Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L00671g54353527320.0
Scas_704.3654551720030.0
YER056C (FCY2)53352119670.0
Scas_715.47d53351719340.0
YER060W (FCY21)52851519080.0
Scas_715.4953251518930.0
YER060W-A (FCY22)53051218650.0
CAGL0J02948g51551518470.0
Sklu_1893.251349518360.0
Kwal_23.581951651717000.0
CAGL0C00231g54048616990.0
KLLA0C08283g51951616930.0
Scas_715.47d152351616150.0
Kwal_34.1573051851015830.0
ADL074W52449614910.0
Scas_715.54d2322236403e-80
Kwal_47.172165425075731e-66
KLLA0D05060g5234995466e-63
YGL186C (TPN1)5795204552e-49
CAGL0L06138g6314564362e-46
Scas_710.305844124244e-45
Scas_701.168602163e-21
Scas_690.1*636602244e-19
Scas_705.2531078673.5
Scas_715.2731587664.4
Kwal_26.752539248664.9
KLLA0E03465g50356648.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L00671g
         (535 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomy...  1056   0.0  
Scas_704.36                                                           776   0.0  
YER056C (FCY2) [1485] chr5 complement(266511..268112) Cytosine/p...   762   0.0  
Scas_715.47d                                                          749   0.0  
YER060W (FCY21) [1490] chr5 (274565..276151) Protein with simila...   739   0.0  
Scas_715.49                                                           733   0.0  
YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine p...   723   0.0  
CAGL0J02948g 282559..284106 highly similar to sp|P40039 Saccharo...   716   0.0  
Sklu_1893.2 YER056C, Contig c1893 1725-3266                           711   0.0  
Kwal_23.5819                                                          659   0.0  
CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces cer...   659   0.0  
KLLA0C08283g complement(725563..727122) similar to sp|P17064 Sac...   656   0.0  
Scas_715.47d1                                                         626   0.0  
Kwal_34.15730                                                         614   0.0  
ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH] complement(...   578   0.0  
Scas_715.54d                                                          251   3e-80
Kwal_47.17216                                                         225   1e-66
KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces c...   214   6e-63
YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of ...   179   2e-49
CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces c...   172   2e-46
Scas_710.30                                                           167   4e-45
Scas_701.1                                                             88   3e-21
Scas_690.1*                                                            91   4e-19
Scas_705.25                                                            30   3.5  
Scas_715.27                                                            30   4.4  
Kwal_26.7525                                                           30   4.9  
KLLA0E03465g 321977..323488 similar to sp|P38758 Saccharomyces c...    29   8.5  

>CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomyces
           cerevisiae YER056c FCY2 purine-cytosine permease or
           sp|P40039 Saccharomyces cerevisiae YER060w FCY21,
           hypothetical start
          Length = 543

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/535 (97%), Positives = 521/535 (97%)

Query: 1   MELNYRXXXXXXXXXXXXXXYELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAAT 60
           MELNYR              YELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAAT
Sbjct: 1   MELNYRNHDHSGSDGSHSNDYELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAAT 60

Query: 61  VEETKLKLGFISRLALKMNAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGAL 120
           VEETKLKLGFISRLALKMNAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGAL
Sbjct: 61  VEETKLKLGFISRLALKMNAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGAL 120

Query: 121 GPIVFRLNFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAI 180
           GPIVFRLNFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAI
Sbjct: 121 GPIVFRLNFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAI 180

Query: 181 NVVACVGWGVVNTVVAAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERW 240
           NVVACVGWGVVNTVVAAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERW
Sbjct: 181 NVVACVGWGVVNTVVAAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERW 240

Query: 241 SWVPNFAVFLVIIARLHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTV 300
           SWVPNFAVFLVIIARLHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTV
Sbjct: 241 SWVPNFAVFLVIIARLHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTV 300

Query: 301 YMPRTMNKFKIFFFLCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAIL 360
           YMPRTMNKFKIFFFLCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAIL
Sbjct: 301 YMPRTMNKFKIFFFLCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAIL 360

Query: 361 VPNSLHGFGEFCCVLLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVG 420
           VPNSLHGFGEFCCVLLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVG
Sbjct: 361 VPNSLHGFGEFCCVLLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVG 420

Query: 421 ISIPASYYFEGFLENFMDSIGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGI 480
           ISIPASYYFEGFLENFMDSIGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGI
Sbjct: 421 ISIPASYYFEGFLENFMDSIGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGI 480

Query: 481 AGCSALFVGAFGVALGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
           AGCSALFVGAFGVALGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP
Sbjct: 481 AGCSALFVGAFGVALGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535

>Scas_704.36
          Length = 545

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/517 (73%), Positives = 439/517 (84%), Gaps = 11/517 (2%)

Query: 21  YELNEV-EKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAAT-VEETKLKLGFISRLALKM 78
           YE+N   EK    D+K       D+     D++ +  E  T +EETKL   F +R    +
Sbjct: 30  YEMNSFGEKASSADIKVIP-GVPDY-----DEYESIQEPETYMEETKLS--FFNRFVASL 81

Query: 79  NAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVF 138
           NAETKGVEPVTDEEKTDDS++NAASMWFSANLV+ASYALG LGPIVF LNFGTSVL I+F
Sbjct: 82  NAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVIIF 141

Query: 139 FNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQ 198
           FN++GL+S+AFFSVFGAEFGLRQMILSR+L+GN+TAR+FA IN++ACVGWGVVNTV ++Q
Sbjct: 142 FNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNITARIFAIINIIACVGWGVVNTVASSQ 201

Query: 199 LLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHK 258
           LL++VN   +  PLW GCL+IVG TV+VTFFGY++IHAYE+WSWVPNFAVFLVIIARL  
Sbjct: 202 LLNMVNT-PNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIARLKM 260

Query: 259 SGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAG 318
           SG F+ G WTSG TTAG VLSFG A++GFAAGWTTYAADYTVYMPR+ NK+ IFF L AG
Sbjct: 261 SGAFTGGEWTSGPTTAGNVLSFGGAVFGFAAGWTTYAADYTVYMPRSTNKYTIFFSLTAG 320

Query: 319 LAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAM 378
           L+ PL FTMILGAASAMGAVNNP+WM  Y  + MGG+TYAILVP+SLHGFG+FCCVLLAM
Sbjct: 321 LSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCVLLAM 380

Query: 379 STIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMD 438
           ST+ANNIPNMYTIALSVQALY+PFS+VPRV WT+AGNA  +GISI A YYF+GF+ENFM+
Sbjct: 381 STVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFMENFMN 440

Query: 439 SIGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMS 498
           SIGYYLAIYIAISLSEHFIYR+GF+GYN+EDWN W +LPIGIAG SAL VGAFGVALGMS
Sbjct: 441 SIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMS 500

Query: 499 QTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
           Q+YW GEI + IG HGGDIGFELG SWAFIV+N++RP
Sbjct: 501 QSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRP 537

>YER056C (FCY2) [1485] chr5 complement(266511..268112)
           Cytosine/purine permease, member of the purine/cytosine
           permease family of membrane transporters [1602 bp, 533
           aa]
          Length = 533

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/521 (71%), Positives = 441/521 (84%), Gaps = 10/521 (1%)

Query: 21  YELNEVEKQ-PVEDVKTTNVNTNDFEYDYGDDFTNSSEAAT---VEETK-LKLGFISRLA 75
           YE+ ++EK+ PV      N    + +    + FT +SE      VE ++  KL +  +  
Sbjct: 9   YEIQDLEKRSPVIGSSLEN----EKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFF 64

Query: 76  LKMNAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLT 135
             +NAETKGVEPVT++EKTDDS+LNAASMWFSAN+V+ASYALGALGP+VF LNFG SVL 
Sbjct: 65  ASLNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLV 124

Query: 136 IVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVV 195
           I+FFN++GL+ VAFFSVFGAE GLRQMILSR+LVGNVTAR+F+ INV+ACVGWG+VNT V
Sbjct: 125 IIFFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSV 184

Query: 196 AAQLLHIVNQGS-HQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIA 254
           +AQLL++VN+GS H  P+W GCL+I+GGTV+VTFFGYS+IHAYE+WSWVPNFAVFLVIIA
Sbjct: 185 SAQLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIA 244

Query: 255 RLHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFF 314
           +L +SG+F  G W  GATTAG VLSFGS+I+GFAAGWTTYAADYTVYMP++ NK+KIFF 
Sbjct: 245 QLSRSGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFS 304

Query: 315 LCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCV 374
           L AGLAFPL FTMILGAASAM A+N+P W A YDK+ MGG+ YAILVPNSL+GFG+FCCV
Sbjct: 305 LVAGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCV 364

Query: 375 LLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLE 434
           LLA+STIANNIPNMYT+ALS QAL+ P +++PRVVWT+AGNAA +GISIPA+YYF+GF+E
Sbjct: 365 LLALSTIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFME 424

Query: 435 NFMDSIGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVA 494
           NFMDSIGYYLAIYIAIS SEHF YRR F  YNI+DW+NW+ LPIGIAG +AL VGAFGVA
Sbjct: 425 NFMDSIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVA 484

Query: 495 LGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
           LGM QTYW GEI R IGK+GGDIGFELG SWAFI++NI+RP
Sbjct: 485 LGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILRP 525

>Scas_715.47d
          Length = 533

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/517 (68%), Positives = 433/517 (83%), Gaps = 3/517 (0%)

Query: 21  YELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTN--SSEAATVEETKLKLGFISRLALKM 78
           YE+ ++E     + + +N+  ND + D G  F+N  +S     EET  K  F +RLA ++
Sbjct: 10  YEIQDLEMDLERNSEFSNL-PNDKKIDLGPTFSNEPASFIEITEETGSKFSFFNRLASQL 68

Query: 79  NAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVF 138
           NAETKG+E +TDEEKTD S+L+A SMWFSAN+V+++Y LG +GP+V+ LNFGT VLTI+F
Sbjct: 69  NAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGTCVLTIIF 128

Query: 139 FNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQ 198
           F+++GL+ VAFFS+FGA+FGLRQM+LSRFL+GN TAR+ A INV++ VGWGVVN+V ++Q
Sbjct: 129 FSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVVNSVASSQ 188

Query: 199 LLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHK 258
           LL++VNQG H  PLW GC++I+G T++VTFFGYS IHAYERWSWVPNFAVFLVIIARLH 
Sbjct: 189 LLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFLVIIARLHM 248

Query: 259 SGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAG 318
           SG FS G WTSG TTAG VLSFG AI+GFA GWT YAADYTVYMPR  NKFKIFF L  G
Sbjct: 249 SGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFKIFFSLVGG 308

Query: 319 LAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAM 378
           L+FPL F +ILGAASAMGAVNNP W   Y  + MGG+TYAILVP+SLHGFGEFCCVLLA+
Sbjct: 309 LSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGEFCCVLLAL 368

Query: 379 STIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMD 438
           STIANNIPNMY+I L+VQA++EP ++VPR +WTLAGNAA + ISIPA YYF+GF+E+FM+
Sbjct: 369 STIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFDGFMEDFMN 428

Query: 439 SIGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMS 498
           SIGYYLAIY A +L+EHFI+RRGFKGYN+EDW++  +LP+GIAGC+ALFVGAFGVALGMS
Sbjct: 429 SIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGAFGVALGMS 488

Query: 499 QTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
           QTYW GEI+RHIG++GGDIGFELG  WAF+V+ I+RP
Sbjct: 489 QTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRP 525

>YER060W (FCY21) [1490] chr5 (274565..276151) Protein with
           similarity to Fcy2p, member of the purine/cytosine
           family of secondary active transporters [1587 bp, 528
           aa]
          Length = 528

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/515 (68%), Positives = 431/515 (83%), Gaps = 11/515 (2%)

Query: 21  YELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAATVEETKLKLGFISRLALKMNA 80
           YEL ++E +   D KT +  TN+F   Y D  ++ +E    E  + KL F++R+A  ++A
Sbjct: 17  YELKDLESR-AHDAKTPS--TNEF---YDDVESHGTE----ELVEAKLSFLNRIAAGLSA 66

Query: 81  ETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFFN 140
           ETKG+EP+T++EKTDDS+LNAASMWFSAN+VL +YA+GALGP+VF LNFG SV  I+FFN
Sbjct: 67  ETKGIEPITEDEKTDDSILNAASMWFSANMVLPAYAIGALGPMVFDLNFGQSVFVIIFFN 126

Query: 141 MIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQLL 200
           ++GLVSVAFFSVFGAE GLRQMILSR+LVGN+ AR+F+ IN +AC+GWG+VNTV ++Q+L
Sbjct: 127 LLGLVSVAFFSVFGAELGLRQMILSRYLVGNIAARIFSFINFIACIGWGIVNTVASSQVL 186

Query: 201 HIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHKSG 260
           ++VN G HQ PLW GC+VI+G TV+VTFFGY +IHAYE+W+WVPNFAVFLVIIARL +S 
Sbjct: 187 NMVNPG-HQCPLWAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNFAVFLVIIARLARSK 245

Query: 261 QFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAGLA 320
           +F  G WTSG TTAG VLSFGS +YGFAAGWTTYAADYTVYMPR  NK+KIFF L  GLA
Sbjct: 246 KFVLGEWTSGPTTAGNVLSFGSTVYGFAAGWTTYAADYTVYMPRKTNKYKIFFSLVVGLA 305

Query: 321 FPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAMST 380
            PL FTMILGAA AM A+ +P W   YD++++GGLT+A+LVPNS+HGFG+FCCVLL++ST
Sbjct: 306 TPLYFTMILGAAVAMAAIGDPAWKTYYDENSIGGLTFAVLVPNSVHGFGQFCCVLLSLST 365

Query: 381 IANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMDSI 440
           IANN+PNMYTIALSVQA +EP ++VPRV+WTL GNAA +GI+IPA YYF  F+  FMDSI
Sbjct: 366 IANNVPNMYTIALSVQATWEPLAKVPRVIWTLLGNAAALGIAIPACYYFSTFMNYFMDSI 425

Query: 441 GYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQT 500
           GYYLAIYIAI+ SEHFIYRR F  YN++DW++W+RLPIGIAG +AL VGAFGVALGM QT
Sbjct: 426 GYYLAIYIAIACSEHFIYRRSFSAYNVDDWDSWERLPIGIAGTAALIVGAFGVALGMCQT 485

Query: 501 YWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
           YW GEISR IG +GGDIGFELG+SWAFIV+NI RP
Sbjct: 486 YWVGEISRLIGDYGGDIGFELGLSWAFIVYNIARP 520

>Scas_715.49
          Length = 532

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/515 (67%), Positives = 430/515 (83%), Gaps = 7/515 (1%)

Query: 21  YELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAATVEETKLKLGFISRLALKMNA 80
           YE+N++E+   +D+K+ + N +    DY  D  +S  +  V ETKL L   +R+A  ++A
Sbjct: 17  YEMNDLERNS-KDLKSPSKNLSS---DYYVDI-DSHASEEVLETKLNL--FNRIAAGLSA 69

Query: 81  ETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFFN 140
           ETKG+EP+TDEEK D S+LNAASMWFSAN+V+A+YA+G LGP+VF LNFGTS L I+FFN
Sbjct: 70  ETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFN 129

Query: 141 MIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQLL 200
           ++GL+ VAFFS+FGA+ GLRQM+LSRFL+GN TAR+F+ IN VACVGWG+VNTV ++QLL
Sbjct: 130 ILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLL 189

Query: 201 HIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHKSG 260
           ++VNQG H+ PLW GC+VI+G T+++TFFGY +IH++E+W WVPNFA FLVIIARL KSG
Sbjct: 190 NMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAKSG 249

Query: 261 QFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAGLA 320
            FSNG WTSG TTAG VLSFGSA++GFA GWTTYAADYTVYMPR  NKFKIFF L AGL+
Sbjct: 250 NFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLS 309

Query: 321 FPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAMST 380
           FPL F MILGAASAMGAVNNP+W   Y ++ MGGLTYAILVPNSLHGFGEFCCV+L++S 
Sbjct: 310 FPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISI 369

Query: 381 IANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMDSI 440
           +ANN+PNMYTIALSVQA++ P +++PRV WT+AGN A +GI+IPA Y+F+ F+E FMDSI
Sbjct: 370 VANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDSI 429

Query: 441 GYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQT 500
            YYLAIYI+I+LSEHFIYRR F+ YN+EDW++  +LPIGIAGC A  VG  GVALGM QT
Sbjct: 430 AYYLAIYISIALSEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQT 489

Query: 501 YWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
           YWTG+I R IG++GGD+GFELG  W+FIV+N+VRP
Sbjct: 490 YWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRP 524

>YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine
           permease with similarity to Fcy2p, member of the
           purine/cytosine subfamily of the nucleobase:cation
           symporter-1 (NCS1) family [1593 bp, 530 aa]
          Length = 530

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/512 (66%), Positives = 420/512 (82%), Gaps = 9/512 (1%)

Query: 33  DVKTTNVNTNDFEYDYGDDFTNSSEA--------ATVEETKLKLGFISRLALKMNAETKG 84
           D+K       D E    D  +++++          T E    K  F +R+A  +NAETKG
Sbjct: 11  DIKDAGSELRDLESGALDTKSSAADVYYEGVELHRTNEFIDNKPSFFNRIAAALNAETKG 70

Query: 85  VEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFFNMIGL 144
           +EPVT++EK DDS+LNAA++WFSAN+V+ +Y++GALGP+VF LNFG SVL I+FFN++GL
Sbjct: 71  IEPVTEDEKNDDSILNAATIWFSANMVIVAYSVGALGPLVFGLNFGQSVLVIIFFNILGL 130

Query: 145 VSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQLLHIVN 204
           + VA FS+FG E GLRQMILSR+L GN+TAR F+ +NV+ACVGW V+N  V+AQLL++VN
Sbjct: 131 IPVALFSLFGVELGLRQMILSRYLAGNITARFFSLVNVIACVGWCVLNISVSAQLLNMVN 190

Query: 205 QGS-HQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHKSGQFS 263
           +GS H  P+W GCL+I GGTV+VTFFGYS++HAYE+WSWVPNFA FLVIIA+L +SG+F 
Sbjct: 191 EGSGHNCPIWAGCLIIAGGTVLVTFFGYSVVHAYEKWSWVPNFAAFLVIIAQLSRSGKFK 250

Query: 264 NGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAGLAFPL 323
            G W  GATTAGGVLSFGS+++G AAGW TYAADYTVYMP+T +K+KIFF + AGLAFPL
Sbjct: 251 GGEWVGGATTAGGVLSFGSSVFGSAAGWATYAADYTVYMPKTTSKYKIFFSVVAGLAFPL 310

Query: 324 LFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAMSTIAN 383
            FTMILGAA  M A+N+P W + YDK+ MGG+ YAILVPNSL+GFG+FCCVLLA+ST+AN
Sbjct: 311 FFTMILGAACGMAALNDPTWKSYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALSTVAN 370

Query: 384 NIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMDSIGYY 443
           N+P MYT+ALS QAL+ P +++PRVVWT+AGNAA +GISIPA+YYF+GF+ENFMDSIGYY
Sbjct: 371 NVPGMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDSIGYY 430

Query: 444 LAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQTYWT 503
           LAIYIAI+ SEHFIYRR F  YNI+DW+NW+ LPIGIAG +AL  GAFGVALGM QTYW 
Sbjct: 431 LAIYIAIACSEHFIYRRSFSAYNIDDWDNWEHLPIGIAGTAALIAGAFGVALGMCQTYWV 490

Query: 504 GEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
           GEISR IG++GGDIGFELG SWAFI++NIVRP
Sbjct: 491 GEISRLIGEYGGDIGFELGGSWAFIIYNIVRP 522

>CAGL0J02948g 282559..284106 highly similar to sp|P40039
           Saccharomyces cerevisiae YER060w or sp|P17064
           Saccharomyces cerevisiae YER056c FCY2, hypothetical
           start
          Length = 515

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/515 (67%), Positives = 422/515 (81%), Gaps = 16/515 (3%)

Query: 22  ELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAATVEETKLKLGFISRLALKMNAE 81
           +L ++E Q VE    ++V T+     Y D        ATV ETKL L  ++RLA  ++AE
Sbjct: 8   DLYDMEMQ-VESSANSHVETDG----YND--------ATVLETKLSL--LNRLAAMISAE 52

Query: 82  TKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFFNM 141
           TKG+EP+TD+EK DDS++NAASMWFSAN+VL + A+G LGP+VF LNFG SVLTIVFFN+
Sbjct: 53  TKGIEPITDDEKNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFGVSVLTIVFFNI 112

Query: 142 IGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQLLH 201
           +GL +VAFFSVFGA+FGLRQM+LSR+LVGN+TAR+FA IN VACVGWG+VNTV A+QLL+
Sbjct: 113 LGLFAVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLN 172

Query: 202 IVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHKSGQ 261
            +N GSHQLPLWGGCLVI+G T++V+FFGY +IH YE++SWVPNFAVFLV+IARL  SG+
Sbjct: 173 EINPGSHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGK 232

Query: 262 FSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAGLAF 321
           F NG W SG TTAG VLSFGSA++GFA+GWTTYAADYTVYMPR  N +KIFF L AGLAF
Sbjct: 233 FHNGAWGSGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAF 292

Query: 322 PLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAMSTI 381
           PL FTMILG+A A  AV+   W   Y+K+ MGGLT+AILVP+SLHGFG+FCCV+LAMSTI
Sbjct: 293 PLFFTMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTI 352

Query: 382 ANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMDSIG 441
           ANN+PNMYTIALS Q++++PF+++PRVVWT+ GN A +GISIPA YYF  F++ FMDSI 
Sbjct: 353 ANNVPNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDSIA 412

Query: 442 YYLAIYIAISLSEHFIYRR-GFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQT 500
           YYL+IYI+I+L EH IYR   F  YN+EDWNN+ +LPIGIAG  +L VGAFGVALGMSQ+
Sbjct: 413 YYLSIYISIALCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQS 472

Query: 501 YWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
           YW GEI+RHIG++GGDI  ELG  WAFI +NI RP
Sbjct: 473 YWVGEIARHIGEYGGDIAIELGAGWAFIAYNICRP 507

>Sklu_1893.2 YER056C, Contig c1893 1725-3266
          Length = 513

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/495 (67%), Positives = 403/495 (81%), Gaps = 1/495 (0%)

Query: 42  NDFEYDYGDDFTNSSEAATVEETKLK-LGFISRLALKMNAETKGVEPVTDEEKTDDSVLN 100
            D E     + T +     VE T+   + FI R A K+ AETKG+EP+TDEEK DDS+LN
Sbjct: 11  QDMEKQNPLELTETDSTPVVESTEYTTVSFIDRWAAKLKAETKGIEPITDEEKDDDSILN 70

Query: 101 AASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGLR 160
           AASMWFSAN+V+A+YALG LG  VF LNF  SVLTI+FF+ +GL+ VAFFSVFGAE G+R
Sbjct: 71  AASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVAFFSVFGAELGMR 130

Query: 161 QMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQLLHIVNQGSHQLPLWGGCLVIV 220
           QM+LSRFL+GNVTAR+FA INV+ACVGWG VNT+ +A LLH++N G  Q P W  CL+IV
Sbjct: 131 QMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGGAQCPPWAACLIIV 190

Query: 221 GGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHKSGQFSNGPWTSGATTAGGVLSF 280
             T++VTFFGY +IHAYE+WSWVPNFAVFLVIIARL  SG FS G WTSGATTAGGVLSF
Sbjct: 191 FSTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTGEWTSGATTAGGVLSF 250

Query: 281 GSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAGLAFPLLFTMILGAASAMGAVNN 340
           G +I+GFA+GWTTYAADYTVYMPR+ NK+KIFF L  GLAFPL F++ILGAAS  G   N
Sbjct: 251 GGSIFGFASGWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLILGAASIAGIEKN 310

Query: 341 PEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAMSTIANNIPNMYTIALSVQALYE 400
             W   Y+  ++GGL YAILV +SLHGFGEFCCVLLAMST+ANNIPNMY+IAL  Q+++E
Sbjct: 311 ALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNMYSIALGTQSMWE 370

Query: 401 PFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMDSIGYYLAIYIAISLSEHFIYRR 460
           P ++VPRV WT+AGN   + I+IPA Y FE F+ +FM++I YYLAIYIAISLSEHF YR+
Sbjct: 371 PLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEAIAYYLAIYIAISLSEHFFYRK 430

Query: 461 GFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQTYWTGEISRHIGKHGGDIGFE 520
           GFKGYN++DWN WDRLPIG AGC+ALF+GAFGVA GMSQTYW G+I+RHIG++GGDIGFE
Sbjct: 431 GFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQIARHIGEYGGDIGFE 490

Query: 521 LGMSWAFIVFNIVRP 535
           LGM ++FI +NI+RP
Sbjct: 491 LGMGFSFITYNILRP 505

>Kwal_23.5819
          Length = 516

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/517 (60%), Positives = 398/517 (76%), Gaps = 18/517 (3%)

Query: 21  YELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAATVEETK-LKLGFISRLALKMN 79
           YE+ +VEK+         +N+    ++  DD         VE T+  KL  + R+A  + 
Sbjct: 8   YEIQDVEKR---------LNS---RFEISDD----DSQPVVESTEYTKLSIVDRIAASLR 51

Query: 80  AETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFF 139
           AETKG+EPVT+EEK DDS+ NAASMWFSAN+V+A+++LG LGP+V+ LNF   VL +V F
Sbjct: 52  AETKGIEPVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLF 111

Query: 140 NMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQL 199
           + +G++ VA++SVFGAE GLRQM+LSRFL+GNVTAR+FA IN++ACVGWG VNT+ +AQL
Sbjct: 112 SALGVIPVAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQL 171

Query: 200 LHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHKS 259
           LH++N G  + P W GCL+IV  T++VTFFGY +IHAYE+WSW+PNFAVFLVIIARL   
Sbjct: 172 LHMINPGGARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKID 231

Query: 260 GQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAGL 319
           G FS+G W SG   A  VLSFG  I+GFA+GWTTYAADYTVYMPRT NK K+FF +  GL
Sbjct: 232 GSFSSGEWISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGL 291

Query: 320 AFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAMS 379
            FPL F++ILGAA+AM + NN E+  L+D   +GGL YAILV NSLHGFG+FCCVLLAMS
Sbjct: 292 MFPLCFSIILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMS 351

Query: 380 TIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMDS 439
           T+ANNIPNMY+IAL  QAL+EP +++PRV WT+AGN   + I+IPA Y F  F+ NFMD+
Sbjct: 352 TVANNIPNMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDA 411

Query: 440 IGYYLAIYIAISLSEHFIYRR-GFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMS 498
           I YYL+IYI ISLSEH  +R+  F+ YN++DWN WD+LPIG AGC ALFVGA GVA+GM 
Sbjct: 412 IAYYLSIYIGISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYAGCCALFVGAVGVAVGME 471

Query: 499 QTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
           QTYWTG+I+R IG +G DIGFE+G  ++ IV+NI+RP
Sbjct: 472 QTYWTGQIARKIGDYGADIGFEIGFCFSVIVYNILRP 508

>CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces
           cerevisiae YER060w or sp|P17064 Saccharomyces cerevisiae
           YER056c, hypothetical start
          Length = 540

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/486 (64%), Positives = 392/486 (80%)

Query: 50  DDFTNSSEAATVEETKLKLGFISRLALKMNAETKGVEPVTDEEKTDDSVLNAASMWFSAN 109
           ++  N S     +ET  K  FI  L   +NAETKGVEP+ + EK D ++  ++ +WFSAN
Sbjct: 47  NELDNKSTETDKDETCFKSPFIIWLKRTLNAETKGVEPINENEKNDTNIFGSSFVWFSAN 106

Query: 110 LVLASYALGALGPIVFRLNFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLV 169
           LVLA+Y +G+LGP V+ LNF  SVLTIVFFN++GLVSV+FFSVFGAE GLRQMI+SR+LV
Sbjct: 107 LVLAAYGVGSLGPTVYHLNFAISVLTIVFFNILGLVSVSFFSVFGAELGLRQMIISRYLV 166

Query: 170 GNVTARVFAAINVVACVGWGVVNTVVAAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFF 229
           GNVTAR+FAA+N + CVGW V+N  +AA+L  I+  G + LPLWGGC+VIVG TV +   
Sbjct: 167 GNVTARIFAALNCIGCVGWDVLNIYLAAKLFAIIKTGGNHLPLWGGCIVIVGSTVFIAAL 226

Query: 230 GYSIIHAYERWSWVPNFAVFLVIIARLHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAA 289
           GY  IH YE+WSW+PN AVFL+II+R+  S +FSNGPWTSG+TTAG VLSFGSAI+G AA
Sbjct: 227 GYKFIHIYEKWSWIPNLAVFLIIISRIKISREFSNGPWTSGSTTAGNVLSFGSAIFGSAA 286

Query: 290 GWTTYAADYTVYMPRTMNKFKIFFFLCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDK 349
           GW TY+ADYTVYMPR  NKF+IFFF   GLAF L+FTMI+GAA+ + AVNN +WM LY++
Sbjct: 287 GWVTYSADYTVYMPRRTNKFRIFFFNSIGLAFSLIFTMIVGAAAGICAVNNSKWMELYNE 346

Query: 350 DNMGGLTYAILVPNSLHGFGEFCCVLLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVV 409
             +GG+TYA+LVPNSLHGFG+FCCV+LAMST+ANN+P+MYTIALSVQAL+EP + VPR +
Sbjct: 347 FQIGGVTYALLVPNSLHGFGKFCCVILAMSTVANNVPSMYTIALSVQALWEPLTSVPRAI 406

Query: 410 WTLAGNAAVVGISIPASYYFEGFLENFMDSIGYYLAIYIAISLSEHFIYRRGFKGYNIED 469
           WT+  N  V+GISIPA Y+F+ F++NFM SIGY+ A+YI ISL+EH ++RR F  YN+ D
Sbjct: 407 WTIFANIVVLGISIPACYFFQSFMQNFMGSIGYFYALYIGISLAEHCVFRRKFGNYNVND 466

Query: 470 WNNWDRLPIGIAGCSALFVGAFGVALGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIV 529
            +NW++LPIG AGC AL VG+FGVALGM+QTYW GEI+R IG +GGDIGFELGMSWAF+ 
Sbjct: 467 HSNWEKLPIGFAGCIALIVGSFGVALGMAQTYWVGEIARKIGTYGGDIGFELGMSWAFLT 526

Query: 530 FNIVRP 535
           + I+RP
Sbjct: 527 YIIIRP 532

>KLLA0C08283g complement(725563..727122) similar to sp|P17064
           Saccharomyces cerevisiae YER056c FCY2 purine-cytosine
           permease, start by similarity
          Length = 519

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/516 (62%), Positives = 399/516 (77%), Gaps = 15/516 (2%)

Query: 21  YELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAATVEETKL-KLGFISRLALKMN 79
           Y L++VEKQ +   +   V                 E   VE T++ KL ++  LA K++
Sbjct: 10  YVLHDVEKQELSKTQFDEVL--------------EEEPVIVETTEVTKLSWVDHLASKLH 55

Query: 80  AETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFF 139
           AETKG+EP+TD+EK DD +LNAASMW SANLV+A+++LG +G  VF LNFG +VL IVFF
Sbjct: 56  AETKGIEPITDDEKDDDDILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFF 115

Query: 140 NMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQL 199
           + +GL+ VAFFSVFGAE GLRQ++LSRFL+GNVTAR+F  IN++ACVGWG VNT+ +A L
Sbjct: 116 SFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASL 175

Query: 200 LHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHKS 259
           LHIVN      P W GCL+I+ GT++VTFFGY +IHAYE+WSWVPNFAVFLVIIARL K+
Sbjct: 176 LHIVNPSGPDCPPWAGCLIIIFGTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLAKA 235

Query: 260 GQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAGL 319
           G F+ G W SG+TTAGGVLSFGS+++GFA GWTTYA+DYTVYMPRT NK K+F  +  GL
Sbjct: 236 GTFTAGSWGSGSTTAGGVLSFGSSVFGFATGWTTYASDYTVYMPRTTNKKKVFAAIVLGL 295

Query: 320 AFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAMS 379
           AFPL F+MILGAA+  G   N  W  LYDK ++GGL YAIL+ +SL GFG FCCV+LA+S
Sbjct: 296 AFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALS 355

Query: 380 TIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMDS 439
           TI+NNIPNMY+IAL  QAL+EP ++VPRV WT+ GN   + I+IPA Y FE F+  FMDS
Sbjct: 356 TISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDS 415

Query: 440 IGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQ 499
           IGYYLAIY AI+LSEHFIYR GFKGYN++DW+ WD+LPIG AG  ALF+GAFGVA GM+Q
Sbjct: 416 IGYYLAIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQ 475

Query: 500 TYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
            YW G+I R IG++GGDIGFELG  +AFI +NI RP
Sbjct: 476 IYWQGQIGRLIGENGGDIGFELGAGFAFITYNIFRP 511

>Scas_715.47d1
          Length = 523

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/516 (57%), Positives = 380/516 (73%), Gaps = 9/516 (1%)

Query: 21  YELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAATVEETKLKLGFISRLALKMNA 80
           ++  ++EKQ    V    + +ND   +  DDF+      TV      + F+ ++A ++NA
Sbjct: 8   FKTTDLEKQDPAFVANEAI-SNDTTGE--DDFSK-----TVSSEASNIAFLQKIATRLNA 59

Query: 81  ETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFFN 140
           ET+G+EPV D+EKTD ++ N   +WFSAN V+++YA+GALGP+VF LNFG + LTIVFFN
Sbjct: 60  ETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFN 119

Query: 141 MIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQLL 200
           +IG+V VA+FS+FG E GLRQM+LSR+LVGN+  R F+ IN +ACVGW V+N++ +AQLL
Sbjct: 120 IIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLL 179

Query: 201 HIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHKSG 260
           ++VN   H+ P W G +V+V GT++VTFFG  +I A+ERWSWVPN AVFLVIIARLHKSG
Sbjct: 180 NMVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVIIARLHKSG 239

Query: 261 QFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAGLA 320
           QFS G WTSG TTAG VLS G   YG+A  W TY+ADYTVYMPR  NK K+FF LC  L 
Sbjct: 240 QFSGGKWTSGPTTAGNVLSLGCVAYGYAGAWATYSADYTVYMPRNTNKVKLFFGLCVALT 299

Query: 321 FPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAMST 380
            PL FTMILGAA  MG VNN  W   Y  + +GGLTY +LVPNS+HGFGEFCCVLLA+ST
Sbjct: 300 VPLCFTMILGAAVGMGGVNNATWAKYYSSNGIGGLTYEVLVPNSVHGFGEFCCVLLALST 359

Query: 381 IANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMDSI 440
           IANN PNMYT+  S QA++EP +RVPR   TL GNAAV  +   A YYF+ F+E FMD++
Sbjct: 360 IANNTPNMYTLGFSFQAIWEPLARVPRAFCTLFGNAAVFVVGCCACYYFDSFMEKFMDTL 419

Query: 441 GYYLAIYIAISLSEHFIYRR-GFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQ 499
            YY AIYI++ ++EH I+R+  FK Y+++DW  + +LPIGIAG    FV AFGVALGM Q
Sbjct: 420 AYYGAIYISLGMAEHLIFRKCSFKAYDVKDWKTFSKLPIGIAGGVGFFVAAFGVALGMCQ 479

Query: 500 TYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
           +YW GEI R IGK GGD+GFE+G +W FI + +VRP
Sbjct: 480 SYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 515

>Kwal_34.15730
          Length = 518

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/510 (58%), Positives = 387/510 (75%), Gaps = 4/510 (0%)

Query: 27  EKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAATVEETKLKLGFISRLALKMNAETKGVE 86
           +K  V+D++   +N    E    DD T  S  A  +     +  ++RLA K+ AETKG+E
Sbjct: 4   DKYEVQDLE---LNVYSQENTSADDATRGSSQAPEKLNGGGMAVLNRLAKKLRAETKGIE 60

Query: 87  PVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFFNMIGLVS 146
           PVT++EK D S+ NAA +WFSAN+V+A++++G LGP+VF LNF   V++IV F  IG++ 
Sbjct: 61  PVTEDEKDDSSIWNAAFVWFSANMVIAAFSVGMLGPLVFSLNFWGCVVSIVIFTFIGVLP 120

Query: 147 VAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQLLHIVNQG 206
           V  +SVFG +  LRQM+LSRFL+GNVTAR+FA INV+AC+GWGVVNTV +AQLLH++N  
Sbjct: 121 VCLYSVFGVQLSLRQMVLSRFLLGNVTARIFALINVIACIGWGVVNTVTSAQLLHMINPT 180

Query: 207 SHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHKSGQFSNGP 266
             + P W GCL+IV  T+ VTFFGY +IH + ++SW+PNF VF+VIIARL   G FS G 
Sbjct: 181 GGRCPPWAGCLIIVFSTIFVTFFGYRVIHTFGKYSWIPNFIVFIVIIARLKIDGSFSVGK 240

Query: 267 WTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAGLAFPLLFT 326
           W SG+TTAG +LS G  ++GFA GWTTYAAD+TVYMPRT+N+ ++FF +  GL FPL FT
Sbjct: 241 WESGSTTAGSILSLGGIVFGFATGWTTYAADFTVYMPRTVNRAEVFFAVMLGLVFPLCFT 300

Query: 327 MILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAMSTIANNIP 386
           +ILGAA+   A+NNP +   Y+ D+ GGL YAILVP SLHGFG+FCCVLLAMST+AN +P
Sbjct: 301 IILGAAAGCAALNNPVYHEFYESDHAGGLVYAILVPRSLHGFGQFCCVLLAMSTVANMVP 360

Query: 387 NMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMDSIGYYLAI 446
           NMY+IAL  QAL+EP ++VPRV WTLAGN   + I+IPA Y FE F+ NFMDSI YYL+I
Sbjct: 361 NMYSIALGTQALWEPLAKVPRVFWTLAGNLITLAIAIPAYYRFEAFMTNFMDSIAYYLSI 420

Query: 447 YIAISLSEHFIYRRG-FKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQTYWTGE 505
           YI +SLSEHFI+R+  F  Y+  +WN+W RLP+G AGC+ALFVGA GVALGM QTYWTGE
Sbjct: 421 YIGVSLSEHFIFRQNKFSNYDTSEWNDWHRLPLGYAGCAALFVGAIGVALGMHQTYWTGE 480

Query: 506 ISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
           I R IG+ GGDIGFELG++++ IV+  +RP
Sbjct: 481 IGRLIGEFGGDIGFELGLAFSMIVYTALRP 510

>ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH]
           complement(551981..553555) [1575 bp, 524 aa]
          Length = 524

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/496 (57%), Positives = 368/496 (74%), Gaps = 7/496 (1%)

Query: 43  DFEYDYGDDFTNSSEAAT--VEETK-LKLGFISRLALKMNAETKGVEPVTDEEKTDDSVL 99
           D E   G   +++ E  T  V+ET+   L +++R A ++NAETKGV PVT++E  D S+L
Sbjct: 25  DLEKKKGF-LSDAEEPVTPQVDETEYTTLSWVNRWAARLNAETKGVSPVTEDECHDSSLL 83

Query: 100 NAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGL 159
           NAASMWFSANLV+A++A+G L   VFRLN   +VL  V F+ +G+++VAFFSVFGAEFGL
Sbjct: 84  NAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSVFGAEFGL 143

Query: 160 RQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQLLHIVNQGSHQLPLWGGCLVI 219
           RQMILSR+L+GN TAR+F  INV+ACVGW  VNT+ +  LLH++N    + P W   L+I
Sbjct: 144 RQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARCPPWAASLII 203

Query: 220 VGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHKSGQFSNGPWTSGATTAGGVLS 279
           V  TV +TFFGY +IHAYE+WSWVPN  VFL+IIARL  +G F+ G    G  TAG  LS
Sbjct: 204 VLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLGGKATAGSFLS 263

Query: 280 FGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAGLAFPLLFTMILGAASAMGAVN 339
           +GS ++GFA+GWTTYAADYTVYMP+  NK++IFFF+ AGLA PLLFT+ILGAA+      
Sbjct: 264 YGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGAAAGRCVHT 323

Query: 340 NPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAMSTIANNIPNMYTIALSVQALY 399
           NP W   Y K ++GGL +AIL  N+L GFG+FCCV+LAMST+ANNIPNMY+IALS QAL+
Sbjct: 324 NPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYSIALSTQALW 383

Query: 400 EPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMDSIGYYLAIYIAISLSEHFIYR 459
             F+RVPRV WTL GNA  + I+I A Y FE F+ +FMDSIGYYL+IYI I ++EHF++R
Sbjct: 384 SRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVICVTEHFVFR 443

Query: 460 RGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQTYWTGEISRHIGKHGGDIGF 519
           +GF+GY++  W+  D LP G AGC+AL VGA GVA+GMS  Y+TG I++     GGDIGF
Sbjct: 444 KGFRGYDVSHWDRPDLLPAGYAGCAALCVGAVGVAMGMSHEYYTGPIAK---LAGGDIGF 500

Query: 520 ELGMSWAFIVFNIVRP 535
            L   ++FIV+   RP
Sbjct: 501 LLAAGFSFIVYICCRP 516

>Scas_715.54d
          Length = 232

 Score =  251 bits (640), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 164/223 (73%), Gaps = 5/223 (2%)

Query: 35  KTTNVNTNDFEYDYGDDFTNSSEA-----ATVEETKLKLGFISRLALKMNAETKGVEPVT 89
           KTT++   D  +   +  +N + +      TV      + F+ ++A ++NAET+G+EPV 
Sbjct: 10  KTTDLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAETRGIEPVR 69

Query: 90  DEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFFNMIGLVSVAF 149
           D+EKTD ++ N   +WFSAN V+++YA+GALGP+VF LNFG + LTIVFFN+IG+V VA+
Sbjct: 70  DDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAY 129

Query: 150 FSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQLLHIVNQGSHQ 209
           FS+FG E GLRQM+LSR+LVGN+  R F+ IN +ACVGW V+N++ +AQLL++VN   H+
Sbjct: 130 FSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHR 189

Query: 210 LPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVI 252
            P W G +V+V GT++VTFFG  +I A+ERWSWVPN AVFLVI
Sbjct: 190 CPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232

>Kwal_47.17216
          Length = 542

 Score =  225 bits (573), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 155/507 (30%), Positives = 238/507 (46%), Gaps = 44/507 (8%)

Query: 67  KLGFISRLALKMNAETKGVEPVTDEEK-TDDSVLNAASMWFSANLVLASYALGALGPIVF 125
           KL   S+    +  E +G++ +   E+ T    L+ A +W SA   L+S +   LGP++F
Sbjct: 32  KLSVASKRLDALGVEIRGIQRIPAYERGTSKQFLSVAGLWLSAAGGLSSMSSYFLGPLLF 91

Query: 126 RLNFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVAC 185
            L F  S+++ +    IG    A+ S  G + G RQM+ +R+L G    +  +  +++  
Sbjct: 92  ELTFRQSLVSGLVSMAIGCAVAAYLSTMGPQSGCRQMVTARYLFGWYFVKFVSLASIIGV 151

Query: 186 VGWGVVNTVVAAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPN 245
           +GW +VN VV  Q+L  ++    ++PLW G +++   + +V  FG   +   E +  VP 
Sbjct: 152 MGWSIVNCVVGGQMLAAISNS--KIPLWVGIIIVTAVSFIVAIFGIKQVLRVETFLSVPV 209

Query: 246 FAVFLVI-IARLHKS---GQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVY 301
              FL++ IA   K      F N       T  G  LSF S  Y   + W +  ADY + 
Sbjct: 210 LTCFLLLYIAASDKYYLLDTFKNDD-IDPLTIKGNWLSFFSLCYSITSTWGSITADYYIL 268

Query: 302 MPRTMNKFKIFFFLCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILV 361
            P     +K+F     G   P  F  +LG   A  A +   W A Y K  MGGL ++   
Sbjct: 269 FPEDTAHYKVFLLTFFGTLIPTTFVGVLGLILASCAASYEPWKAAYHKYGMGGLLFSGF- 327

Query: 362 PNSLHGFGEFCCVLLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGI 421
               +GFG+FC V+L  S I+NNI N Y+ A ++Q      +RVPR +W +A     +  
Sbjct: 328 -ERWNGFGKFCVVVLIFSLISNNIINTYSAAFNIQLSSVHMARVPRWLWAIACTIFYLVC 386

Query: 422 SIPASYYFEGFLENFMDSIGYYLAIYIAISLSEHFIYRRGFK------------------ 463
           ++    +F   L NF+  IGY++++Y  I L E+ I+R  F+                  
Sbjct: 387 ALVGRNHFSEILGNFLPMIGYWISMYFIILLEENLIFRSHFRHLYTEEFPPHPVEEGESP 446

Query: 464 ----------------GYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQTYWTGEIS 507
                            YN E WNN + L  G A   A  VG  GVAL M+Q YW G I+
Sbjct: 447 RALRDIKNKKVSSRKHAYNWEMWNNAEVLTHGYAATFAFLVGVGGVALSMAQAYWIGPIA 506

Query: 508 RHIGKHGGDIGFELGMSWAFIVFNIVR 534
           RH G  GGD+G  + M ++  V+  +R
Sbjct: 507 RHFGDFGGDLGMWVSMGFSGTVYPALR 533

>KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, hypothetical start
          Length = 523

 Score =  214 bits (546), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 149/499 (29%), Positives = 247/499 (49%), Gaps = 40/499 (8%)

Query: 71  ISRLALKMNA---ETKGVEPVTDEEK-TDDSVLNAASMWFSANLVLASYALGALGPIVFR 126
           I + + K++A   E +G++ +   E+ T     + A +W SA   L+S +   LGP+VF+
Sbjct: 21  IRQFSDKLDALGVEARGIQRIQPYERGTAKQFWHVAGLWLSAAGGLSSMSSYFLGPMVFQ 80

Query: 127 LNFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACV 186
           L F   +++ +    IG    A+ SV G + G RQ++ +R+L G    +  A   +V  +
Sbjct: 81  LTFNQCLVSGLISMWIGCGVAAYCSVMGPQSGCRQIVTARYLFGWWFVKFIALAAIVGVM 140

Query: 187 GWGVVNTVVAAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNF 246
           GW +VN VV  Q+L  V+ G  ++PLW G +++   +++V+ FG   +   E    VP  
Sbjct: 141 GWSIVNCVVGGQMLASVSDG--KVPLWVGIIIVTVVSLLVSIFGIKQVLKVETLFAVPVL 198

Query: 247 AVFLVIIA----RLHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYM 302
             FL++      +     +FSN    S  T  G  LSF S  Y   + W +  ADY +  
Sbjct: 199 TSFLLLYISASDKFKYLYEFSNSDIDS-LTVKGCWLSFFSLCYSITSTWGSITADYYILF 257

Query: 303 PRTMNKFKIFFFLCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVP 362
           P    + ++F     G A P  F  +LG   A  +++   W A YD+  MGGL  A    
Sbjct: 258 PEDTPQIQVFLLTFFGTAVPTTFVGVLGLLLASCSLSYEPWQAAYDEYGMGGLMNAGF-- 315

Query: 363 NSLHGFGEFCCVLLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGIS 422
           +  +GFG+F  V+L +S I+NNI N Y+ A S+Q      ++VPR +W +      +  +
Sbjct: 316 SRWNGFGKFLVVVLILSLISNNIVNTYSAAFSIQLSSVMLAKVPRWIWAIGCTIFYLVCA 375

Query: 423 IPASYYFEGFLENFMDSIGYYLAIYIAISLSEHFIYR----------------------- 459
           +     F   L NF+  IGY++++Y  + + E+ I+R                       
Sbjct: 376 LVGRNSFSTILGNFLPMIGYWISMYFILLVEENVIFRNWFHHLYKLEFPNDIEVKPHHKL 435

Query: 460 ----RGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQTYWTGEISRHIGKHGG 515
               R    YN ++W+N + +  G+A  +A  +G  GV LGM QTY+ G ++  IG++GG
Sbjct: 436 RKLPRHIHRYNWDEWDNSEVITRGLAASAAFCIGVAGVVLGMCQTYYVGPLAAKIGEYGG 495

Query: 516 DIGFELGMSWAFIVFNIVR 534
           D+G  LGM +A + +  +R
Sbjct: 496 DLGMWLGMGFAGVSYPPLR 514

>YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of the
           purine/cytosine permease family of membrane transporters
           [1740 bp, 579 aa]
          Length = 579

 Score =  179 bits (455), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 143/520 (27%), Positives = 242/520 (46%), Gaps = 56/520 (10%)

Query: 67  KLGFISRLALKMNAETKGVEPVTDEEK--TDDSVLNAASMWFSANLVLASYALGALGPIV 124
           +  ++S+    M  E+ G++ ++  E+  +    L+ A +W SA   L+S +   LGP++
Sbjct: 55  RAAWLSKKVDAMGVESTGIQRISPYERGTSKKQFLHVAGLWLSATGGLSSMSSFLLGPLL 114

Query: 125 FRLNFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVA 184
           F L+F  SV + +    IG +  A+ S+ G + G RQM+ +R+L G    ++ A  +++ 
Sbjct: 115 FGLSFRESVASSLISVTIGCLIAAYCSIMGPQSGCRQMVTARYLFGWWFVKLVALASIIG 174

Query: 185 CVGWGVVNTVVAAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVP 244
            +GW VVN+VV  ++L  ++  + ++PLW G +++   + +V  FG   +   E +  VP
Sbjct: 175 VMGWSVVNSVVGGEMLAAIS--NDKVPLWVGIVIVTVCSFLVAIFGIKQVIKVETYLSVP 232

Query: 245 NFAVFLVIIARLHKSGQFSNGPWTSG----ATTAGGVLSFGSAIYGFAAGWTTYAADYTV 300
               FL++         F N   + G    +T  G  +SF S  Y   A W +  ADY +
Sbjct: 233 VLTAFLLLYISSSDKYSFVNAYVSKGNLDSSTRKGNWMSFFSLCYSITATWGSITADYYI 292

Query: 301 YMPRTMNKFKIFFFLCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAIL 360
             P      +IF     G   P  F  ILG   A  A++   W   YD   MGGL +A  
Sbjct: 293 LFPEDTPYIQIFCLTFFGTFLPTCFVGILGLLLASVAMSYKPWSVEYDSHGMGGLLWAGF 352

Query: 361 VPNSLHGFGEFCCVLLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVG 420
                +GFG+FC V+L  S ++NNI N Y+ A S+Q      +++PR  W++      + 
Sbjct: 353 --QRWNGFGKFCVVVLVFSLVSNNIINTYSAAFSIQLSSVFCAKIPRWFWSIVCTIICLV 410

Query: 421 ISIPASYYFEGFLENFMDSIGYYLAIYIAISLSEHFIYRRGF------------------ 462
            ++    +F   L NF+  IGY++++Y  +   E+ ++RR F                  
Sbjct: 411 CALIGRNHFSTILGNFLPMIGYWISMYFILLFEENLVFRRFFLHLYTKEFPTVTGEINGP 470

Query: 463 ----------------------------KGYNIEDWNNWDRLPIGIAGCSALFVGAFGVA 494
                                         YN + W +++ L  G A   A  VG  GV 
Sbjct: 471 ELVGSSKEVEKDAVTNIHLLKRKHKVTKHRYNWDKWEDYEVLTHGYAATFAFIVGVAGVV 530

Query: 495 LGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVR 534
           +GM+Q YW G I+   G++GGD+   L M+++ +V+   R
Sbjct: 531 VGMAQAYWIGPIAAKFGEYGGDVAMWLSMAFSGVVYPPCR 570

>CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, start by similarity
          Length = 631

 Score =  172 bits (436), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 126/456 (27%), Positives = 214/456 (46%), Gaps = 32/456 (7%)

Query: 21  YELNEVEKQPVE-DVKTTNVNTNDFEYDYGDDFTNSSEAATVEETKLKLGFISRLALKMN 79
           Y+L +      + D +T   N   F+ D  D   N             L ++  L+ K++
Sbjct: 34  YDLEKRSTHKTDPDSRTNRRNKKLFDLDRHDPNLNIFMKG--------LAYLLWLSDKLD 85

Query: 80  A---ETKGVEPVTDEEK-TDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLT 135
           +   ET G+E V   E+ T    L+ A +W SA   L+S +   LGP++F L+F  ++ +
Sbjct: 86  SFGVETSGIERVPPYERGTKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFELSFQQALTS 145

Query: 136 IVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVV 195
            +    +G +  A+ S+ G + G RQM+ +R+L G    +  A   ++  +GW V N+VV
Sbjct: 146 SMISVTVGCLVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVTNSVV 205

Query: 196 AAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVI--- 252
             ++L  ++  + ++PLW G +++   + +V  FG   +   E +  VP    FL++   
Sbjct: 206 GGEMLAAIS--NDRVPLWVGIVIVTVCSFVVAIFGIKQVLRIETYISVPVLTSFLLLYIS 263

Query: 253 ------IARLHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTM 306
                 + R +K     +       T  G  +SF S  Y   + W +  ADY +  P   
Sbjct: 264 SGNRDYLVREYKPIDVPS------KTIKGNWISFFSLCYSITSTWGSITADYYILFPEDT 317

Query: 307 NKFKIFFFLCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLH 366
             +++F    AG   P  F  ILG   A  A +   +   YD   MGGL +A    +  +
Sbjct: 318 PHYQVFLLTLAGTLIPTTFVGILGLTLASIAKSYQPYGEEYDTHGMGGLLWAGF--SRWN 375

Query: 367 GFGEFCCVLLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPAS 426
           GFG+F  V+L +S I+NNI N Y+ A  +Q      +RVPR  W +      +  ++   
Sbjct: 376 GFGKFLVVVLILSLISNNIINTYSAAFGIQLSAVWAARVPRWFWCIVCTIVYLVCALVGR 435

Query: 427 YYFEGFLENFMDSIGYYLAIYIAISLSEHFIYRRGF 462
            +F   L NF+  IGY++++Y  +   E+ I+RR F
Sbjct: 436 NHFATILGNFLPMIGYWISMYFILLFEENVIFRRYF 471

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 465 YNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQTYWTGEISRHI-GKHGGDIGFELGM 523
           YN ++W+N D L  G A   A   G  GV +GM+QTYW G I+R + G +GGDI   L M
Sbjct: 552 YNWDEWDNPDVLTHGYAATFAFLCGVAGVVVGMAQTYWVGPIARKLGGPYGGDIAMWLSM 611

Query: 524 SWAFIVFNIVR 534
            ++ IV+  +R
Sbjct: 612 GFSGIVYPWLR 622

>Scas_710.30
          Length = 584

 Score =  167 bits (424), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 119/412 (28%), Positives = 206/412 (50%), Gaps = 11/412 (2%)

Query: 70  FISRLALKMNAETKGVEPVTDEEK--TDDSVLNAASMWFSANLVLASYALGALGPIVFRL 127
            +S+    +  E  G+E ++  E+       ++ A  W +A   L+S +   LGP++F L
Sbjct: 35  LLSKKLDSLGVEATGIERISPYERGSKRKQFIHVAGYWLAATGSLSSMSSFLLGPLLFGL 94

Query: 128 NFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVG 187
            F  S+++ +    IG +  A+ S+ G + G RQM+ +R+L G    +  A   ++  +G
Sbjct: 95  TFNESMVSGIVSMAIGCLVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVMG 154

Query: 188 WGVVNTVVAAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFA 247
           W VVN+VV  ++L  ++  + ++PLW G L++   + +V  FG   +   E +  +P + 
Sbjct: 155 WSVVNSVVGGEMLASIS--NDKVPLWVGVLIVTLFSFLVAVFGIKQVLKVETYLSIPVWL 212

Query: 248 VFLVII----ARLHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMP 303
           +F+++      + H    F + P     T  G  LSF S  Y   A W +  ADY +  P
Sbjct: 213 MFILLYISSSDKYHYIDDFKS-PIPDRLTLKGNWLSFFSLCYSITATWGSITADYYILFP 271

Query: 304 RTMNKFKIFFFLCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPN 363
              +KF++F     G   P LF  +LG   +  A     W   Y+K  MGGL +A     
Sbjct: 272 EDTSKFQVFMLTFLGTVVPTLFVGVLGLCLSTVAATYEPWNDDYNKYGMGGLLHAGF--K 329

Query: 364 SLHGFGEFCCVLLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISI 423
             +GFG+FC V+L +S I+NNI N Y+ A SVQ      ++VPR  W++      +  ++
Sbjct: 330 RWNGFGKFCVVVLLLSLISNNIINTYSAAFSVQLASVKAAKVPRWFWSIVCMIICLVCAL 389

Query: 424 PASYYFEGFLENFMDSIGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDR 475
               +F   L NF+  IGY++++Y  + L E+ I+R  F     +++  +D+
Sbjct: 390 VGRNHFSTILGNFLPMIGYWISMYFILLLEENVIFREYFHHLYYKEFPEFDK 441

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 3/83 (3%)

Query: 455 HFIYRRGFKGYNIEDWNNWDR---LPIGIAGCSALFVGAFGVALGMSQTYWTGEISRHIG 511
           H + RR     +  +WN WD    L  G A   A   G  GV +GM+Q YW G ++R  G
Sbjct: 493 HLLKRRHLATSHKYNWNKWDDPEVLTHGYAATFAFLCGVAGVVVGMAQAYWIGPLARKFG 552

Query: 512 KHGGDIGFELGMSWAFIVFNIVR 534
           + GGDI   L M+++ +V+  +R
Sbjct: 553 ETGGDIAMWLSMAFSGLVYPPLR 575

>Scas_701.1
          Length = 68

 Score = 87.8 bits (216), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 40/60 (66%), Positives = 46/60 (76%)

Query: 476 LPIGIAGCSALFVGAFGVALGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
           LPIGIAG    FV AFGVALGM Q+YW GEI R IGK GGD+GFE+G +W FI + +VRP
Sbjct: 1   LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 60

>Scas_690.1*
          Length = 636

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 40/60 (66%), Positives = 46/60 (76%)

Query: 476 LPIGIAGCSALFVGAFGVALGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535
           LPIGIAG    FV AFGVALGM Q+YW GEI R IGK GGD+GFE+G +W FI + +VRP
Sbjct: 569 LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 628

>Scas_705.25
          Length = 310

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 12/78 (15%)

Query: 105 WFSANLVLASYALGALGPIVFRLNFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGLRQM-- 162
            F   L    YALG +  ++  + +GT+++ +V   +  LV    F+ F  +  LRQM  
Sbjct: 32  HFQRQLAHQFYALGCILIVIQYVKYGTTIVALV---VRALVMALLFTPFPDDSQLRQMVH 88

Query: 163 -------ILSRFLVGNVT 173
                  I SRF  GN T
Sbjct: 89  TSNVSGFISSRFTSGNET 106

>Scas_715.27
          Length = 315

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 11/87 (12%)

Query: 46  YDYGDDFTNSSEAATVEETKLKLGFISRLALKMNAETKGVEPVTDEEKTDDSVLNAASMW 105
           ++ G +F        +EETKLKL F      K N E    E + ++EK+   ++  +   
Sbjct: 194 FEKGTNFFKFGSDGVIEETKLKLEF------KKNYELNTRESLNEKEKS--IIIETSKKI 245

Query: 106 FSANLVLASYALGALGP--IVFRLNFG 130
           F  NL +A   LG++    ++ +LNF 
Sbjct: 246 FDYNL-MAMEELGSINKEQLMSKLNFK 271

>Kwal_26.7525
          Length = 392

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 164 LSRFLVGN--VTARVFAAINVVACVGWGVVNTVVAAQLLHIVNQGSHQ 209
           L++FL  N  ++  V  A+  +  + +GVV  V+A QL   VN  SHQ
Sbjct: 215 LTKFLTSNPDISVAVSQAMLEMGFINYGVVTKVIAEQLGTRVNVPSHQ 262

>KLLA0E03465g 321977..323488 similar to sp|P38758 Saccharomyces
           cerevisiae YHR009c singleton, start by similarity
          Length = 503

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 26  VEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAATVEETKLKLGFISRLALKMNAE 81
           V  +PV  V TT  +  D+EY YG+D       A+  +TK  +  +S+  L++ ++
Sbjct: 174 VNNEPVSRVGTTE-DDEDYEYSYGEDDEEDEAPASELDTKSSIA-LSKDPLRLPSD 227

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.139    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,332,765
Number of extensions: 680355
Number of successful extensions: 2413
Number of sequences better than 10.0: 39
Number of HSP's gapped: 2448
Number of HSP's successfully gapped: 43
Length of query: 535
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 429
Effective length of database: 12,926,601
Effective search space: 5545511829
Effective search space used: 5545511829
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)