL                           E  D 
Sbjct: 694 GILPRNLYHYPKEVVDSMVMTAAQFDQL-------------------------TDEEIDN 728

Query: 839 VVHLPTVIACRCTPQQKADV--ALIIRELTGKRVCCI-GDGGNDVSMIQCADVGV--GIV 893
           ++ LP VIA RC PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+  GI 
Sbjct: 729 LLLLPLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIAMGIN 783

Query: 894 GKE-GKQAS 901
           G +  K AS
Sbjct: 784 GSDVAKDAS 792

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 178/802 (22%), Positives = 318/802 (39%), Gaps = 158/802 (19%)

Query: 236 IQRRRRDRESNM--ELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGE 293
           + R+R DR+  +  +  E L     ++  +L VGDL+K+  G  VPAD +L++     GE
Sbjct: 150 LNRKREDRQVVVVRDAAESL-----ISIHNLLVGDLLKLQTGDVVPADCVLVR-----GE 199

Query: 294 AFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNT 353
                  L GE++          + L   D LE             HS  G     DT+ 
Sbjct: 200 CETDESALTGESN--------TIKKLPLADALE------------YHSAHGGRDIGDTSA 239

Query: 354 SGLT--IDNTLWANTVLAS-----SGFCIGCVIYTGRDTRQAMNTTSAKVKT--GLLELE 404
           SG +   D++   + +L S     SG     V   G ++       S K  +    L++ 
Sbjct: 240 SGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVGVNSVHGKTMASLKEDSEDTPLQMR 299

Query: 405 INDISKILC--ACVFILSILLVVFAG-----LHNDDWYVDI---------MRYLILFSTI 448
           ++ ++  +    CV  +++ +V+FA      L +   Y D+         M   I   T+
Sbjct: 300 LSQLTDNISVYGCVAAITLFVVLFARYLSYILPSGGKYHDLPPAEKGSKFMDIFITAITV 359

Query: 449 IPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQ 508
           I V++   L LA ++         T    +VR     E +G    + SDKTGTLT+N M 
Sbjct: 360 IVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENIMT 419

Query: 509 LKKVHLGNVSYTTETADI----------VSDYIQGMI-----------ESKN-------D 540
           + +  LG   +    AD            SD ++ +I           E+K+       +
Sbjct: 420 VVRGTLGRAGFDDIGADPSKSNLVFKKKCSDLLRTVIYDNIVLNSTAFENKDYKDPNNYN 479

Query: 541 SVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESV 600
           S+ +  PR   R+   T                P  E++ L + A    E  I   TE+ 
Sbjct: 480 SIDDSQPRRLIRRITQT-----------LQKKKPDDEENLLAHAAEGRQEPYIGSKTETA 528

Query: 601 GLSLFKRDRH----SMSLLHEHSGTILNYD-VLTMFPFNSDTKRMGIIVY-----DKQKD 650
            LSL ++       ++     H   +   + ++ + PF S  K   I+V      + +  
Sbjct: 529 LLSLARKSFGLKFGALQSFRGHPEKLPTVETIVQIIPFESSRKWSAIVVKLNSNKENEGK 588

Query: 651 QYWFLQKGADTVMNRIVA---------------NNDWLEEETGNMAREGLRTLVIGRKKL 695
           ++    KGA  ++ +                  + D +EE+  ++A++ LR + +     
Sbjct: 589 KFRLYVKGAAEIVAKACTLKNVCNEGISEIDQKSKDDIEEQIFSLAKDALRAISLAHMDF 648

Query: 696 TKKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIEL 755
              + E   KE  +   S      ++ +    +LE  L L  + G++D L+++VK+S+  
Sbjct: 649 --DVNEWPPKELADPENSHEALAVKLIDPKKPHLE-GLTLDAIVGIQDPLRENVKNSVAQ 705

Query: 756 LRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNA 815
            + AG+ + M+TGD + TA+ ++ +  ++S           SK            +N +A
Sbjct: 706 CQKAGVTVRMVTGDNLLTAKAIARNCGILS-----------SK-----------SLNDSA 743

Query: 816 CLLIDGESLGMFLKYYRQEFFDVVVHLPTV-IACRCTPQQKADVALIIRELTGKRVCCIG 874
           C + +G +        R+        LP + +  R +P+ K  +   ++E+ G+ V   G
Sbjct: 744 CAM-EGPAFRKLSDSERKRI------LPKLRVLARSSPEDKKILVRALKEM-GEVVAVTG 795

Query: 875 DGGNDVSMIQCADVG--VGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKL 932
           DG ND   ++ ADVG  +GI G E  + +         F  +   + W GR       K 
Sbjct: 796 DGTNDAPALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKW-GRCVAASIKKF 854

Query: 933 AQFVMHRGLIIAICQAVFSVCS 954
            QF +   +   +   V SV S
Sbjct: 855 IQFQLIVNVTAVLLTFVTSVIS 876

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 184/787 (23%), Positives = 311/787 (39%), Gaps = 150/787 (19%)

Query: 193 NLYFLLVALSQAIP-ALR---IGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRESNME 248
           N   +++ +S AI  A+R    G + S+V+ +  ++ +    +A+  +   +     N  
Sbjct: 72  NAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAH 131

Query: 249 LYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQ--LDGETD 306
           +    G+   + SKD+  GD+  +  G  +PADL L+++          TD+  L GE+ 
Sbjct: 132 VIRN-GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKN------FDTDESLLTGESL 184

Query: 307 WKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANT 366
              + A  +     E  + +++ +  S+         G V     N+    I  +L  ++
Sbjct: 185 PVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDS 244

Query: 367 VLASSGFCIGCVIYTGRDTRQA--MNT--TSAKVKTGLLELEIN-DISKILCACVFILSI 421
            L S            RD  ++   NT  ++ KV    L   +   + + L     +L  
Sbjct: 245 GLIS------------RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFW 292

Query: 422 LLVVFAGLHNDDWYVDIMRYLILFS-----TIIPVSLRVNLDLAKSVYAHQIEHDKTIPE 476
           + V+FA +       D+ + + +++     ++IP SL V L +  SV A  +     I  
Sbjct: 293 IAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVI-- 350

Query: 477 TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHL-------------------GNV 517
             VR     E LG +  + SDKTGTLTQ  M  +++ +                   GNV
Sbjct: 351 --VRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNV 408

Query: 518 SYTTETADIVSDYIQGMIESKNDSVTNLGPRSTTRKDAATHV-IDLITTL---AICHNVT 573
           S         S Y     E  +  +          KD    + +DL       A   N+ 
Sbjct: 409 SLIPR----FSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIA 464

Query: 574 PTFEDDELTYQAA--SPDEIAIVKFTESVGL------------SLFKRDRHSMSLLHEHS 619
             F+DD      A   P EIAI  F   + L               + D+ S+S  +E  
Sbjct: 465 TVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKP 524

Query: 620 GTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGA--------------DTVMNR 665
           G+   ++ +  FPF+S  KRM  + Y+   + Y    KGA              D V   
Sbjct: 525 GS-AQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKIT 583

Query: 666 IVANND--WLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMAN 723
            + + D   + +   +++ EGLR L    K  TK          ++V+      + ++ N
Sbjct: 584 PLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTK----------DQVN------DDQLKN 627

Query: 724 TISKYL--EHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISA 781
             S     E DL  LGL G+ D  + +   +++    AGI + MLTGD V TA+ ++   
Sbjct: 628 ITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEV 687

Query: 782 KLISRGQYVH---VVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDV 838
            ++    Y +   +V  +      F+ L                          +E  D 
Sbjct: 688 GILPTNLYHYSQEIVDSMVMTGSQFDGLS-------------------------EEEVDD 722

Query: 839 VVHLPTVIACRCTPQQKADVALIIRELTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGK 895
           +  LP VIA RC+PQ K  V +I      K+ C + GDG ND   ++ A+VG+  GI G 
Sbjct: 723 LPVLPLVIA-RCSPQTK--VRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGS 779

Query: 896 E-GKQAS 901
           +  K+AS
Sbjct: 780 DVSKEAS 786

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 184/787 (23%), Positives = 311/787 (39%), Gaps = 150/787 (19%)

Query: 193 NLYFLLVALSQAIP-ALR---IGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRESNME 248
           N   +++ +S AI  A+R    G + S+V+ +  ++ +    +A+  +   +     N  
Sbjct: 72  NAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAH 131

Query: 249 LYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQ--LDGETD 306
           +    G+   + SKD+  GD+  +  G  +PADL L+++          TD+  L GE+ 
Sbjct: 132 VIRN-GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKN------FDTDESLLTGESL 184

Query: 307 WKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANT 366
              + A  +     E  + +++ +  S+         G V     N+    I  +L  ++
Sbjct: 185 PVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDS 244

Query: 367 VLASSGFCIGCVIYTGRDTRQA--MNT--TSAKVKTGLLELEIN-DISKILCACVFILSI 421
            L S            RD  ++   NT  ++ KV    L   +   + + L     +L  
Sbjct: 245 GLIS------------RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFW 292

Query: 422 LLVVFAGLHNDDWYVDIMRYLILFS-----TIIPVSLRVNLDLAKSVYAHQIEHDKTIPE 476
           + V+FA +       D+ + + +++     ++IP SL V L +  SV A  +     I  
Sbjct: 293 IAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVI-- 350

Query: 477 TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHL-------------------GNV 517
             VR     E LG +  + SDKTGTLTQ  M  +++ +                   GNV
Sbjct: 351 --VRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNV 408

Query: 518 SYTTETADIVSDYIQGMIESKNDSVTNLGPRSTTRKDAATHV-IDLITTL---AICHNVT 573
           S         S Y     E  +  +          KD    + +DL       A   N+ 
Sbjct: 409 SLIPR----FSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIA 464

Query: 574 PTFEDDELTYQAA--SPDEIAIVKFTESVGL------------SLFKRDRHSMSLLHEHS 619
             F+DD      A   P EIAI  F   + L               + D+ S+S  +E  
Sbjct: 465 TVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKP 524

Query: 620 GTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGA--------------DTVMNR 665
           G+   ++ +  FPF+S  KRM  + Y+   + Y    KGA              D V   
Sbjct: 525 GS-AQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKIT 583

Query: 666 IVANND--WLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMAN 723
            + + D   + +   +++ EGLR L    K  TK          ++V+      + ++ N
Sbjct: 584 PLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTK----------DQVN------DDQLKN 627

Query: 724 TISKYL--EHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISA 781
             S     E DL  LGL G+ D  + +   +++    AGI + MLTGD V TA+ ++   
Sbjct: 628 ITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEV 687

Query: 782 KLISRGQYVH---VVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDV 838
            ++    Y +   +V  +      F+ L                          +E  D 
Sbjct: 688 GILPTNLYHYSQEIVDSMVMTGSQFDGLS-------------------------EEEVDD 722

Query: 839 VVHLPTVIACRCTPQQKADVALIIRELTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGK 895
           +  LP VIA RC+PQ K  V +I      K+ C + GDG ND   ++ A+VG+  GI G 
Sbjct: 723 LPVLPLVIA-RCSPQTK--VRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGS 779

Query: 896 E-GKQAS 901
           +  K+AS
Sbjct: 780 DVSKEAS 786

>Scas_665.30
          Length = 1439

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 130/536 (24%), Positives = 217/536 (40%), Gaps = 109/536 (20%)

Query: 438 IMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSD 497
           I+R L + + ++P +L   L +       +++       +  R +      G+I+ L  D
Sbjct: 502 ILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNI----GGKIDILCFD 557

Query: 498 KTGTLTQNDMQLKKVHLGNVSY--TTETADIVSDYIQGMIE-SKNDSVTNLGPRSTTRKD 554
           KTGTLT+N + +  V L   S   + + AD+V D  +   + S ND  +   PR    K+
Sbjct: 558 KTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSS---PRDYRAKN 614

Query: 555 AATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT---------ESVGLSLF 605
                     +L  CH++     D+EL      P +  + +FT         E    S +
Sbjct: 615 -------FFISLLTCHSLRVV--DNELI---GDPLDFKMFQFTKWSYEEDFQEKEFHSTY 662

Query: 606 KRDRHSMSL----------LHEHSG----TILNYD------VLTMFPFNSDTKRMGIIVY 645
           +  RH  +L          +H +S     T ++ D      ++  F F S+ +RM +IV 
Sbjct: 663 EERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVK 722

Query: 646 DKQKDQYWFLQKGADTVMNRIV------ANNDWLEEETGNMAREGLRTLVIGRKKLTKK- 698
              +D YW   KGA  V+ +I       AN    EE       +G R +    + L +  
Sbjct: 723 PSNEDVYWAFTKGAPEVITQICNKATLPAN---FEEMLNYYTHKGYRVIACAGRVLPRNT 779

Query: 699 -IYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLR 757
            +Y Q K   EEV                   E ++E LG    E+KL+K+   +++ L+
Sbjct: 780 WLYSQ-KVSREEV-------------------ESNMEFLGFIIFENKLKKETAKTLQTLQ 819

Query: 758 NAGIKIWMLTGDKVETARCVSISAKLI--------------SRGQYVHVVTKLSKPEGAF 803
            A I+  M TGD V TA  V     LI              S GQ   +   +   +   
Sbjct: 820 EASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTL 879

Query: 804 NQLEYLKVNKNAC----LLIDGESLGMFL----KYYRQEFFDVVVHLPTVIACRCTPQQK 855
           +    L +N ++     L I G+   +          +++ + V+ L   I  R +P +K
Sbjct: 880 DSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVL-LKGTIYARMSPDEK 938

Query: 856 ADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF 911
            ++   ++ L      C GDG ND   ++ ADVG+ +   E   AS+AA F+   F
Sbjct: 939 HELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTSQVF 990

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 173/722 (23%), Positives = 283/722 (39%), Gaps = 145/722 (20%)

Query: 254 GRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQ--LDGETDWKLRI 311
           G+   + SKD+  GD+  +  G  +PADL L+++          TD+  L GE+    + 
Sbjct: 136 GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKN------FDTDESLLTGESLPVSKD 189

Query: 312 ACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASS 371
           A  +     E  + +++ +  S+         G V     N+    I  +L  ++ L S 
Sbjct: 190 ANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLIS- 248

Query: 372 GFCIGCVIYTGRDTRQA--MNT--TSAKVKTGLLELEIN-DISKILCACVFILSILLVVF 426
                      RD  ++   NT  ++ KV    L   +   + + L     +L  + V+F
Sbjct: 249 -----------RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLF 297

Query: 427 AGLHNDDWYVDIMRYLILFS-----TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRT 481
           A +       D+ + + +++     ++IP SL V L +  SV A  +     I    VR 
Sbjct: 298 AIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVI----VRK 353

Query: 482 STIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHL-------------------GNVSYTTE 522
               E LG +  + SDKTGTLTQ  M  +++ +                   GNVS    
Sbjct: 354 LDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPR 413

Query: 523 TADIVSDYIQGMIESKNDSVTNLGPRSTTRKDAATHV-IDLITTL---AICHNVTPTFED 578
                S Y     E  +  +          KD    + +DL       A   N+   F+D
Sbjct: 414 ----FSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKD 469

Query: 579 DELTYQAA--SPDEIAIVKFTESVGL------------SLFKRDRHSMSLLHEHSGTILN 624
           D      A   P EIAI  F   + L               + D+ S+S  +E  G+   
Sbjct: 470 DATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGS-AQ 528

Query: 625 YDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGA--------------DTVMNRIVANN 670
           ++ +  FPF+S  KRM  + Y+   + Y    KGA              D V    + + 
Sbjct: 529 FEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDC 588

Query: 671 D--WLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISKY 728
           D   + +   +++ EGLR L    K  TK          ++V+      + ++ N  S  
Sbjct: 589 DVETIRKNVYSLSNEGLRVLGFASKSFTK----------DQVN------DDQLKNITSNR 632

Query: 729 L--EHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISR 786
              E DL  LGL G+ D  + +   +++    AGI + MLTGD V TA+ ++    ++  
Sbjct: 633 ATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT 692

Query: 787 GQYVH---VVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLP 843
             Y +   +V  +      F+ L                          +E  D +  LP
Sbjct: 693 NLYHYSQEIVDSMVMTGSQFDGLS-------------------------EEEVDDLPVLP 727

Query: 844 TVIACRCTPQQKADVALIIRELTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQ 899
            VIA RC+PQ K  V +I      K+ C + GDG ND   ++ A+VG+  GI G +  K+
Sbjct: 728 LVIA-RCSPQTK--VRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKE 784

Query: 900 AS 901
           AS
Sbjct: 785 AS 786

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 165/706 (23%), Positives = 281/706 (39%), Gaps = 122/706 (17%)

Query: 259  VASKDLKVGDLIKISKGARV--PADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLT 316
            V S DL  GDL +IS  + V  P D +L+     SG+  +    L GE+    + A T  
Sbjct: 551  VNSSDLVPGDLFEISDPSLVVLPCDAVLI-----SGDCIVNESMLTGESVPVSKYAAT-- 603

Query: 317  QNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIG 376
                E  + + +    S+    + SF+ + ++    T  + + N           G  + 
Sbjct: 604  ----EATMAQLLQDFKSS---QVSSFVSK-SFLFNGTKIIRVRNQ-------PGQGMALA 648

Query: 377  CVIYTGRDTRQAMNTTS----AKVKTGLLELEINDISKILCACVFILSILLVVFAGLHND 432
             VI TG  T +     S      V     E     I  +    +F  SI  + F  L   
Sbjct: 649  LVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRL-GL 707

Query: 433  DWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIE 492
            ++ V I+R L + + ++P +L   L +  S    +++       +  R +      G+++
Sbjct: 708  EYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNV----GGKVD 763

Query: 493  YLLSDKTGTLTQNDMQLKKVHLG---NVSYTTETADIVSDYIQGMIESKNDSVTNLGPRS 549
             +  DKTGTLT+  + +  +H       S   + +D+++D          D V      S
Sbjct: 764  MMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDC---------DEVLQKHTLS 814

Query: 550  TTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESV---GLSLFK 606
                       + + +L  CH++     D EL      P ++ + +FT+     G   +K
Sbjct: 815  DCNSAEEFKAKNFLVSLLTCHSLKHI--DGELL---GDPLDLKMFEFTKWAYEEGYESWK 869

Query: 607  ----RDRHSMSLLHEHSGTILNY---------DVLTMFPFNSDTKRMGIIVYDKQKDQYW 653
                 D+  +S    H  +  N+          V+  F F S+ +RM +IV   +++ YW
Sbjct: 870  FKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYW 929

Query: 654  FLQKGADTVM----NRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKK--IYEQFKKEY 707
               KGA  V+    N      D+  E   +    G R +    K L K   +Y Q K   
Sbjct: 930  SFTKGAPEVIADICNPATIPKDF-HELLHHYTHNGFRIIACAGKTLPKSSWLYSQ-KVSR 987

Query: 708  EEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 767
            EEV                   E +LE LG    E+KL+   K++++ L+NA I+  M T
Sbjct: 988  EEV-------------------EDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCT 1028

Query: 768  GDKVETARCVSISAKLISRGQYV------------HVVT-KLSKPEGAFNQLEYLK---- 810
            GD V TA  V   + LIS  +              H+++ +    EG+      LK    
Sbjct: 1029 GDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLND 1088

Query: 811  VNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTV-----IACRCTPQQKADVALIIREL 865
              K+  L I G+   +F   +R +      ++ TV     I  R +P +K ++   +++L
Sbjct: 1089 PEKSYTLAITGD---IFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKL 1145

Query: 866  TGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF 911
                  C GDG ND   ++ A++G+ +   E   AS+AA F+   F
Sbjct: 1146 DYNVGFC-GDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVF 1187

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 181/765 (23%), Positives = 294/765 (38%), Gaps = 142/765 (18%)

Query: 263 DLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNED 322
           DL VGD+I +  G  VPAD +L+     SG        L GE+D   ++A          
Sbjct: 256 DLLVGDVISLQTGDVVPADAVLI-----SGSCECDESALTGESDTIKKVALKPA------ 304

Query: 323 DLLEKIT-ITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYT 381
             LEK   I    P   I S          +  G  + + L  +     SG     +   
Sbjct: 305 --LEKYKQIFEKDPTIDIGS----------HGVGEKVPDPLLISGSKLLSGIGNAVITSV 352

Query: 382 GRDT---RQAMNTTSAKVKTGLLELEIN---DISKILCACVFILSILLVV--FAGLHNDD 433
           G ++   R  M   +    T L E   N   +IS   C    +L I+L +     L N  
Sbjct: 353 GENSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMAALVLFIILFIRFLTYLPNGK 412

Query: 434 WYVDI------MRYLILFSTII-------PVSLRVNLDLAKSVYAHQIEHDKTIPETIVR 480
            Y D+       +++ +F T +       P  L + + LA +    ++  D  +    VR
Sbjct: 413 KYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNL----VR 468

Query: 481 TSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTET----------------- 523
                E +G    + SDKTGTLT+N M + K   GN+ +   T                 
Sbjct: 469 VLRACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAENKEIKSAVVLRSNC 528

Query: 524 -ADIVSDYIQGM------IESK----NDSVTNLGPRSTTRKDAATHVIDLITTLAICHNV 572
            A +++D +  +       E+K     D   +  P   +RK       +  T+  I   +
Sbjct: 529 DASLLTDILSNISLNSTAFENKESQHKDKDVDENPYHKSRKSLFPWSRNNRTSQLIADAM 588

Query: 573 TPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFP 632
               E+DE      S  E A++ F +    SL  +D H +       G      V+ + P
Sbjct: 589 K---ENDEQFL--GSKTETALLAFAQK---SLGMKDVHKLRTKPSDLGI---DKVVQVIP 637

Query: 633 FNSDTKRMGIIVYDKQKDQYWFLQKGADTVM-----------NRIVANNDWLEEET---- 677
           F S  K   I V       Y F  KGA  ++           N IV  N  L +E+    
Sbjct: 638 FESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDLYDESFKKI 697

Query: 678 GNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSAS---MYNREQEMANTISKYLEHDLE 734
            +MA   LRT+ +  +   +   ++F    +   AS   +   E +  N  S+ +  D  
Sbjct: 698 QDMASHALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDHKNLSSEGMTLD-- 755

Query: 735 LLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHVVT 794
              + G++D L++ VK S+E  + AG+ + M+TGD + TAR +S +  ++S   Y     
Sbjct: 756 --AMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGY----- 808

Query: 795 KLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQ 854
             + PE A                ++G +   F K   ++   V+  L   +  R +P+ 
Sbjct: 809 --NDPECA----------------MEGPT---FRKLPYKKMLRVIPKL--RVLARSSPED 845

Query: 855 KADVALIIRELTGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQASLAADFSITQFC 912
           K  +   ++++ G+ V   GDG ND   ++ ADVG  +GI G E  + +         F 
Sbjct: 846 KRILVETLKKM-GEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFT 904

Query: 913 HLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFE 957
            +   + W GR       K  QF +   +   I   V +V S  E
Sbjct: 905 AIVNAIKW-GRCVSVSIKKFIQFQLTVNITAVILTFVSAVASAEE 948

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 182/772 (23%), Positives = 292/772 (37%), Gaps = 141/772 (18%)

Query: 201 LSQAIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRESNMELYEVLGRPRPVA 260
           +S AI     G +  +V+ +  ++ +    +AS  +   R     N  +    G    V 
Sbjct: 80  ISFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRN-GNSEVVD 138

Query: 261 SKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLN 320
           S D+  GDL+ +  G  +PADL L+              Q + ETD  L    +L  + +
Sbjct: 139 STDVVPGDLVVVKVGDTIPADLRLVS-------------QQNFETDEALLTGESLPVSKD 185

Query: 321 EDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCI-GCVI 379
            +++ +  T         I+      T       G+ I   L  NT +      + G   
Sbjct: 186 ANEIFDDETPVGD----RINLAFSSSTVVKGRAQGIAIKTGL--NTEIGKIAKSLRGGNE 239

Query: 380 YTGRDT-----RQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHNDDW 434
              RD      + A  +T   V   L   +   + + L     +L  + VVFA +     
Sbjct: 240 LISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQ 299

Query: 435 YVDIMRYLILFS-----TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLG 489
             D+ R + +++     ++IP SL V L +  SV A  +     I    +R     E LG
Sbjct: 300 KFDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVI----IRKLDSLEALG 355

Query: 490 RIEYLLSDKTGTLTQNDMQLKKVHL----------GNVSYTTETADIVSDYIQGM--IES 537
            +  + SDKTGTLTQ  M  K++ +           N     E  DI  ++I  +   E 
Sbjct: 356 AVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDI--NFIPNLSPYEY 413

Query: 538 KNDSVTNLGPRSTTRK---------DAATHVIDLITTLAICHNVTPTFEDDELTYQAA-- 586
            ++   ++G     +          +    + D     A   N+   F D E     A  
Sbjct: 414 SHNETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHG 473

Query: 587 SPDEIAIVKFTESVGLS--LFKRDRHSMS--------LLHEHSGTILN--YDVLTMFPFN 634
            P EIAI  F   + L   +   +R  M          L E   T  N  +     FPF+
Sbjct: 474 DPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFD 533

Query: 635 SDTKRMGIIVYDKQKDQYWFLQKGA-DTVMNRIV---------------ANNDWLEEETG 678
           S  KRM  +   +    Y    KGA ++V+N                  A+ D ++E   
Sbjct: 534 STIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIKENID 593

Query: 679 NMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGL 738
           +M+ EGLR L    K   K    +     E++   +  R+         Y E  L  LGL
Sbjct: 594 SMSSEGLRVLAFANKSYPKSDVNE-----EKLQKILKERD---------YAETGLTFLGL 639

Query: 739 TGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVH---VVTK 795
            G+ D  +++   +++    AGI + MLTGD   TA+ ++    ++    Y +   VV  
Sbjct: 640 IGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDI 699

Query: 796 LSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQK 855
           +      F+ L                          ++  D +  LP VIA RC+PQ K
Sbjct: 700 MVMTGKQFDNLS-------------------------EDEIDNLPVLPLVIA-RCSPQTK 733

Query: 856 ADV--ALIIRELTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 901
             +  AL  RE    + C + GDG ND   ++ A+VG+  GI G +  K AS
Sbjct: 734 VRMIEALHRRE----KFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDAS 781

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 124/535 (23%), Positives = 219/535 (40%), Gaps = 109/535 (20%)

Query: 438  IMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSD 497
            I+R L + + ++P +L   L +  +    +++       +  R +      G+I+ +  D
Sbjct: 726  ILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNIS----GKIDVMCFD 781

Query: 498  KTGTLTQNDMQLKKVHLG--NVSYTTETADIVSDYIQGMIE-SKNDSVTNLGPRSTTRKD 554
            KTGTLT++ + +  V +   N     +  +++SD  Q   + S ND  + L  +S     
Sbjct: 782  KTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSR---- 837

Query: 555  AATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTE-SVGLSLFKRDRHSM- 612
                  +   +L  CH++     D  L      P +  + +FT  S      KR  HS+ 
Sbjct: 838  ------NFFMSLLTCHSLRSV--DGNLL---GDPLDFKMFQFTGWSFEEDFQKRAFHSLY 886

Query: 613  -----------------SLLHEHSGTILN----------YDVLTMFPFNSDTKRMGIIVY 645
                             +++H  S    N            V+  F F S+ +RM +IV 
Sbjct: 887  EGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVK 946

Query: 646  DKQKDQYWFLQKGADTVMNRIVANNDW---LEEETGNMAREGLRTLVIGRKKLTKK--IY 700
                D YW   KGA  V++ I   +      EE        G R +    K L K+  +Y
Sbjct: 947  TNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLY 1006

Query: 701  EQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAG 760
             Q K   EEV                   E +LE LG    ++KL+K+   +++ L++A 
Sbjct: 1007 SQ-KVSREEV-------------------ESNLEFLGFIIFQNKLKKETSETLKSLQDAN 1046

Query: 761  IKIWMLTGDKVETARCVSISAKLIS--------------RGQYVHVVTKLSKPEGAFN-- 804
            I+  M TGD + TA  V   A LI                G+ V V   +++P+   +  
Sbjct: 1047 IRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTK 1106

Query: 805  QLEYLKVNKNAC---------LLIDGESLGMFLK---YYRQEFFDVVVHLPTVIACRCTP 852
             L+ +K+  N+          L + G+   +  +      +E+ + ++ L + I  R +P
Sbjct: 1107 TLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEIL-LNSSIYARMSP 1165

Query: 853  QQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 907
             +K ++ + +++L      C GDG ND   ++ ADVG+ +   E   AS+AA F+
Sbjct: 1166 DEKHELMIQLQKLDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFT 1216

>Kwal_47.17547
          Length = 1240

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 170/765 (22%), Positives = 297/765 (38%), Gaps = 126/765 (16%)

Query: 263 DLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNED 322
           D+ VGD++ +  G  VPAD IL++ S    E+      L GE+    + A         D
Sbjct: 203 DILVGDILSLQTGDVVPADCILVKGSCECDES-----ALTGESATIKKAAI--------D 249

Query: 323 DLLEKITITASAPEKSIHSFLGRVTYKDTNTSGL--TIDNTLWANTVLASSGFCIGCVIY 380
              EK     SA + +I          D  T G     D  L + + L S G     V  
Sbjct: 250 VCYEKYK-QLSATDAAI----------DIGTPGAEKVPDPMLISGSKLLS-GLGRAVVTS 297

Query: 381 TGRDTRQAMNTTSAKVKTGLLELE------INDISKILCACVFILSILLVV--FAGLHND 432
            G ++       + KV+     L+       N IS    A   +L  +L +   A L   
Sbjct: 298 VGVNSMHGRTLMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKG 357

Query: 433 DWYVDI---------MRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTST 483
               D+         M   I+  T+I V++   L LA ++              +VR   
Sbjct: 358 GELHDLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLR 417

Query: 484 IPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSY----TTETADIVSDYIQGMI---- 535
             E +G    + SDKTGTLT+N M + K  LG+  +    +   +D  +D    +     
Sbjct: 418 ACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDEAESVGPSDSETDVDLAIANECS 477

Query: 536 -ESKNDSVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTF-------------EDDEL 581
            E K D +TN+   ST  ++      D ++     H    +                 EL
Sbjct: 478 EELKKDVLTNITLNSTAFENKENEE-DKVSNENPFHKPRKSLFPWSRNNKSKKPATAKEL 536

Query: 582 TYQAAS--PDEIAIVKFTESVGLSLFKRDRHSMSLLH--EHSGTILNYDVLTMFPFNSDT 637
              AA+  P E  +   TE+  L+  +++    +L H  +    +    ++ + PF S  
Sbjct: 537 VENAAADQPKEPFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLGIEKIVQIIPFESSR 596

Query: 638 KRMGIIVYDKQKDQYWFLQKGADTVMNR------------IVANNDWLEEETG--NMARE 683
           K  GI+V  K     ++++  A+ ++ R            +++  D+ EE     N+A E
Sbjct: 597 KWGGIVVKYKNGLHRFYIKGAAELLLRRCMQKRASDSKLTLISQKDFDEESQTITNLAAE 656

Query: 684 GLRTLVIGRK---KLTKKIYEQFKKEYEEVSAS---MYNREQEMANTIS---KYLEHDLE 734
            LR + +  +           + + E E  +AS   ++  E   ++++S   + L   + 
Sbjct: 657 ALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQELVSPMV 716

Query: 735 LLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHVVT 794
           L G+ G++D L+K V+ S+E  + AG+ + M+TGD + TA  ++    ++S  Q  +  +
Sbjct: 717 LDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQAENPES 776

Query: 795 KLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQ 854
            +  P                           F K   +E   ++ +L   +  R +P+ 
Sbjct: 777 SMEGPR--------------------------FRKLSNKERVRILPNL--RVLARSSPED 808

Query: 855 KADVALIIRELTGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQASLAADFSITQFC 912
           K  +   ++++ G  V   GDG ND   ++ ADVG  +GI G E  + +         F 
Sbjct: 809 KRILVETLKKM-GDVVAVTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILMTDDFS 867

Query: 913 HLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFE 957
            +   + W GR       K  QF +   +   +   V +V S  E
Sbjct: 868 AIVNAIKW-GRCVSTSIKKFIQFQLTVNVTAVVLTFVSAVASSEE 911

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 165/742 (22%), Positives = 294/742 (39%), Gaps = 142/742 (19%)

Query: 189 KFFFNLY---FLLVALSQAIPALRIGYLS---SYVVPLAFVLTVTMAKEASDDIQRRRRD 242
           KF  N      +L+ +  AI ++ +G +    S  + +  V+TV   +E   +      +
Sbjct: 95  KFLSNFVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALN 154

Query: 243 RESNMELYEVLG-RPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQL 301
           +    E + + G R   V + +L  GDL++   G R+PAD+ +++ ++ +    I    L
Sbjct: 155 KLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLT----IDESNL 210

Query: 302 DGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTI--- 358
            GETD                            P    +  L R +Y D   S + +   
Sbjct: 211 TGETD----------------------------PVHKSYKALSRDSYNDQPNSIVPVAER 242

Query: 359 DNTLWANTVLASSGFCIGCVIYTGRDTRQA----MNTTSAKVKTGLLELEINDISKILCA 414
            N  +  T L   G   G V+ TGR+T       M ++  K KT  L+L ++ + K L  
Sbjct: 243 TNIAYMGT-LVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTP-LQLTMDKLGKDLSL 300

Query: 415 CVFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTI 474
             F++  ++ V   +    W       + L    IP  L + + +  ++   ++   K  
Sbjct: 301 ASFVVIGIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK-- 358

Query: 475 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKV-HLGNVSYTTETADIVSDYIQG 533
              IVR     E LG +  + SDKTGTLT N M + K+  LG+++            +  
Sbjct: 359 --AIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLN--------VLS 408

Query: 534 MIESKNDSVTNLGPRSTTRKDAATHVIDLITTLAICHNV--TPTFEDDELTYQAASPDEI 591
           + ++K  ++ N             ++ D + T  +C N+    ++  +   Y   +P ++
Sbjct: 409 LDKNKGGNLKN-------------YLTDDVKTTLLCGNLCNNASYSQEHAKY-LGNPTDV 454

Query: 592 AIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQ 651
           A+++  +   L+  + +                Y  +    FNS  K M   + D +K  
Sbjct: 455 ALLEQLQKFELADVRSE----------------YTKVKELSFNSKRKMMATKIQDNEKKT 498

Query: 652 YWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVS 711
             F+ KGA     RI+  +     E G + +     L  G ++           E   V 
Sbjct: 499 TLFI-KGA---FERILDKSSSYLTEKGKIEK-----LTAGHRETIIDCANTLASEGLRVL 549

Query: 712 ASMYNREQEMANTISKYLEHDLELL---GLTGVEDKLQKDVKSSIELLRNAGIKIWMLTG 768
           A     ++ M ++ SK +E D+  L   GL G+ D  +  VK +I+     GI I M+TG
Sbjct: 550 AFA---KRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITG 606

Query: 769 DKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFL 828
           D   TA               V++  ++  P           V      ++ G+ L    
Sbjct: 607 DSENTA---------------VNIARQIGIP-----------VIDPKLSVLSGDKLN--- 637

Query: 829 KYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADV 888
           +    +  +V+ H+   I  R TP+ K ++   +R   G  V   GDG ND   ++ AD+
Sbjct: 638 EMTDDQLANVIDHVN--IFARATPEHKLNIVRALRR-RGDVVAMTGDGVNDAPALKLADI 694

Query: 889 GVGIVGKEGKQ-ASLAADFSIT 909
           GV + G+ G   A  A+D  +T
Sbjct: 695 GVSM-GRMGTDVAKEASDMILT 715

>Kwal_26.9207
          Length = 1469

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 133/606 (21%), Positives = 242/606 (39%), Gaps = 121/606 (19%)

Query: 434  WYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDK--TIPETIVRTSTIPEDLGRI 491
            + V I+R L + + ++P +L   L +  S    +++      I  T V  S      G+I
Sbjct: 728  YKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVS------GKI 781

Query: 492  EYLLSDKTGTLTQNDMQLKKVHLGNV-SYTTETADIVSDYIQGMIE--SKNDSVTNLGPR 548
            + +  DKTGTLT++ + +  VH+     +       +   ++G+    S ND  + +  +
Sbjct: 782  DVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCGSPIDFK 841

Query: 549  STTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT--------ESV 600
            S           + + +L  CH++     D EL      P +  + +FT        +  
Sbjct: 842  SR----------NFLVSLLTCHSLRVV--DGELL---GDPLDFKMFQFTNWSYAEDFQDF 886

Query: 601  GLSLFKRDRHSMSLLHEHSG---TILNYD------------------VLTMFPFNSDTKR 639
                   +R++ S L E++G    +++ +                  V+  F F S+ +R
Sbjct: 887  KFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRR 946

Query: 640  MGIIVYDKQKDQYWFLQKGADTVMNRIVANNDW---LEEETGNMAREGLRTLVIGRKKLT 696
            M +IV    ++ +W   KGA  V++ I   +      E+        G R +    K L 
Sbjct: 947  MSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLP 1006

Query: 697  KKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELL 756
            K+ +   +K          +RE+         +E ++E LG    E+KL+     ++  L
Sbjct: 1007 KRTWRFAQK---------VSREE---------VESNMEFLGFVVFENKLKPSTTPTLASL 1048

Query: 757  RNAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHVVTKLSKP---------------- 799
            ++AGI+  M TGD V TA  V   + LI+    +V  +     P                
Sbjct: 1049 QDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLI 1108

Query: 800  -EGAFNQLEYLKVNKNACLLIDGESLGMFLKYYR--QEFFDVVVHLPTVIACRCTPQQKA 856
             +G    LE +  + +  + + G+   +  K      E +  +V L + I  R +P +K 
Sbjct: 1109 LDGV--TLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKH 1166

Query: 857  DVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---CH 913
            ++   ++ L      C GDG ND   ++ ADVGV +   E   AS+AA F+ + F   C 
Sbjct: 1167 ELVGQLQGLDYVVGFC-GDGANDCGALKAADVGVSLSEAE---ASVAAPFTSSVFEISCI 1222

Query: 914  LTELLLWHGRNSYKRSAKLAQF--------------VMHRGLIIAICQAVFSVCSQFEPI 959
            L   ++  GR S   S    Q+              +  RG+ +   Q ++       PI
Sbjct: 1223 LD--VIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLFLIVPI 1280

Query: 960  ALYQGW 965
            A++  W
Sbjct: 1281 AIFMSW 1286

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 131/492 (26%), Positives = 205/492 (41%), Gaps = 76/492 (15%)

Query: 447 TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 506
           ++IP SL V L +  S  A  +         I+R     E LG +  + SDKTGTLTQ  
Sbjct: 323 SMIPSSLVVVLTITMSAGAKVM----ATRHVIIRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 507 MQLKKVHLG-----NVSYTTETADIVSDYIQ-----GMIESKNDSVTNLGPRSTTR-KDA 555
           M  K+V +      NV  + E  +     IQ        + K+D   ++G  +  + K  
Sbjct: 379 MIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEEDVGMITDFKSKYY 438

Query: 556 ATHVIDLITTL-------AICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGLS--- 603
           A  +  L  +L       A   N+   F D E     A   P EIAI  F   + L    
Sbjct: 439 ADELGPLNVSLFTQWLYTATLANIATVFRDPETQDWKAHGDPTEIAIQVFATRMDLPRRV 498

Query: 604 LFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGII---VYDKQKDQYWFLQKGAD 660
           L   D      +H      + ++ +  +PF+S  KRM  I   V + +   Y    KGA 
Sbjct: 499 LTGEDNDDEKNIHND----ITFEHVAEYPFDSSVKRMSAIYKNVEEPKAPIYEVFTKGA- 553

Query: 661 TVMNRIV-ANNDWLEEETGN---MAREGLRTLVIGRKKLTK---KIYEQFKKEYEEVSAS 713
               R++   N W     G+   +  E L T+      L+    ++    KK + E S  
Sbjct: 554 --FERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKKTFNE-SQF 610

Query: 714 MYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET 773
             N+++ +      ++E++L  LGL G+ D  +++  ++++    AGI + MLTGD   T
Sbjct: 611 TINKDKLLKE--RDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGT 668

Query: 774 ARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQ 833
           A+ ++    ++    Y +       P+   N +     + +A  L D E           
Sbjct: 669 AKSIAQEVGILPHNLYHY-------PKEVVNFMVMTATDFDA--LSDKE----------- 708

Query: 834 EFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCI-GDGGNDVSMIQCADVGV-- 890
              D +  LP VIA RC PQ K  V +I       R C + GDG ND   ++ A+VG+  
Sbjct: 709 --IDELPVLPLVIA-RCAPQTK--VRMIEALHRRNRFCAMTGDGVNDSPSLKIANVGIAM 763

Query: 891 GIVGKE-GKQAS 901
           GI G +  K AS
Sbjct: 764 GINGSDVAKDAS 775

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 163/748 (21%), Positives = 296/748 (39%), Gaps = 139/748 (18%)

Query: 184 LYEQF-KFFFNLYFLLVALSQAIPALRIGYLS---SYVVPLAFVLTVTMAKEASDDIQRR 239
           L+++F   F     +L+ +  A+ +L +G +    S  + +  V+TV   +E   +    
Sbjct: 84  LFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLE 143

Query: 240 RRDRESNMELYEV-LGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKT 298
             ++    E + +  G+   V +  L  GDL+    G R+PAD+ ++++ + S    I  
Sbjct: 144 ALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLS----IDE 199

Query: 299 DQLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTI 358
             L GE +   + + T+ ++   D     + I+    E+S  +++G              
Sbjct: 200 SNLTGENEPVHKTSQTIEKSSFNDQPNSIVPIS----ERSCIAYMG-------------- 241

Query: 359 DNTLWANTVLASSGFCIGCVIYTGRDTR-----QAMNTTSAKVKTGLLELEINDISKILC 413
                    L   G   G V+ TG +T      + MN    K KT L +L ++ + K L 
Sbjct: 242 --------TLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIE-KPKTPL-QLTMDKLGKDLS 291

Query: 414 ACVFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKT 473
              FI+  ++ +   +    W       + L    IP  L + + +  ++   ++   K 
Sbjct: 292 LVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKA 351

Query: 474 IPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQG 533
           I    VR     E LG +  + SDKTGTLT N M + K+            D +S+ +  
Sbjct: 352 I----VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLW---------CLDSMSNKLNV 398

Query: 534 MIESKNDSVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAI 593
           +   KN    N       +      V + +T   +C+N +  F  +   +   +P ++A+
Sbjct: 399 LSLDKNKKTKN--SNGNLKNYLTEDVRETLTIGNLCNNAS--FSQEHAIF-LGNPTDVAL 453

Query: 594 VKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYW 653
           +   E +        R+++  + E              PFNS  K M   + +   ++  
Sbjct: 454 L---EQLANFEMPDIRNTVQKVQE-------------LPFNSKRKLMATKILNPVDNKCT 497

Query: 654 FLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSAS 713
              KGA     RI      LE  T  +  +G         K T+K+ E  K    E + S
Sbjct: 498 VYVKGA---FERI------LEYSTSYLKSKG---------KKTEKLTEAQKATINECANS 539

Query: 714 MYNRE-----------QEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIK 762
           M +              + +  +++ L  DL   GL G+ D  + +VK +IE L   G+ 
Sbjct: 540 MASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVH 599

Query: 763 IWMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGE 822
           I M+TGD   TA               V++  ++  P           V      ++ G+
Sbjct: 600 IIMITGDSENTA---------------VNIAKQIGIP-----------VIDPKLSVLSGD 633

Query: 823 SLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSM 882
            L    +    +  +V+ H+   I  R TP+ K ++   +R+  G  V   GDG ND   
Sbjct: 634 KLD---EMSDDQLANVIDHVN--IFARATPEHKLNIVRALRK-RGDVVAMTGDGVNDAPA 687

Query: 883 IQCADVGVGIVGKEGKQ-ASLAADFSIT 909
           ++ +D+GV + G+ G   A  A+D  +T
Sbjct: 688 LKLSDIGVSM-GRIGTDVAKEASDMVLT 714

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 79.7 bits (195), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 132/493 (26%), Positives = 206/493 (41%), Gaps = 78/493 (15%)

Query: 447 TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 506
           ++IP SL V L +  S  A  +         IVR     E LG +  + SDKTGTLTQ  
Sbjct: 323 SMIPSSLVVVLTITMSAGAKVM----ATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 507 MQLKKVHLGNV-SYTTETADIVSDYIQGMI---------ESKNDSVTNLG--PRSTTRKD 554
           M  K+V +    + T + ++   +   G I         + K+D   ++G  P   ++  
Sbjct: 379 MIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSKYL 438

Query: 555 AA------THVIDLITTLAICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGLS--- 603
           A         + D     A   N+   F+D E     A   P EIAI  F   + L    
Sbjct: 439 AGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLPRHV 498

Query: 604 LFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQ----YWFLQKGA 659
           L   D+        +S    +++ +  FPF+S  KRM  I Y   +D     Y    KGA
Sbjct: 499 LTGEDKDDEKDARANS----SFEHVAEFPFDSSVKRMSAI-YKNTEDPATPIYEVFTKGA 553

Query: 660 DTVMNRIVANND-WLEEETGN---MAREGLRTLVIGRKKLTK---KIYEQFKKEYEEVSA 712
                R++   D W     G    +++E L T+      L+    ++    KK + E   
Sbjct: 554 ---FERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNE--- 607

Query: 713 SMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVE 772
           S +N  ++       ++E  L  LGL G+ D  +++  ++++    AGI + MLTGD   
Sbjct: 608 SEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPG 667

Query: 773 TARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYR 832
           TA+ ++    ++    Y +       P+   N +     + +A  L D            
Sbjct: 668 TAKSIAQEVGILPHNLYHY-------PKEVVNFMVMAATDFDA--LSD------------ 706

Query: 833 QEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCI-GDGGNDVSMIQCADVGV- 890
           QE  D+ V LP VIA RC PQ K  V +I       + C + GDG ND   ++ A+VG+ 
Sbjct: 707 QEIDDLRV-LPLVIA-RCAPQTK--VRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIA 762

Query: 891 -GIVGKE-GKQAS 901
            GI G +  K AS
Sbjct: 763 MGINGSDVAKDAS 775

>Kwal_14.1498
          Length = 939

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 150/668 (22%), Positives = 268/668 (40%), Gaps = 156/668 (23%)

Query: 267 GDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLE 326
           GD+++   G R+PADL ++++ + S    I+   L GE +   +   T+ +   +++L  
Sbjct: 167 GDVVRFRVGDRIPADLRIIEAVDLS----IEESNLTGENEPVHKSTATVNKEFYKENLGS 222

Query: 327 KITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTR 386
            + ++    E+S  +F+G                       L   G   G VI T ++T 
Sbjct: 223 IVPVS----ERSCIAFMG----------------------TLVREGHGRGIVIGTAKNTA 256

Query: 387 -----QAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHNDDWYVDIMRY 441
                + MN    K KT L +  ++ + K L    FI+  ++ +   +    W       
Sbjct: 257 FGKVFEMMNAIE-KPKTPL-QTAMDKLGKDLSFMSFIVIGIICLIGVIQGRSWLEMFQIS 314

Query: 442 LILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGT 501
           + L    IP  L + + +  ++   ++   + I   I R  ++ E LG +  + SDKTGT
Sbjct: 315 VSLAVAAIPEGLPIIVTVTLALGVLRMAKRRAI---IRRLPSV-ETLGSVNVICSDKTGT 370

Query: 502 LTQNDMQLKKV-HLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGPRSTTRKDAATHVI 560
           LT N M + KV  LG++S  +                K D  T+     + +K+    + 
Sbjct: 371 LTANHMSVNKVWCLGSMSNKSNIL-------------KLDKATS----GSFKKNLTEDLR 413

Query: 561 DLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSG 620
             + T  +C+N T + E  +      +P +IA+++     GL   + +R  ++   E S 
Sbjct: 414 ATLRTGNLCNNSTYSHEHAKYL---GNPTDIALLEVLHKFGL---EDERPQVTRSDEIS- 466

Query: 621 TILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGADTVM----------NRIVANN 670
                       FNS  K M + V +        ++   + ++          N++V  +
Sbjct: 467 ------------FNSKRKFMAVKVKEANGKFVVHVKGAYEKILEKSTHFINAENKVVKLD 514

Query: 671 DWLEEETGN----MAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTIS 726
             L +   +    +A +GLRTL                             + E++N  S
Sbjct: 515 SNLRQAITDSADALASDGLRTLAFA--------------------------QLELSNGNS 548

Query: 727 KYLEHD----LELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAK 782
           K L  D    L   GL G+ D  +  VK+++E L    + I M+TGD   TA  VSI+ +
Sbjct: 549 KKLTEDDINGLTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTA--VSIARQ 606

Query: 783 LISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHL 842
           +      + VV     PE A               ++ G+ L         +   ++ H+
Sbjct: 607 I-----GIPVVN----PETA---------------VLTGDKLD---HMSEDQLASIIDHV 639

Query: 843 PTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-AS 901
              I  R TP+ K ++   +++  G  V   GDG ND   ++ AD+GV + GK G   A 
Sbjct: 640 N--IFARATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVSM-GKMGTDVAK 695

Query: 902 LAADFSIT 909
            A+D  +T
Sbjct: 696 EASDMVLT 703

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 168/717 (23%), Positives = 274/717 (38%), Gaps = 154/717 (21%)

Query: 259 VASKDLKVGDLIKISKGARVPADLILLQS-SEPSGEAFIKTDQLDGETDWKLRIACTLTQ 317
           +AS  +  GD++++  G  VPADL L+++ +  + EA +  + L    D     A    Q
Sbjct: 145 MASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKD----PAAVFEQ 200

Query: 318 NLNEDDLL---------EKITITASAPEKSIHSFLGRVT----------YKDTNTSGLTI 358
           +    D L          K   T       + S +G++            +D N SGL  
Sbjct: 201 DTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGL-- 258

Query: 359 DNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFI 418
            NT+   TV AS G  +G  + T       ++   AK+   L  + +     ++    FI
Sbjct: 259 QNTVL--TVKASVGSFLGTNVGT------PLHRKLAKLALILFAIAVLFALIVMATQKFI 310

Query: 419 LSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETI 478
           ++  + ++A              + +  ++IP SL V L +  S  A  +    +    I
Sbjct: 311 VNREVAIYA--------------ICVALSMIPSSLVVVLTITMSAGAKVM----STRNVI 352

Query: 479 VRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK----------VHLGNVSYTTETADIVS 528
           VR     E LG +  + SDKTGTLTQ  M LK+          V+  NV +     D+  
Sbjct: 353 VRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSL 412

Query: 529 DYIQGMIESKNDSVTNLG---------PRSTTRKDAATHVIDLITTLAICHNVTPTFED- 578
                  E ++D   ++G           ++  K       +     A   N+   F+D 
Sbjct: 413 IPRFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDS 472

Query: 579 DELTYQA-ASPDEIAIVKFTESV-----GLSLFKRDRHSMSLLHEHSGTILNYDVLTMFP 632
           D   ++A   P EIAI  F   +      L+  + +  S S     +  I  Y+    FP
Sbjct: 473 DSKEWRAHGDPTEIAIQVFATRMDHPHHALTTEQDEEDSDSSQQNDAARI--YEHAAEFP 530

Query: 633 FNSDTKRMGIIVYDKQKDQ-------------------YWFLQKGADTVMNRIVANNDWL 673
           F+S  KRM   VY   +D+                    W L  G          + + +
Sbjct: 531 FDSSIKRMSA-VYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEII 589

Query: 674 EEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDL 733
           ++    ++ EGLR L    K +  +  E   +   +      +R+         ++E DL
Sbjct: 590 QKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTK------DRD---------FVESDL 634

Query: 734 ELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVH-- 791
              GL G+ D  + +   +++    AGI + MLTGD   TA+ ++    ++    Y +  
Sbjct: 635 IFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPK 694

Query: 792 -VVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTVIACRC 850
            VV  +      F+ L                           E  D +  LP VIA RC
Sbjct: 695 EVVDIMVMTATQFDSLT-------------------------DEELDQLPVLPLVIA-RC 728

Query: 851 TPQQKADV--ALIIRELTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 901
            PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+  GI G +  K AS
Sbjct: 729 APQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDAS 781

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 157/679 (23%), Positives = 262/679 (38%), Gaps = 153/679 (22%)

Query: 254 GRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIAC 313
           G+   V + +L  GDL++   G R+PADL +++S +                       C
Sbjct: 154 GQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESID----------------------LC 191

Query: 314 TLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGF 373
               NL  ++     +  A  P+   H     +   D N  G            L   G 
Sbjct: 192 VDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFM--------GTLVREGH 243

Query: 374 CIGCVIYTGRDTRQA----MNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGL 429
             G VI TG+ T       M +   K KT L +  ++ + + L    F+L  ++ +   +
Sbjct: 244 GKGIVIATGKHTVFGSVFEMMSGIDKPKTPL-QTAMDKLGQDLSYMSFVLIGIICLIGII 302

Query: 430 HNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLG 489
               W       + L    IP  L + + +  ++   ++   K I    VR     E LG
Sbjct: 303 QGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI----VRRLPSVETLG 358

Query: 490 RIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGPRS 549
            +  + SDKTGTLT N M + K+                 +  G +E+K    TN    S
Sbjct: 359 SVNVICSDKTGTLTANHMTVSKI-----------------WCLGSMENK----TNCLALS 397

Query: 550 TTRKDAATHVIDLITTLA---ICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFK 606
             ++       D+ TTL    IC+N   T+  + L Y   +P +IAI++  +  G++   
Sbjct: 398 KVKERPIKMEQDVATTLRIGNICNN--GTYSQEHLKY-LGNPTDIAILESLQHFGIN--- 451

Query: 607 RDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGA------- 659
             R+S++ ++E              PFNS  K M +   D   D+     KGA       
Sbjct: 452 DCRNSVNKINE-------------IPFNSKRKFMAVKTIDAN-DKVVVYVKGAFEKIVEK 497

Query: 660 -------DTVMNRIVANNDWLEEETG-NMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVS 711
                  D  ++++  N+  +  +    +A EGLRTL                    EVS
Sbjct: 498 SINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAEL---------------EVS 542

Query: 712 ASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKV 771
           A+  ++E       ++ +   L   GL  + D  +  V+S+IE L    + + M+TGD  
Sbjct: 543 ATHGDKE------FNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAE 596

Query: 772 ETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYY 831
            TA  VSI+                        Q+    +N    +L  G+ L    +  
Sbjct: 597 NTA--VSIA-----------------------RQIGIPVINPEYSVL-SGDKLD---QMT 627

Query: 832 RQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVG 891
             +   V+ H+   +  R TP+ K ++   +++  G  V   GDG ND   ++ AD+GV 
Sbjct: 628 DDQLASVIDHVN--VFARATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVS 684

Query: 892 IVGKEGKQ-ASLAADFSIT 909
           + GK G   A  A+D  +T
Sbjct: 685 M-GKMGTDVAKEASDMVLT 702

>Scas_707.48*
          Length = 741

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 152/676 (22%), Positives = 259/676 (38%), Gaps = 147/676 (21%)

Query: 254 GRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIAC 313
           G+   V +  L  GDL+    G R+PADL ++++ + S    I    L GE +   + A 
Sbjct: 159 GQESHVLASGLVPGDLVHFKIGDRIPADLRIIEAVDLS----IDESNLTGENEPVHKSA- 213

Query: 314 TLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGF 373
              + +N+D   ++        +++  +++G                       L   G 
Sbjct: 214 ---KEVNKDSFNDQPNSIIPISDRTCVAYMG----------------------TLVKEGH 248

Query: 374 CIGCVIYTGRDTRQA----MNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGL 429
             G V+  G++T       M +   K KT L +  ++ + K L    FI+  L+ +   L
Sbjct: 249 GKGIVVGIGKNTSFGAIFEMLSNIEKPKTPL-QNAMDKLGKDLSLFSFIVIGLICLVGIL 307

Query: 430 HNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLG 489
               W       + L    IP  L + + +  ++   ++   K I    VR     E LG
Sbjct: 308 QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI----VRRLPSVETLG 363

Query: 490 RIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGPRS 549
            +  + SDKTGTLT N M   K+    +      A+++S     + +SK+ S+ N     
Sbjct: 364 SVNVICSDKTGTLTSNHMTASKIWC--LDSMANKANVLS-----LEKSKSGSLKNY---- 412

Query: 550 TTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDR 609
                    V   +T   IC+N +  F  +   Y   +P +IA+++      LS     R
Sbjct: 413 -----LTEDVKSTLTIGNICNNAS--FSQEHGKY-LGNPTDIALLEQLSKFDLSDI---R 461

Query: 610 HSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGA-DTVMNRIV- 667
            +   + E              PFNS  K M + + + +  +Y    KGA + V+++   
Sbjct: 462 PTFKKVQE-------------IPFNSKRKFMAVKIVNSE-GKYSLCVKGAFEKVLSQCSH 507

Query: 668 -------------ANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASM 714
                           D + E   ++A EGLR L   +  L               S ++
Sbjct: 508 YLNQKGKTEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLPD-------------SPTL 554

Query: 715 YNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETA 774
              E             DL   GL G+ D  +  VK +IE L   G+ I M+TGD   TA
Sbjct: 555 LTEESV----------GDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTA 604

Query: 775 RCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQE 834
                          V++  ++  P           V      ++ G+ L    +    +
Sbjct: 605 ---------------VNIARQIGIP-----------VLDPKLSVLSGDKLN---EMSDDQ 635

Query: 835 FFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVG 894
             +V+ H+   I  R TP+ K ++   +R+  G  V   GDG ND   ++ AD+GV + G
Sbjct: 636 LANVIDHVN--IFARATPEHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLADIGVSM-G 691

Query: 895 KEGKQ-ASLAADFSIT 909
           + G   A  A+D  +T
Sbjct: 692 RMGTDVAKEASDMVLT 707

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 165/742 (22%), Positives = 277/742 (37%), Gaps = 180/742 (24%)

Query: 191 FFNLYFLLVALSQAIPALRIGYLSSYV-VPLAFVLTVTMAKEASDDIQRRRRDRESNMEL 249
           F     +L+ +  A+ +  IG +   V + LA ++ VT+       IQ  R   E ++E 
Sbjct: 102 FVEDRLILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGF-----IQEYRS--EKSLEA 154

Query: 250 YEVL----------GRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTD 299
              L          GR     + +L  GDL++   G R+PAD+ ++++ + S    I   
Sbjct: 155 LNKLVPTKCHLIRYGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLS----IDES 210

Query: 300 QLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTID 359
            L GET+   + A T+       D  E         E+S  +++G               
Sbjct: 211 NLTGETEPLHKDAQTI-------DPEEYDNRNVPVSERSCIAYMG--------------- 248

Query: 360 NTLWANTVLASSGFCIGCVIYTGRDTRQA----MNTTSAKVKTGLLELEINDISKILCAC 415
                   L   G   G VI TG +T       M  +  K KT L E  ++ +   L   
Sbjct: 249 -------TLVKEGHGKGIVIGTGTNTSYGAIFEMVNSIEKPKTPLQE-TMDRLGTELSYI 300

Query: 416 VFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIP 475
            F +  ++ +   +  +   +     + L    IP  L + + +  ++   ++    T  
Sbjct: 301 SFFIIAIISIVGIIRGNSLLMMFQVSVSLAVAAIPEGLPIIVTVTLALGVLRM----TKQ 356

Query: 476 ETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMI 535
             IVR     E LG +  + +DKTGTLT N M + K+   + S T E A           
Sbjct: 357 NAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLFCLDSSGTYENA----------- 405

Query: 536 ESKNDSVTNLGPRSTTRKDAATHVIDLITTLA-ICHNVTPTFEDDELTYQAASPDEIAIV 594
                    + P   +  D   + +    T+A IC+N   +   +E      +P ++A++
Sbjct: 406 ---------ISPEEDSEFDVHDNDVKETLTIANICNNAKYS---EEHNLYIGNPTDVALI 453

Query: 595 KFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWF 654
           +     G+   +RD H               + +    FNS  K M  I   K+  ++  
Sbjct: 454 EVLTKFGIP-DQRDSH---------------EKMEELSFNSKRKYMA-IKSSKESGEHVL 496

Query: 655 LQKGADTVMNRIVANNDWLEEETGNM------------------AREGLRTLVIGRKKLT 696
             KGA     RI+  + +  ++ G +                  A +GLRT+    K   
Sbjct: 497 YIKGA---FERILDKSSYYLDKAGEVREFDEHSKVMVLEAAHSCASDGLRTIACAFKP-- 551

Query: 697 KKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELL 756
                                  +  N IS+   + L   GL G+ D  + +VK+SIE L
Sbjct: 552 ----------------------TDSDNVISEDDINGLTFTGLFGLADPPRPNVKASIEKL 589

Query: 757 RNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNAC 816
              G+ I M+TGD V TA  VSI+ K+                         L V     
Sbjct: 590 HRGGVHIIMITGDSVNTA--VSIAEKI------------------------GLSVQDRES 623

Query: 817 LLIDGESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDG 876
            ++ G+ +    +    +  D V      I  R TP+ K ++   +R+  G  V   GDG
Sbjct: 624 SVMTGDKVSELTEDELSKVIDKV-----NIFARATPENKLNIVKALRK-RGDIVAMTGDG 677

Query: 877 GNDVSMIQCADVGV--GIVGKE 896
            ND   ++ AD+G+  GI G +
Sbjct: 678 VNDAPALKLADIGIAMGISGTD 699

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 121/531 (22%), Positives = 211/531 (39%), Gaps = 109/531 (20%)

Query: 438  IMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSD 497
            I+R L + + ++P +L   L +  S   ++++          R +      G+I+ +  D
Sbjct: 714  ILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNI----GGKIDVMCFD 769

Query: 498  KTGTLTQNDMQLKKVHLGNVSYTTETA--DIVSDYIQGMIESKNDSVTNLGPRSTTRKDA 555
            KTGTLT++ + +  V +   +   + +  D++SD      +      +N  P    R++ 
Sbjct: 770  KTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSN--PDDYKRRN- 826

Query: 556  ATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRD--RHSMS 613
                   + +L  CH++     D EL      P +  + +FT   G S ++ D   H   
Sbjct: 827  ------FLISLLTCHSLRVV--DGELL---GDPLDFKMFQFT---GWS-YEEDFQNHQFH 871

Query: 614  LLHE--HSGTIL--NYDVLTM---------------------------FPFNSDTKRMGI 642
             L+E  H G     N D++                             F F S+ +RM +
Sbjct: 872  SLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSV 931

Query: 643  IVYDKQKDQYWFLQKGADTVMNRIVANNDWLEEETGNM----AREGLRTLVIGRKKLTKK 698
            IV    ++ YW   KGA  V+  I  N   L  +  ++       G R +    K L K 
Sbjct: 932  IVKPNNENVYWAYTKGAPEVIIDI-CNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKN 990

Query: 699  --IYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELL 756
              +Y Q K   EEV                   E ++E LG    ++KL+     ++  L
Sbjct: 991  TWLYSQ-KVRREEV-------------------ESNMEFLGFIIFQNKLKDATSPTLSKL 1030

Query: 757  RNAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHVVT-------------KLSKPEGA 802
            + A I+  M TGD V TA  V    +LI+  + YV  V              ++S  E  
Sbjct: 1031 KTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHI 1090

Query: 803  FNQLEYLKVNKNA---CLLIDGESLGMFLK---YYRQEFFDVVVHLPTVIACRCTPQQKA 856
             +      ++  +    L I GE   +       Y +E+ + ++ L   I  R +P +K 
Sbjct: 1091 LDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEIL-LKGSIFARMSPDEKH 1149

Query: 857  DVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 907
            ++   ++++      C GDG ND   ++ ADVG+ +   E   AS+AA F+
Sbjct: 1150 ELVEQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFT 1196

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 144/665 (21%), Positives = 256/665 (38%), Gaps = 143/665 (21%)

Query: 267 GDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLE 326
           GDL+    G R+PAD+ +++S++ S    +    L GET+  +  +CT   +    D+  
Sbjct: 178 GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETE-PVHKSCTPVNSATYSDVPG 232

Query: 327 KITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTR 386
            I       E++  +++G                       L   G   G V+ TG+ T 
Sbjct: 233 GIIPIG---ERTSIAYMG----------------------TLVREGHGKGIVVATGKHTM 267

Query: 387 -----QAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHNDDWYVDIMRY 441
                + MN+   K KT  L++ ++ + + L    F+LS ++ +   +    W       
Sbjct: 268 FGAVFEMMNSIE-KPKTP-LQMAMDTLRRDLSYVRFVLSGIIFLLGVIQGRSWLEMFQIS 325

Query: 442 LILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGT 501
           + L    IP  L + + +  ++   ++ + K     IVR     E LG +  + SDKTGT
Sbjct: 326 VSLAVAAIPEGLPIIVTVTLALGVLRMANRK----AIVRRLPSVETLGSVNVICSDKTGT 381

Query: 502 LTQNDMQLKKV-HLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGPRSTTRKDAATHVI 560
           LT N M   K+  LG+++       + +    G+           G     +   +  V 
Sbjct: 382 LTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLP----------GKLPNLKNYLSDDVK 431

Query: 561 DLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSG 620
             +   +IC+N   +F  +   Y   +P +IA+++  +   L              +   
Sbjct: 432 ATLRIGSICNNA--SFSHEHGKY-LGNPTDIALLEVLQKFDLV-------------DERP 475

Query: 621 TILNYDVLTMFPFNSDTKRMGI-----------IVYDKQK-----DQYWFLQKGADTVMN 664
           T    D LT   FNS  K M +           I+Y K       ++      GA  V  
Sbjct: 476 TTTRVDELT---FNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEK 532

Query: 665 RIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANT 724
              ++   + +   ++A EGLRTL           + Q      E S +    +  + N 
Sbjct: 533 LSDSHKSLINDCAKSLASEGLRTLA----------FAQL-----ECSTNKPMNDSTIQN- 576

Query: 725 ISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLI 784
                   L  +GL G++D  +  V+ +IE L   G+ + M+TGD   TA          
Sbjct: 577 --------LTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTA---------- 618

Query: 785 SRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPT 844
                V++  ++  P           +N    +L  G+ L    +    +   V+ H+  
Sbjct: 619 -----VNIARQIGIP----------VINPEISVLT-GDRLD---QMTDDQLAGVIDHVN- 658

Query: 845 VIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAA 904
            I  R TP+ K ++   +++  G  V   GDG ND   ++ AD+GV +       A  A+
Sbjct: 659 -IFARATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEAS 716

Query: 905 DFSIT 909
           D  +T
Sbjct: 717 DMVLT 721

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 88/359 (24%), Positives = 150/359 (41%), Gaps = 71/359 (19%)

Query: 627 VLTMFPFNSDTKRMGIIV-YDKQKDQ---YWFLQKGADTVMNRIVA----NNDWLEE--- 675
           V+   PF S  K  G++V Y + K++   Y F  KGA  ++++  +    ++D LEE   
Sbjct: 609 VVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEINE 668

Query: 676 --------ETGNMAREGLRTLVIGRKKLTKK---IYEQFK-KEYEEVSAS--MYNREQEM 721
                   E  N+A + LR + +  K   +      EQ + K+   ++A   ++N ++  
Sbjct: 669 DNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQK-- 726

Query: 722 ANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISA 781
                      L L GL G++D L+  V+ S++  + AG+ + M+TGD +       ++A
Sbjct: 727 ----------GLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNI-------LTA 769

Query: 782 KLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVH 841
           K I+R   +      S+   A    E+ K+ KN  + I                      
Sbjct: 770 KAIARNCAILSTDISSEAYSAMEGTEFRKLTKNERIRI---------------------- 807

Query: 842 LPTV-IACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGK 898
           LP + +  R +P+ K  +   ++ + G  V   GDG ND   ++ ADVG  +GI G E  
Sbjct: 808 LPNLRVLARSSPEDKRLLVETLKGM-GDVVAVTGDGTNDAPALKLADVGFSMGISGTEVA 866

Query: 899 QASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFE 957
           + +         F  +   + W GR       K  QF +   +   I   V SV S  E
Sbjct: 867 REASDIILMTDDFSAIVNAIKW-GRCVSVSIKKFIQFQLIVNITAVILTFVSSVASSDE 924

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 70/308 (22%), Positives = 123/308 (39%), Gaps = 46/308 (14%)

Query: 240 RRDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTD 299
           R D+E  + ++ VL            VGD+I +  G  VPAD +++     SG+      
Sbjct: 198 RNDQEILISIHHVL------------VGDVISLQTGDVVPADCVMI-----SGKCEADES 240

Query: 300 QLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTID 359
            + GE++          Q    D+ L       S      H+    +   D N  G  I 
Sbjct: 241 SITGESN--------TIQKFPVDNSLRDFKKFNSIDS---HNHSKPLDIGDVNEDGNKIA 289

Query: 360 NTLWANTVLASSGFCIGCVIYTGRDT--RQAMNTTSAKVKTGLLELEINDISKILC--AC 415
           + +  +     SG   G +   G ++   Q M + +A+ ++  L+L ++ ++  +    C
Sbjct: 290 DCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVYGC 349

Query: 416 VFILSILLVVFAG-----LHNDDWYVDI---------MRYLILFSTIIPVSLRVNLDLAK 461
           V  + + LV+F       +  D  + D+         M   I   T+I V++   L LA 
Sbjct: 350 VSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAV 409

Query: 462 SVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTT 521
           ++         T    +VR     E +G    + SDKTGTLT+N M + +   GN  +  
Sbjct: 410 TLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKFDD 469

Query: 522 ETADIVSD 529
             +  VS+
Sbjct: 470 SKSLPVSE 477

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 100/425 (23%), Positives = 166/425 (39%), Gaps = 89/425 (20%)

Query: 489 GRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGPR 548
           GRI+    DKTGTLT  D+    V  G    +++  DI   Y          S T+  P 
Sbjct: 477 GRIDVCCFDKTGTLTGEDL----VFEGLAGLSSDPKDIRHLY----------SATDC-PN 521

Query: 549 STTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRD 608
           ST+    A H +  +             ED E+         +  +K+T   G  +F   
Sbjct: 522 STSLVVGAAHALVRL-------------EDGEIVGDPMEKATLKALKWTVEKGDKVF--- 565

Query: 609 RHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGADTVMNRIVA 668
                  +E +G +    +L  F F+S  KR   +     K  Y  ++   +T+  R+  
Sbjct: 566 -------NEKNGQV---TILRRFQFSSALKRSSSVATHDGK-LYSAVKGAPETIRERLFT 614

Query: 669 NNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISKY 728
                +E   +  R G R L +  KKL K    Q +           +RE         +
Sbjct: 615 IPANYDEIYKSFTRSGSRVLALASKKLEKMSQSQIEDA---------DRE---------H 656

Query: 729 LEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQ 788
            E DLE  G       L+ D   +I++L  +  +  M+TGD   TA  V+    ++ +G+
Sbjct: 657 FERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIV-KGE 715

Query: 789 --YVHVVTKLSKPEGAFNQLE-----YLKVNKNACLLIDGESLGMFLKY----------- 830
              V +V   +  +  F  +E        V+K++      E  G+F KY           
Sbjct: 716 TLIVDMVDNGNDDKLVFRNVEETLSFEFVVSKDSF-----EKYGIFDKYDLAVTGHALEA 770

Query: 831 --YRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADV 888
                +  D++ H    I  R +P QK  +   ++++  + + C GDG NDV  ++ A V
Sbjct: 771 LKGHHQLQDLIRH--AWIYARVSPAQKEFILNNLKDMGYQTLMC-GDGTNDVGALKQAHV 827

Query: 889 GVGIV 893
           GV ++
Sbjct: 828 GVALL 832

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 124/560 (22%), Positives = 216/560 (38%), Gaps = 126/560 (22%)

Query: 372 GFCIGCVIYTGRDTRQA-----MNTTSAKVKTGLLELEINDISKILCACVFILSILLVVF 426
           G  +  V  TG +T Q      M  +S +V  G  E           A  FIL +L+   
Sbjct: 364 GGALAVVSKTGFETSQGALVRVMIYSSERVSVGNKE-----------ALYFILFLLIFAI 412

Query: 427 AGLHNDDWYV-------------DIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKT 473
           A      WYV              I+  +++ ++++P  L + L +A       + +   
Sbjct: 413 AA----SWYVWVEGTRMGRVQSKLILDCILIITSVVPSELPMELTMA-------VNNSLA 461

Query: 474 IPETIVRTSTIPEDL---GRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDY 530
           +        T P  +   GRI+    DKTGTLT  D+                   V + 
Sbjct: 462 VLSKFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDL-------------------VFEG 502

Query: 531 IQGMIESKNDSVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDE 590
           + G+   KN  V +L   +    D  T+++     +   H +    +DDE+      P E
Sbjct: 503 LAGL-AGKNQPVNHLFKGTEVPLD--TNLV-----IGAAHALV-RLDDDEVV---GDPME 550

Query: 591 IAIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGII-VYDKQK 649
            A +  T   G  +  +D    SL +E  G I    +L  F F+S  KR   I V++KQ 
Sbjct: 551 KATLAAT---GWKVGVKD----SLSNEKVGDI---SILRRFQFSSALKRSSTIAVHNKQ- 599

Query: 650 DQYWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEE 709
             Y  ++   +T+  R+       ++   +  R G R L +  KKL     +Q +K   E
Sbjct: 600 -HYSAVKGAPETIRERLSQVPTDYDQVYKSFTRAGSRVLALASKKLPSMSIKQIEKLERE 658

Query: 710 VSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGD 769
                              +E DLE  G       L+ D   +I++L  +  +  M+TGD
Sbjct: 659 A------------------VESDLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITGD 700

Query: 770 KVETARCVSISAKLISRGQYV---------HVVTKLSKPEGAFNQ-------LEYLKVNK 813
              TA  V+    ++ R   +         H +   +  E   N         E+ K+  
Sbjct: 701 NPLTAVHVAKEVAIVERETLILDEPIDGSSHALVFRNIEETIVNPFNPEKDTFEHSKLFA 760

Query: 814 NACLLIDGESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCI 873
              + + G +L +   +   +  +++ H  T +  R +P QK  +   ++++  + + C 
Sbjct: 761 KYDIAVTGHALQLLSGH--SQLNELIRH--TWVYARVSPAQKEFIMNSLKDMGYQTLMC- 815

Query: 874 GDGGNDVSMIQCADVGVGIV 893
           GDG NDV  ++ A VG+ ++
Sbjct: 816 GDGTNDVGALKQAHVGIALL 835

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 73/157 (46%), Gaps = 11/157 (7%)

Query: 359 DNTLWANTVLASSGFCIGCVIYTGRDT---RQAMNTTSAKVKTGLLELEINDISKILCAC 415
           D T  ++TV    GF +  V  TG +T   R A     A    G     +N I  IL   
Sbjct: 243 DQTFSSSTVKRGEGFMV--VTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIGIILLVL 300

Query: 416 VFILSILLVVFAGLHNDDWYVDIMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTI 474
           V I ++LLV  A  +  +  V I+RY +  + I +PV L   +    +V A  +      
Sbjct: 301 V-IATLLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK--- 356

Query: 475 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK 511
            + IV+  +  E L  +E L SDKTGTLT+N + L +
Sbjct: 357 -QAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE 392

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 97/249 (38%), Gaps = 48/249 (19%)

Query: 545 LGPRSTTRKDAATHVIDLITTLA----ICHNVTPTFEDDEL------TYQAASPDEIAIV 594
           +G     +K A    +  I +LA    +C + T T   ++L      T +  SPD++ + 
Sbjct: 348 VGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLML- 406

Query: 595 KFTESVGLSLFKR-----DRHSMSLLHEHS---GTILNYDVLTMFPFNSDTKRMGIIVYD 646
             T  +  S  K+     D+  +  L ++      +  Y VL   PF+  +K++  +V  
Sbjct: 407 --TACLAASRKKKGLDAIDKAFLKSLKQYPKAKDALTKYKVLEFHPFDPVSKKVTAVVES 464

Query: 647 KQKDQYWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKE 706
            + ++     KGA   + + V      EE+                      I E   + 
Sbjct: 465 PEGERI-VCVKGAPLFVLKTV------EED--------------------HPIPEDVHEN 497

Query: 707 YEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWML 766
           YE   A + +R         K  E   E+LG+    D  + D   ++   R+ G+++ ML
Sbjct: 498 YENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKML 557

Query: 767 TGDKVETAR 775
           TGD V  A+
Sbjct: 558 TGDAVGIAK 566

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 120/292 (41%), Gaps = 52/292 (17%)

Query: 624 NYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGA-DTVMNRIVANNDWLEEETGNMAR 682
           N  +L  F F+S  KR   I    Q ++++   KGA +T+  R+ +     ++   +  R
Sbjct: 571 NIRILRRFQFSSSLKRSASIA--SQSNRFFAAVKGAPETIRERLNSVPSDYDDIYKSFTR 628

Query: 683 EGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVE 742
            G R L +  K L K                M N   ++ N     +E  L         
Sbjct: 629 SGSRVLALAYKDLPK----------------MSN--SQIDNIDRDEIETGLTFGAFLVFH 670

Query: 743 DKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKP-EG 801
             L+ D   +I++L  +  +  M+TGD   TA  V+    ++ R   +     L +P +G
Sbjct: 671 CPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDRETLI-----LDEPIDG 725

Query: 802 AFNQLEYLKVNKNAC--------------------LLIDGESLGMFLKYYRQEFFDVVVH 841
           + + L    VN+                       L + G +L +   +  ++  DV+ H
Sbjct: 726 SSHALVMRDVNETIVKPFNPDADTFDEKEIFQKYDLAVTGHALKLLQGH--KQLRDVIRH 783

Query: 842 LPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIV 893
             T I  R +P QK  + + ++++  + + C GDG NDV  ++ A VG+ ++
Sbjct: 784 --TWIYARVSPSQKEFILITLKDMGYQTLMC-GDGTNDVGALKQAHVGIALL 832

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 145/678 (21%), Positives = 259/678 (38%), Gaps = 171/678 (25%)

Query: 268 DLIKISKGAR---VPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDL 324
           DL+ I++ A    +P DLILL      G A +    L GE+   L+ +  L  +  ED+L
Sbjct: 276 DLVSITRTAEESAIPCDLILLD-----GSAIVNEAMLSGESTPLLKESIKLRPS--EDNL 328

Query: 325 ----LEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASS-GFCIGCVI 379
               ++KI +        +H            T  L +      + +     G  +  V 
Sbjct: 329 QLDGVDKIAV--------LHG----------GTKALQVTPPEHKSDIPPPPDGGALAIVT 370

Query: 380 YTGRDTRQAMNTTSAKVKTGLLELEINDISKILC----ACVFILSILLVVFAGLHNDDWY 435
            TG +T Q            L+ + I    ++      A +FIL   L++FA + +  WY
Sbjct: 371 KTGFETSQG----------SLVRVMIYSAERVSVDNKEALMFIL--FLLIFAVIAS--WY 416

Query: 436 V-------------DIMRYLILFSTIIPVSLRVNLDLA--------KSVYAHQIEHDKTI 474
           V              I+  +++ ++++P  L + L +A           Y +  E  + I
Sbjct: 417 VWVEGTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALAKFYVYCTEPFR-I 475

Query: 475 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGM 534
           P             GRI+    DKTGTLT  D+  +   L  +S  +E        I+ +
Sbjct: 476 PFA-----------GRIDVCCFDKTGTLTGEDLVFEG--LAGISADSEN-------IRHL 515

Query: 535 IESKNDSVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIV 594
             +         P ST     A H +                ED ++      P E A +
Sbjct: 516 YSAAE------APESTILVIGAAHALV-------------KLEDGDIV---GDPMEKATL 553

Query: 595 KFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWF 654
           K   +VG ++ +++ +      E +G +   D++  F F+S  KR   I      D  + 
Sbjct: 554 K---AVGWAVERKNSN----YREGTGKL---DIIRRFQFSSALKRSASIA--SHNDALFA 601

Query: 655 LQKGA-DTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSAS 713
             KGA +T+  R+       +E   +  R G R L +  K L K    +           
Sbjct: 602 AVKGAPETIRERLSDIPKNYDEIYKSFTRSGSRVLALASKSLPKMSQSKIDD-------- 653

Query: 714 MYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET 773
             NR+          +E +L   G       L+ D   +I++L  +  +  M+TGD   T
Sbjct: 654 -LNRDD---------VESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLT 703

Query: 774 ARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDG-----ESLGMFL 828
           A  V+    ++  G+ + ++ +  K +   NQL +  V +   +  D      +   +F 
Sbjct: 704 AVHVAKEVGIVF-GETL-ILDRAGKSDD--NQLLFRDVEETVSIPFDPSKDTFDHSKLFD 759

Query: 829 KY-------------YRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGD 875
           +Y                +  D++ H  T +  R +P QK  +   ++++  + + C GD
Sbjct: 760 RYDIAVTGYALNALEGHSQLRDLLRH--TWVYARVSPSQKEFLLNTLKDMGYQTLMC-GD 816

Query: 876 GGNDVSMIQCADVGVGIV 893
           G NDV  ++ A VG+ ++
Sbjct: 817 GTNDVGALKQAHVGIALL 834

>Scas_583.14*
          Length = 875

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 126/295 (42%), Gaps = 44/295 (14%)

Query: 627 VLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGA-DTVMNRIVANNDWLEEETGNMAREGL 685
           +L  F F+S  KR   +     KD+ +   KGA +T+  R+       +E   +  R G 
Sbjct: 230 ILRRFQFSSALKRSSSVA--SHKDKLFTAVKGAPETIRERLAVVPKNYDEIYKSFTRSGS 287

Query: 686 RTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKL 745
           R L +  K L     +Q             +R++         +E  L   G       L
Sbjct: 288 RVLALASKSLPNLSSKQLDD---------LDRDE---------IETGLTFNGFLVFHCPL 329

Query: 746 QKDVKSSIELLRNAGIKIWMLTGDK----VETARCVSI---------SAKLISRGQ--YV 790
           + D   +I++L  +  +  M+TGD     V  A+ V+I          ++ +  G+  + 
Sbjct: 330 KPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLILDKSETVGDGKLLFF 389

Query: 791 HVVTKLSKP-EGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTVIACR 849
           +V   +  P + A ++ ++ ++     + + G +L +   +   +  D++ H  T +  R
Sbjct: 390 NVEETIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDH--SQLKDLIRH--TWVYAR 445

Query: 850 CTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAA 904
            +P QK  +   ++E+  + + C GDG NDV  ++ A VGV ++   G + S+ A
Sbjct: 446 VSPSQKEFILNNLKEMGYQTLMC-GDGTNDVGALKQAHVGVALL--NGTEESMTA 497

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 70/157 (44%), Gaps = 11/157 (7%)

Query: 359 DNTLWANTVLASSGFCIGCVIYTGRDT---RQAMNTTSAKVKTGLLELEINDISKILCAC 415
           D    ++TV     F +  V  TG +T   R A     A    G     +N I  IL   
Sbjct: 272 DEVFSSSTVKTGEAFMV--VTATGDNTFVGRAAALVGQASGVEGHFTEVLNGIGIILLVL 329

Query: 416 VFILSILLVVFAGLHNDDWYVDIMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTI 474
           V I ++LLV  A  +     V I+RY +  + I +PV L   +    +V A  +      
Sbjct: 330 V-IATLLLVWTACFYRTVGIVSILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK--- 385

Query: 475 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK 511
            + IV+  +  E L  +E L SDKTGTLT+N + L +
Sbjct: 386 -QAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE 421

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 97/249 (38%), Gaps = 48/249 (19%)

Query: 545 LGPRSTTRKDAATHVIDLITTLA----ICHNVTPTFEDDEL------TYQAASPDEIAIV 594
           +G     +K A    +  I +LA    +C + T T   ++L      T +  SPD++ + 
Sbjct: 377 VGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLML- 435

Query: 595 KFTESVGLSLFKR-----DRHSMSLLHEHS---GTILNYDVLTMFPFNSDTKRMGIIVYD 646
             T  +  S  K+     D+  +  L E+      +  Y VL   PF+  +K++  +V  
Sbjct: 436 --TACLAASRKKKGLDAIDKAFLKSLIEYPKAKDALTKYKVLEFHPFDPVSKKVTAVVES 493

Query: 647 KQKDQYWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKE 706
            + ++     KGA   + + V      EE+                      I E   + 
Sbjct: 494 PEGERI-VCVKGAPLFVLKTV------EED--------------------HPIPEDVHEN 526

Query: 707 YEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWML 766
           YE   A + +R         K  E   E+LG+    D  + D   +I   RN G++I ML
Sbjct: 527 YENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTINEARNLGLRIKML 586

Query: 767 TGDKVETAR 775
           TGD V  A+
Sbjct: 587 TGDAVGIAK 595

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 99/275 (36%), Gaps = 67/275 (24%)

Query: 624 NYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGADTVMNRIVANNDWLEEETGNMARE 683
            Y VL   PF+  +K++  IV   + ++     KGA   + + V  N  + E+       
Sbjct: 423 KYKVLEFHPFDPVSKKVTAIVESPEGERI-VCVKGAPLFVLKTVEENHLIPEDV------ 475

Query: 684 GLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVED 743
                               K+ YE   A + +R         K  E   E+LG+    D
Sbjct: 476 --------------------KENYENKVAELASRGYRALGVARKRGEGHWEILGVMPCMD 515

Query: 744 KLQKDVKSSIELLRNAGIKIWMLTGDKV----ETARCVSISAKLISRGQYVHVVTKLSKP 799
             + D   ++   R+ G+++ MLTGD V    ET R + +    I   + + +      P
Sbjct: 516 PPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTN-IYNAERLGLGGGGDMP 574

Query: 800 EGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVA 859
                                G  L  F++     F +V             PQ K +V 
Sbjct: 575 ---------------------GSELADFVE-NADGFAEVF------------PQHKYNVV 600

Query: 860 LIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVG 894
            I+++  G  V   GDG ND   ++ AD G+ + G
Sbjct: 601 EILQQ-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 634

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 72/157 (45%), Gaps = 11/157 (7%)

Query: 359 DNTLWANTVLASSGFCIGCVIYTGRDT---RQAMNTTSAKVKTGLLELEINDISKILCAC 415
           D T  ++TV    GF I  V  TG  T   R A     A   +G     +N I  IL   
Sbjct: 224 DATFSSSTVKRGEGFMI--VTATGDSTFVGRAAALVNKASAGSGHFTEVLNGIGTILLIL 281

Query: 416 VFILSILLVVFAGLHNDDWYVDIMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTI 474
           V +  +++ V     + D  V I+RY +  + + +PV L   +    +V A  +   K I
Sbjct: 282 VILTLLVVYVACFYRSID-IVTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKKKAI 340

Query: 475 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK 511
              + + S I E L  +E L SDKTGTLT+N + L +
Sbjct: 341 ---VQKLSAI-ESLAGVEILCSDKTGTLTKNKLSLHE 373

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 80/378 (21%), Positives = 136/378 (35%), Gaps = 82/378 (21%)

Query: 545 LGPRSTTRKDAATHVIDLITTLA----ICHNVTPTFEDDEL------TYQAASPDEI--- 591
           +G     +K A    +  I +LA    +C + T T   ++L      T +   PD++   
Sbjct: 329 VGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLT 388

Query: 592 -AIVKFTESVGL-SLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQK 649
             +    +  GL ++ K    S+         +  Y +L   PF+  +K++  IV   + 
Sbjct: 389 ACLAASRKKKGLDAIDKAFLKSLISYPRAKAALTKYKLLEFHPFDPVSKKVTAIVESPEG 448

Query: 650 DQYWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEE 709
           ++     KGA   + + V      EEE                      I E  ++ YE 
Sbjct: 449 ERI-ICVKGAPLFVLKTV------EEE--------------------HPIPEDVRENYEN 481

Query: 710 VSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGD 769
             A + +R         K  E   E+LG+    D  + D   ++   R+ G+++ MLTGD
Sbjct: 482 KVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGD 541

Query: 770 KV----ETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLG 825
            V    ET R + +    I   + + +      P                     G  L 
Sbjct: 542 AVGIAKETCRQLGLGTN-IYNAERLGLGGGGDMP---------------------GSELA 579

Query: 826 MFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQC 885
            F++     F +V             PQ K +V  I+++  G  V   GDG ND   ++ 
Sbjct: 580 DFVE-NADGFAEVF------------PQHKYNVVEILQQ-RGYLVAMTGDGVNDAPSLKK 625

Query: 886 ADVGVGIVGKEGKQASLA 903
           AD G+ + G      S A
Sbjct: 626 ADTGIAVEGATDAARSAA 643

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 11/100 (11%)

Query: 427 AGLHNDDWYVDIMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIP 485
           A  +  +  V I+RY +  + + +PV L   +    +V A  +       + IV+  +  
Sbjct: 292 ASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 347

Query: 486 EDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETAD 525
           E L  +E L SDKTGTLT+N + L +       YT E  D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHE------PYTVEGVD 381

>Scas_688.1
          Length = 913

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 79/369 (21%), Positives = 135/369 (36%), Gaps = 82/369 (22%)

Query: 545 LGPRSTTRKDAATHVIDLITTLA----ICHNVTPTFEDDEL------TYQAASPDEIAIV 594
           +G     +K A    +  I +LA    +C + T T   ++L      T +  S D++ + 
Sbjct: 343 VGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLML- 401

Query: 595 KFTESVGLSLFKR-----DRHSMSLLHEHSGT---ILNYDVLTMFPFNSDTKRMGIIVYD 646
             T  +  S  K+     D+  +  L ++      +  Y VL   PF+  +K++  +V  
Sbjct: 402 --TACLAASRKKKGLDAIDKAFLKSLAQYPAAKNALTKYKVLEFHPFDPVSKKVTAVVES 459

Query: 647 KQKDQYWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKE 706
            + ++     KGA   + + V      EE+                      I E   + 
Sbjct: 460 PEGERI-ICVKGAPLFVLKTV------EED--------------------HPIPEDIHEN 492

Query: 707 YEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWML 766
           YE   A + +R         K  E   E+LG+    D  + D   ++   R  G+++ ML
Sbjct: 493 YENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTGETVAEARRLGLRVKML 552

Query: 767 TGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGA-FNQLEYLKVNKNACLLIDGESLG 825
           TGD V  A+    + + +  G  V+   +L    G      E     +NA    DG    
Sbjct: 553 TGDAVGIAKE---TCRQLGLGTNVYNAERLGLSGGGDMPGSELADFVENA----DG---- 601

Query: 826 MFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQC 885
            F + + Q+ + VV  L T                      G  V   GDG ND   ++ 
Sbjct: 602 -FAEVFPQDKYRVVEILQT---------------------RGYLVAMTGDGVNDAPSLKK 639

Query: 886 ADVGVGIVG 894
           AD G+ + G
Sbjct: 640 ADTGIAVEG 648

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 5/88 (5%)

Query: 427 AGLHNDDWYVDIMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIP 485
           A  +  D  V I+RY +  + + +PV L   +    +V A  +       + IV+  +  
Sbjct: 306 ASFYRTDGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 361

Query: 486 EDLGRIEYLLSDKTGTLTQNDMQLKKVH 513
           E L  +E L SDKTGTLT+N + L + +
Sbjct: 362 ESLAGVEILCSDKTGTLTKNKLSLHEPY 389

>Scas_227.0d
          Length = 307

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 102/254 (40%), Gaps = 58/254 (22%)

Query: 497 DKTGTLTQNDMQLKKVHLGN-----------VSYTTET----------------ADIVSD 529
           DKTGTLT+N M + +  +G+            S  T++                 ++  D
Sbjct: 11  DKTGTLTENVMSVVRGFVGDSYFNDSDNALLTSVATDSHIKKSIEIFKKNGECSENLEKD 70

Query: 530 YIQGMI------ESKN--DSVTNLGPRSTTRKDA-----ATHVIDLITTLAICHNVTPTF 576
           ++  ++      E+K+  DS  NL P ST  +D      A   +   T ++I  +     
Sbjct: 71  FLTNIVLNSTAFENKDFVDSANNL-PFSTDERDPSQVKRAFEFVRTHTRISISRDDNSDS 129

Query: 577 EDDELTYQAASPDEIAIVKFTESVGLSLFKRDRH----SMSLLHEHSGTILNY-DVLTMF 631
            DD +        E  I   TE+  L+L K+  +    S+  L E+        ++  + 
Sbjct: 130 GDDLIQNAIKGRQEPYIGSKTETALLTLAKKSMNLRFGSLRALRENPVDRFEVSEIAQII 189

Query: 632 PFNSDTKRMGIIVYDKQKDQYWFLQKGADTVMNR------------IVANNDWLEEETGN 679
           PF S  K  GIIV  K+ + Y F  KGA  +++             +  N D + +E  N
Sbjct: 190 PFESTRKWGGIIVKYKESNLYRFFIKGAAEIVSNNCHSKRNSDDSIVTLNKDQINKEIEN 249

Query: 680 MAREGLRTLVIGRK 693
           +A + LR L +  +
Sbjct: 250 LANDALRALSLAHR 263

>Kwal_47.17522
          Length = 899

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 80/381 (20%), Positives = 136/381 (35%), Gaps = 88/381 (23%)

Query: 545 LGPRSTTRKDAATHVIDLITTLA----ICHNVTPTFEDDEL------TYQAASPDEIAIV 594
           +G     +K A    +  I +LA    +C + T T   ++L      T +   PD++ + 
Sbjct: 329 VGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPDDLML- 387

Query: 595 KFTESVGLSLFKR-----DRHSMSLLHEHS---GTILNYDVLTMFPFNSDTKRMGIIVYD 646
             T  +  S  K+     D+  +  L ++      +  Y VL   PF+  +K++  +V  
Sbjct: 388 --TACLAASRKKKGLDAIDKAFLKSLIQYPRAKNALTKYKVLDFHPFDPVSKKVTAVVES 445

Query: 647 KQKDQYWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKE 706
            + ++     KGA   + + V      EE+                      I E   + 
Sbjct: 446 PEGERI-ICVKGAPLFVLKTV------EED--------------------HPIPEDVHEN 478

Query: 707 YEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWML 766
           YE   A + +R         K  E   E+LG+    D  + D   ++   R  G+++ ML
Sbjct: 479 YENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVHEARRLGLRVKML 538

Query: 767 TGDKV----ETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGE 822
           TGD V    ET R + +    I   + + +      P                     G 
Sbjct: 539 TGDAVGIAKETCRQLGLGTN-IYNAERLGLGGGGDMP---------------------GS 576

Query: 823 SLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSM 882
            L  F++     F +V             PQ K  V  I+++  G  V   GDG ND   
Sbjct: 577 ELADFVE-NADGFAEVF------------PQHKYSVVEILQQ-RGYLVAMTGDGVNDAPS 622

Query: 883 IQCADVGVGIVGKEGKQASLA 903
           ++ AD G+ + G      S A
Sbjct: 623 LKKADTGIAVEGATDAARSAA 643

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 72/157 (45%), Gaps = 11/157 (7%)

Query: 359 DNTLWANTVLASSGFCIGCVIYTGRDT---RQAMNTTSAKVKTGLLELEINDISKILCAC 415
           D T  ++TV    GF I  V  TG +T   R A     A    G     +N I  IL   
Sbjct: 224 DTTFSSSTVKRGEGFMI--VTATGDNTFVGRAAALVNQAAGDQGHFTEVLNGIGTILLVL 281

Query: 416 VFILSILLVVFAGLHNDDWYVDIMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTI 474
           V +  +L+   A  +  D  V I+RY +  + I +PV L   +    +V A  +   + I
Sbjct: 282 VIVTLLLVWT-ACFYRTDRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAI 340

Query: 475 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK 511
              + + S I E L  +E L SDKTGTLT+N + L +
Sbjct: 341 ---VQKLSAI-ESLAGVEILCSDKTGTLTKNKLSLHE 373

>Scas_297.1
          Length = 800

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 75/193 (38%), Gaps = 34/193 (17%)

Query: 768 GDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMF 827
           GD + TAR ++ +  ++S   Y+        PE A                I+G      
Sbjct: 1   GDNILTARAIARNCNILSEETYLI-------PECA----------------IEGPKFRTL 37

Query: 828 LKYYRQEFFDVVVHLPTV-IACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCA 886
            K  R      +  LP + +  R +P+ K  +   ++ + G  V   GDG ND   ++ A
Sbjct: 38  TKQER------IKMLPNLRVMARSSPEDKRLLVETLKGM-GDVVAVTGDGTNDAPALKLA 90

Query: 887 DVG--VGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIA 944
           DVG  +GI G E  + +         F  + + + W GR       K  QF +   +   
Sbjct: 91  DVGFSMGISGTEVAREASDIILMTDDFAAIVDAIKW-GRCVSISIKKFIQFQLIVNITAV 149

Query: 945 ICQAVFSVCSQFE 957
           I   V S+ S+ E
Sbjct: 150 ILAFVSSIASEDE 162

>KLLA0D04092g complement(344666..348124) some similarities with
           sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
           copper-transporting ATPase P16.2.f2.1, hypothetical
           start
          Length = 1152

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%)

Query: 738 LTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVS 778
           +   +D+++ + K  I+ LR +GI+ WM++GD   TAR V+
Sbjct: 924 MCAAKDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVA 964

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 37.0 bits (84), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 8/97 (8%)

Query: 714 MYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET 773
           MY R      T   YL  D ++ G   + D+++ D K  I  LRN   +++M+TGD  ++
Sbjct: 737 MYGRAGPCTVT---YLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKS 793

Query: 774 ARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLK 810
           A  V+    +     Y  V      P+G    +EYL+
Sbjct: 794 AMKVAEMVDIPPNNVYSEVT-----PDGKSQTVEYLR 825

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 427 AGLHNDDWYVDIMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIP 485
           A  +  D  V I+R+ +  + I +PV L   +    +V A  +       + IV+  +  
Sbjct: 295 ACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 350

Query: 486 EDLGRIEYLLSDKTGTLTQNDMQLKK 511
           E L  +E L SDKTGTLT+N + L +
Sbjct: 351 ESLAGVEILCSDKTGTLTKNKLSLHE 376

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%)

Query: 699 IYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRN 758
           I E   + YE   A + +R         K  E   E+LG+    D  + D   ++   R 
Sbjct: 474 IPEDVHENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAETVNEARR 533

Query: 759 AGIKIWMLTGDKVETAR 775
            G+++ MLTGD V  A+
Sbjct: 534 LGLRVKMLTGDAVGIAK 550

>Scas_710.41
          Length = 904

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 70/196 (35%), Gaps = 32/196 (16%)

Query: 699 IYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRN 758
           + E   + YE   A + +R         K  E   E+LG+    D  + D   +I   R 
Sbjct: 477 VPEDVHENYENKVAELASRGFRSLGVARKRGEGYWEILGVMPCMDPPRDDTARTIAEART 536

Query: 759 AGIKIWMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLL 818
            G+++ MLTGD V  A+  S    L                    N     K+       
Sbjct: 537 LGLRVKMLTGDAVGIAKETSRQLGL------------------GVNIYNAEKLGLGGGGD 578

Query: 819 IDGESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGN 878
           + G  L  F++     F +V             PQ K  V  I++   G  V   GDG N
Sbjct: 579 MPGSELADFVE-NADGFAEVF------------PQHKYKVVEILQN-RGYLVAMTGDGVN 624

Query: 879 DVSMIQCADVGVGIVG 894
           D   ++ AD G+ + G
Sbjct: 625 DAPSLKKADTGIAVEG 640

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 5/88 (5%)

Query: 427 AGLHNDDWYVDIMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIP 485
           A  +  D  V I+R+ +  + I +PV L   +    +V A  +       + IV+  +  
Sbjct: 298 ACFYRTDGIVMILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 353

Query: 486 EDLGRIEYLLSDKTGTLTQNDMQLKKVH 513
           E L  +E L SDKTGTLT+N + L + +
Sbjct: 354 ESLAGVEILCSDKTGTLTKNKLSLHEPY 381

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 37/71 (52%), Gaps = 7/71 (9%)

Query: 740  GVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKP 799
             V D+L+ + K  ++ L   GI+ WM++GD    A  V++   +       HV+  +  P
Sbjct: 1015 AVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI------KHVIADV-LP 1067

Query: 800  EGAFNQLEYLK 810
            EG   ++++++
Sbjct: 1068 EGKAEKIQWIR 1078

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 852  PQQKADVALIIRELTGKRVCC--IGDGGNDVSMIQCADVGVGIVGKEGKQASLAADF 906
            P+ KA+    IRE +G+ V    +GDG ND   I  ADVG+ +       A ++ DF
Sbjct: 1067 PEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISLASGS-DLAMISCDF 1122

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%)

Query: 728 YLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETA 774
           Y+  D  L+G   + D++++D    +E L+N GIK  M+TGD  ++A
Sbjct: 734 YVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSA 780

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 5/93 (5%)

Query: 800 EGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVA 859
           E A   +EYL+     C ++ G++    LK  +Q    + +    V +   TP+QK D+ 
Sbjct: 753 EDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQ----LGISANDVFS-EVTPEQKRDIV 807

Query: 860 LIIRELTGKRVCCIGDGGNDVSMIQCADVGVGI 892
           + ++    +RV  +GDG ND   +  AD+G+ I
Sbjct: 808 IQLQNNGTERVAFVGDGINDSPALVEADLGISI 840

>Scas_569.0d
          Length = 468

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 17/118 (14%)

Query: 842 LPTVIACRCTPQQKADVALIIRELTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-G 897
           LP VIA RC+PQ K  V +I       + C + GDG ND   ++ A+VG+  GI G +  
Sbjct: 101 LPLVIA-RCSPQTK--VRMIEALHRRDKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVA 157

Query: 898 KQAS--LAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVC 953
           K AS  + +D +     +  E     GR   + S  + +FV+   L   + QA++ +C
Sbjct: 158 KDASDIVLSDDNFASILNAIE----EGR---RMSDNIQKFVLQL-LAENVAQALYLIC 207

>Kwal_55.21575
          Length = 989

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 28/48 (58%)

Query: 254 GRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQL 301
           G+ R +  + L+VGD ++I  GA++P D ++++      E+ I  + L
Sbjct: 417 GKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESL 464

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 34/58 (58%)

Query: 722 ANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSI 779
           A++   Y++ + EL+G   + D ++KD    ++ L   G ++ M+TGD  ++A  V++
Sbjct: 726 ASSTLAYVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVAL 783

>CAGL0B04103g 400331..401164 similar to tr|Q06104 Saccharomyces
           cerevisiae YPR109w, hypothetical start
          Length = 277

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 380 YTGRDTRQAMNTTSAKVKTGLLELEI--NDISKILCACVFILSILLVVFAGLHNDDWYV 436
           +T      + N+ S +  TG   LE+    I  IL  CV  ++IL VVFA L   D+Y+
Sbjct: 90  FTTAGASGSNNSDSTQTDTGDFALEVLKRKIRAILFNCVLTINILYVVFAILFPTDFYI 148

>Kwal_47.18219
          Length = 293

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 684 GLRTLVIGRKKLTKKIYEQFKKEYEEV-SASMYNREQEMANTISKYLEHDLE 734
           GL T  I R + ++ +Y+  K  Y  + +A +Y  E E+   I K+LE D E
Sbjct: 29  GLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEEDPE 80

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 716 NREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETAR 775
           N   +  NT+S Y+  +  + GL  + D+++ D  ++++ L+  G + +M+TGD    A+
Sbjct: 737 NSNVDQGNTVS-YVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAK 795

Query: 776 CVS 778
            V+
Sbjct: 796 RVA 798

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 740  GVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKL 783
             +ED L+ D  S+I LLR  GI + +L+GD     R  S++A+L
Sbjct: 1021 ALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVR--SMAARL 1062

>Kwal_33.14284
          Length = 441

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 45/116 (38%), Gaps = 14/116 (12%)

Query: 697 KKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELL 756
           K+ YE   K     +A +     E+ N I  +    L L  L  VED +  D K  + LL
Sbjct: 40  KRCYELLTKTSRSFAAVIMELHPELRNAIMLFY---LVLRALDTVEDDMTIDPKIKVPLL 96

Query: 757 RNAGIKI----WMLTGD-KVETARCVSISAKLI------SRGQYVHVVTKLSKPEG 801
           R    K+    W   G+   E  RCV +    I       + QY  V+  ++   G
Sbjct: 97  REFDTKLDLDNWSFDGNAPTEKDRCVLVEFPCILKELHKLKPQYQEVIKTITHKMG 152

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,158,058
Number of extensions: 1616008
Number of successful extensions: 5734
Number of sequences better than 10.0: 107
Number of HSP's gapped: 5722
Number of HSP's successfully gapped: 184
Length of query: 1127
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 1015
Effective length of database: 12,718,893
Effective search space: 12909676395
Effective search space used: 12909676395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)