Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L00693g24924512211e-172
Scas_704.372512477013e-93
YIL049W (DFG10)2532466069e-79
ADL073W2772384393e-53
Kwal_23.58252432324084e-49
Sklu_1893.32812664081e-48
KLLA0C08261g2332313266e-37
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L00693g
         (245 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces cer...   474   e-172
Scas_704.37                                                           274   3e-93
YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in...   238   9e-79
ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH] complement...   173   3e-53
Kwal_23.5825                                                          161   4e-49
Sklu_1893.3 YIL049W, Contig c1893 3492-4337                           161   1e-48
KLLA0C08261g complement(724399..725100) similar to sp|P40526 Sac...   130   6e-37

>CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces
           cerevisiae YIL049w DFG10, hypothetical start
          Length = 249

 Score =  474 bits (1221), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 233/245 (95%), Positives = 233/245 (95%)

Query: 1   MIDNSNILQLITICLRLSNIVGLMSLIIAKYYLPDFLRYGKTFTFAKNGNENIWDKIKNF 60
           MIDNSNILQLITICLRLSNIVGLMSLIIAKYYLPDFLRYGKTFTFAKNGNENIWDKIKNF
Sbjct: 1   MIDNSNILQLITICLRLSNIVGLMSLIIAKYYLPDFLRYGKTFTFAKNGNENIWDKIKNF 60

Query: 61  SVPKSYFAHFYIXXXXXXXXXXXXYPTDILVWQLFLHSSRRLYETLYISKYTEKSKMNWS 120
           SVPKSYFAHFYI            YPTDILVWQLFLHSSRRLYETLYISKYTEKSKMNWS
Sbjct: 61  SVPKSYFAHFYILSSVLALVTLASYPTDILVWQLFLHSSRRLYETLYISKYTEKSKMNWS 120

Query: 121 HYAVGLWFYSQLNILVYLRVQRENTTARVLPILVMVLASWDQYKNHVVLSKLKKYSLPRS 180
           HYAVGLWFYSQLNILVYLRVQRENTTARVLPILVMVLASWDQYKNHVVLSKLKKYSLPRS
Sbjct: 121 HYAVGLWFYSQLNILVYLRVQRENTTARVLPILVMVLASWDQYKNHVVLSKLKKYSLPRS 180

Query: 181 RLFELVCCPHYLDEMIIYGSLVSYGHEFVWPLIWVIASLSISALESRKFYLSKFKDTEVP 240
           RLFELVCCPHYLDEMIIYGSLVSYGHEFVWPLIWVIASLSISALESRKFYLSKFKDTEVP
Sbjct: 181 RLFELVCCPHYLDEMIIYGSLVSYGHEFVWPLIWVIASLSISALESRKFYLSKFKDTEVP 240

Query: 241 RYAAI 245
           RYAAI
Sbjct: 241 RYAAI 245

>Scas_704.37
          Length = 251

 Score =  274 bits (701), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 133/247 (53%), Positives = 176/247 (71%), Gaps = 3/247 (1%)

Query: 2   IDNSNILQLITICLRLSNIVGLMSLIIAKYYLPDFLRYGKTFTFAKNGN-ENIWDKIKNF 60
           +    IL L+ I  R S  +GL+SL IAK+YLPDFL+YGKT   A++G+   +WDKI +F
Sbjct: 1   MSTDTILNLLVIGYRSSFFLGLLSLAIAKFYLPDFLQYGKTLNTAQSGDVMTLWDKIIHF 60

Query: 61  SVPKSYFAHFYIXXXXXXXXXXXXYPTDILVWQLFLHSSRRLYETLYISKYTEKSKMNWS 120
           +VPKSYF+HFY             YP   +VW L  HS RRLYETL++ KYT KS+MNWS
Sbjct: 61  TVPKSYFSHFYYLSAILSVSTLYVYPKYPVVWLLAFHSLRRLYETLFVCKYTSKSRMNWS 120

Query: 121 HYAVGLWFYSQLNIL--VYLRVQRENTTARVLPILVMVLASWDQYKNHVVLSKLKKYSLP 178
           HY VG+WFY+ L+++  + L  +R + T  +  + +++LASWDQYKNH VL+ L+KYSLP
Sbjct: 121 HYVVGIWFYTVLHLILNICLYFERISPTINISALFILILASWDQYKNHRVLAHLRKYSLP 180

Query: 179 RSRLFELVCCPHYLDEMIIYGSLVSYGHEFVWPLIWVIASLSISALESRKFYLSKFKDTE 238
             RLF++VCCPHYLDEMIIY + +SY  EF+WPLIWV+ SLSISA+E++ FY SKF +  
Sbjct: 181 TQRLFKIVCCPHYLDEMIIYSTFLSYNAEFIWPLIWVVVSLSISAIETKNFYKSKFVEEN 240

Query: 239 VPRYAAI 245
           VP Y+ I
Sbjct: 241 VPDYSII 247

>YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in
           filamentous growth, cell polarity, and cellular
           elongation [762 bp, 253 aa]
          Length = 253

 Score =  238 bits (606), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 122/246 (49%), Positives = 161/246 (65%), Gaps = 3/246 (1%)

Query: 3   DNSNILQLITICLRLSNIVGLMSLIIAKYYLPDFLRYGKTFTFAKNGN-ENIWDKIKNFS 61
           D   +L+      RLS  VG+ SL IAK  LP+FL+YGKT+   +N    +I ++IK F+
Sbjct: 4   DEEQLLKYTIYAYRLSFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIKKFT 63

Query: 62  VPKSYFAHFYIXXXXXXXXXXXXYPTDILVWQLFLHSSRRLYETLYISKYTEKSKMNWSH 121
           VPK+YF+HFY             YP   +VW +F HS RRLYETLY+  YT  S+MNWSH
Sbjct: 64  VPKAYFSHFYYLATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMNWSH 123

Query: 122 YAVGLWFYSQLNILVYLRVQREN--TTARVLPILVMVLASWDQYKNHVVLSKLKKYSLPR 179
           Y VG+WFYS L +++ + + + +   T  +   ++  +ASWDQYKNHV+L+ L KYSLP 
Sbjct: 124 YLVGIWFYSVLLLILNISLYKNSIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYSLPT 183

Query: 180 SRLFELVCCPHYLDEMIIYGSLVSYGHEFVWPLIWVIASLSISALESRKFYLSKFKDTEV 239
            RLF LVCCPHYLDE+IIY +L+ Y  EF   L+WVI SL+ISALE++ +Y  KFKD  V
Sbjct: 184 GRLFRLVCCPHYLDEIIIYSTLLPYEQEFYLTLVWVITSLTISALETKNYYRHKFKDNHV 243

Query: 240 PRYAAI 245
             YA I
Sbjct: 244 APYAII 249

>ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH]
           complement(553708..554541) [834 bp, 277 aa]
          Length = 277

 Score =  173 bits (439), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 97/238 (40%), Positives = 141/238 (59%), Gaps = 15/238 (6%)

Query: 21  VGLMSLIIAKYYLPDFLRYGKTFTFAKNGNENIWDKIKNFSVPKSYFAHFYIXXXXXXXX 80
           +GL SL +AKY LP  L+YGKT      G    W    + +VP+ YF+HFY+        
Sbjct: 38  IGLFSLWLAKYRLPKLLQYGKTRQKKLVGVIEPW--YTSIAVPRRYFSHFYVLSFVLATA 95

Query: 81  XXXXYPTDILVWQLFLHSSRRLYETLYISKYTEKSKMNWSHYAVGLWFYSQLNILVYLRV 140
               +P D++   +F HS RRL E+  ++K+  +S+M+ +HY VGLWFYS LN+ VYL++
Sbjct: 96  NLYWFPEDVITSCIFFHSLRRLVESARVTKWGSESRMHAAHYLVGLWFYSVLNLSVYLQL 155

Query: 141 ---QRENTTARVLPILVMV------LASWDQYKNHVVLSKLKKYSLPRSRLFELVCCPHY 191
              QR  + + V  +   V      LASWDQ +NH+ L+ + KY+LPR  LF++V C HY
Sbjct: 156 NSRQRTRSPSTVNKVFGAVGAVGFLLASWDQARNHIHLAHMIKYTLPRRGLFKIVACAHY 215

Query: 192 LDEMIIYGSLVSYGHEFVWPL----IWVIASLSISALESRKFYLSKFKDTEVPRYAAI 245
            DE++IY SL +      W L    IWV A+L +SA+E++++Y +KFK   V  YA I
Sbjct: 216 FDEIVIYASLAAMEATTRWSLTVAVIWVCANLGVSAVETKRYYDAKFKGQAVAPYALI 273

>Kwal_23.5825
          Length = 243

 Score =  161 bits (408), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 101/232 (43%), Positives = 135/232 (58%), Gaps = 8/232 (3%)

Query: 18  SNIVGLMSLIIAKYYLPDFLRYGKTFTFAKNGNENIWDKIKNFSVPKSYFAHFYIXXXXX 77
           S +VG+ S+ +AK+ LP  L+YGKT   ++   + +    +  +VPK +F HFY+     
Sbjct: 12  SFLVGIASVHLAKWQLPALLKYGKTLEGSRT-QKGLLGFFEQLTVPKQWFTHFYVYSTTL 70

Query: 78  XXXXXXXYPTDILVWQLFL-HSSRRLYETLYISKYTEKSKMNWSHYAVGLWFYSQLNILV 136
                  Y    LV  LFL HS RRLYET  ++KY E S+M+ SHY VGLWFYS  N  V
Sbjct: 71  AILNV--YCQRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVGLWFYSVANWAV 128

Query: 137 YLRVQRENTT-ARVLPILVMVLASWDQYKNHVVLSKLKKYSLPRSRLFELVCCPHYLDEM 195
           +    R      R L +LV  L+S DQY NH+ LSKL KY++P   LF +   PHY DE+
Sbjct: 129 FESKSRSQLPLVRFLAVLVFALSSVDQYMNHLHLSKLVKYTMPTYGLFSITTSPHYFDEV 188

Query: 196 IIYGSLVSYGH--EFVWPLIWVIASLSISALESRKFYLSKFKDTEVPRYAAI 245
           ++Y SL +Y    +    L+WVI +LS SALE+R +YL KF  T  P YA I
Sbjct: 189 LLYLSLTAYTGSLKLFACLVWVIVNLSTSALETRAWYLKKFPQT-TPPYAII 239

>Sklu_1893.3 YIL049W, Contig c1893 3492-4337
          Length = 281

 Score =  161 bits (408), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 91/266 (34%), Positives = 148/266 (55%), Gaps = 31/266 (11%)

Query: 3   DNSNILQLITICLRLSNIVGLMSLIIAKYYLPDFLRYGKTFTFAKN----GNE------- 51
           D    ++ IT+ +  S +V +  +++AK+ L  FL+YGKT     +    GNE       
Sbjct: 6   DMDRAIKCITLLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREMT 65

Query: 52  ---NIWDKIKNFSVPKSYFAHFYIXXXXXXXXXXXXYPTDILVWQLFLHSSRRLYETLYI 108
               I D  ++  VP+++F+HFYI            YP  ++ W    HS RRLYE+  I
Sbjct: 66  NVLQILDFFESIVVPRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLYESYCI 125

Query: 109 SKYTEKSKMNWSHYAVGLWFYSQLNILVYLRVQRE--------NTTARVLPILVMVLASW 160
           SK+  +SKMN SHY VG+WFY+ LN++  + + ++        N+  +++ + V + +S+
Sbjct: 126 SKFGAESKMNISHYLVGIWFYTSLNLIFSIGLSKDNKITSLSSNSAFQLIALFVFLASSY 185

Query: 161 DQYKNHVVLSKLKKYSLPRSRLFELVCCPHYLDEMIIYGSLVSYGH---------EFVWP 211
           +QY+NHV LS+L KY+ P+  LF+ V C HY DE++IY SL  Y              + 
Sbjct: 186 NQYQNHVYLSQLVKYTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLADGLKYC 245

Query: 212 LIWVIASLSISALESRKFYLSKFKDT 237
           L+WV  +LS+SA+E+R +Y  +++D 
Sbjct: 246 LLWVGINLSVSAIETRNYYSHRYQDV 271

>KLLA0C08261g complement(724399..725100) similar to sp|P40526
           Saccharomyces cerevisiae YIL049w DFG10 singleton, start
           by similarity
          Length = 233

 Score =  130 bits (326), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 131/231 (56%), Gaps = 15/231 (6%)

Query: 8   LQLITICLRLSNIVGLMSLIIAKYYLPDFLRYGKTFTFAKNGNENIWDKIKNFSVPKSYF 67
           + +  I L  +  VG++S+ +A++Y+P  L+YGKT+      + N W  +   + PKS F
Sbjct: 1   MDIFQILLYSTFYVGIISVFVAEFYIPQLLKYGKTW----EASNNFWYSL---TCPKSNF 53

Query: 68  AHFYIXXXXXXXXXXXXYPTDILVWQLFLHSSRRLYETLYISKYTEKSKMNWSHYAVGLW 127
            HFY+            +   +L   +F+HS RRLYE   ++K+ + SK++ SHY VG+W
Sbjct: 54  GHFYLLSSIFSIYNLL-WIRSLLTLSVFIHSVRRLYECYCVTKWGQ-SKIHLSHYLVGIW 111

Query: 128 FYSQLNILVYLRVQRENTTARVLPILVMVLASWDQYKNHVVLSKLKKYSLPRSRLFELVC 187
           FY+ LN+ + L      T   ++ +++ +++S DQ  NH  LSKLKKYS P   LF+ +C
Sbjct: 112 FYTTLNLGIMLY--HGETQYSLISVILFIMSSLDQATNHDYLSKLKKYSQPSYGLFKYIC 169

Query: 188 CPHYLDEMIIYGS--LVSYGHE--FVWPLIWVIASLSISALESRKFYLSKF 234
             HY DE++IY S  L+  G     +  ++W++ +L  S+ E+  +Y  KF
Sbjct: 170 SAHYFDELLIYTSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQEKF 220

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.140    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,907,052
Number of extensions: 311456
Number of successful extensions: 935
Number of sequences better than 10.0: 12
Number of HSP's gapped: 915
Number of HSP's successfully gapped: 12
Length of query: 245
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 146
Effective length of database: 13,168,927
Effective search space: 1922663342
Effective search space used: 1922663342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 60 (27.7 bits)