Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K12232g26025613410.0
YPR060C (ARO7)25625610021e-139
Scas_667.232582569931e-137
KLLA0B08481g2602569431e-130
Kwal_27.126022572569341e-128
ADL326W2592568081e-109
CAGL0F03465g93294643.7
Kwal_55.2117953362634.3
Sklu_2351.1465102634.5
Sklu_2124.1183057634.8
AEL030W73933626.0
CAGL0M01628g60153618.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K12232g
         (256 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K12232g complement(1194973..1195755) highly similar to sp|P...   521   0.0  
YPR060C (ARO7) [5489] chr16 complement(674856..675626) Chorismat...   390   e-139
Scas_667.23                                                           387   e-137
KLLA0B08481g 752482..753264 highly similar to sp|P32178 Saccharo...   367   e-130
Kwal_27.12602                                                         364   e-128
ADL326W [1415] [Homologous to ScYPR060C (ARO7) - SH] complement(...   315   e-109
CAGL0F03465g complement(340640..343438) similar to sp|P48524 Sac...    29   3.7  
Kwal_55.21179                                                          29   4.3  
Sklu_2351.1 YGL038C, Contig c2351 332-1729 reverse complement          29   4.5  
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement           29   4.8  
AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH] complement(...    28   6.0  
CAGL0M01628g complement(181274..183079) highly similar to tr|Q04...    28   8.6  

>CAGL0K12232g complement(1194973..1195755) highly similar to
           sp|P32178 Saccharomyces cerevisiae YPR060c ARO7
           chorismate mutase, start by similarity
          Length = 260

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/256 (100%), Positives = 256/256 (100%)

Query: 1   MDFTKPETVLNLQNIRDELVKMEDSIIFKFIERSHFPVCAPVYAPNHPDLNIPDFTGSFL 60
           MDFTKPETVLNLQNIRDELVKMEDSIIFKFIERSHFPVCAPVYAPNHPDLNIPDFTGSFL
Sbjct: 1   MDFTKPETVLNLQNIRDELVKMEDSIIFKFIERSHFPVCAPVYAPNHPDLNIPDFTGSFL 60

Query: 61  DWALLQMEITHSKLRRFDSPDETPFFPNDIQEPILPRINYPKILHEKASKPVNYNEKIKS 120
           DWALLQMEITHSKLRRFDSPDETPFFPNDIQEPILPRINYPKILHEKASKPVNYNEKIKS
Sbjct: 61  DWALLQMEITHSKLRRFDSPDETPFFPNDIQEPILPRINYPKILHEKASKPVNYNEKIKS 120

Query: 121 IYIKEIVPLISNSDGDSKENYGSVATRDMECLQSLSRRIHFGKFVAEAKFQSDIDLYTKM 180
           IYIKEIVPLISNSDGDSKENYGSVATRDMECLQSLSRRIHFGKFVAEAKFQSDIDLYTKM
Sbjct: 121 IYIKEIVPLISNSDGDSKENYGSVATRDMECLQSLSRRIHFGKFVAEAKFQSDIDLYTKM 180

Query: 181 IREKDVDGIMSSITNAAVEEKILERLVRKADVYGVDPTTPVDSSEKVRRITPEYLVKIYK 240
           IREKDVDGIMSSITNAAVEEKILERLVRKADVYGVDPTTPVDSSEKVRRITPEYLVKIYK
Sbjct: 181 IREKDVDGIMSSITNAAVEEKILERLVRKADVYGVDPTTPVDSSEKVRRITPEYLVKIYK 240

Query: 241 EIVIPITKEVEVDYLL 256
           EIVIPITKEVEVDYLL
Sbjct: 241 EIVIPITKEVEVDYLL 256

>YPR060C (ARO7) [5489] chr16 complement(674856..675626) Chorismate
           mutase, required for the synthesis of both phenylalanine
           and tyrosine [771 bp, 256 aa]
          Length = 256

 Score =  390 bits (1002), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 194/256 (75%), Positives = 220/256 (85%), Gaps = 5/256 (1%)

Query: 1   MDFTKPETVLNLQNIRDELVKMEDSIIFKFIERSHFPVCAPVYAPNHPDLNIPDFTGSFL 60
           MDFTKPETVLNLQNIRDELV+MEDSIIFKFIERSHF  C  VY  NHP L IP+F GSFL
Sbjct: 1   MDFTKPETVLNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGLEIPNFKGSFL 60

Query: 61  DWALLQMEITHSKLRRFDSPDETPFFPNDIQEPILPRINYPKILHEKASKPVNYNEKIKS 120
           DWAL  +EI HS++RRF+SPDETPFFP+ IQ+  LP INYP+IL   A + VNYN+KIK 
Sbjct: 61  DWALSNLEIAHSRIRRFESPDETPFFPDKIQKSFLPSINYPQILAPYAPE-VNYNDKIKK 119

Query: 121 IYIKEIVPLISNSDGDSKENYGSVATRDMECLQSLSRRIHFGKFVAEAKFQSDIDLYTKM 180
           +YI++I+PLIS  DGD K N+GSVATRD+ECLQSLSRRIHFGKFVAEAKFQSDI LYTK+
Sbjct: 120 VYIEKIIPLISKRDGDDKNNFGSVATRDIECLQSLSRRIHFGKFVAEAKFQSDIPLYTKL 179

Query: 181 IREKDVDGIMSSITNAAVEEKILERLVRKADVYGVDPTTPVDSSEKVRRITPEYLVKIYK 240
           I+ KDV+GIM +ITN+AVEEKILERL +KA+VYGVDPT   +S E  RRITPEYLVKIYK
Sbjct: 180 IKSKDVEGIMKNITNSAVEEKILERLTKKAEVYGVDPTN--ESGE--RRITPEYLVKIYK 235

Query: 241 EIVIPITKEVEVDYLL 256
           EIVIPITKEVEV+YLL
Sbjct: 236 EIVIPITKEVEVEYLL 251

>Scas_667.23
          Length = 258

 Score =  387 bits (993), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 192/256 (75%), Positives = 218/256 (85%), Gaps = 5/256 (1%)

Query: 1   MDFTKPETVLNLQNIRDELVKMEDSIIFKFIERSHFPVCAPVYAPNHPDLNIPDFTGSFL 60
           MDF KP+TVLNLQNIR ELVKMED+IIF+FIERSHF  C+ VY PNHP ++IP+F GSFL
Sbjct: 1   MDFLKPDTVLNLQNIRAELVKMEDTIIFQFIERSHFATCSSVYQPNHPGVSIPNFDGSFL 60

Query: 61  DWALLQMEITHSKLRRFDSPDETPFFPNDIQEPILPRINYPKILHEKASKPVNYNEKIKS 120
           DWALL +EITHS+LRRF+SPDETPFFPN+I +PILP INYP IL   AS+ VNYN+KIK 
Sbjct: 61  DWALLHLEITHSQLRRFESPDETPFFPNEILKPILPSINYPPILASYASE-VNYNDKIKK 119

Query: 121 IYIKEIVPLISNSDGDSKENYGSVATRDMECLQSLSRRIHFGKFVAEAKFQSDIDLYTKM 180
           +YI  IVPLIS  DGD KENYGSVATRD E LQ+LSRRIHFGKFVAEAKFQS  +LY ++
Sbjct: 120 VYIDRIVPLISKYDGDQKENYGSVATRDCEVLQNLSRRIHFGKFVAEAKFQSAKELYIEL 179

Query: 181 IREKDVDGIMSSITNAAVEEKILERLVRKADVYGVDPTTPVDSSEKVRRITPEYLVKIYK 240
           I+ KDV+GIM  ITN+AVEEKILERL +KA+VYGVDPT    + E  RRITPEYLVKIYK
Sbjct: 180 IKNKDVEGIMKHITNSAVEEKILERLTKKAEVYGVDPT----NKEGERRITPEYLVKIYK 235

Query: 241 EIVIPITKEVEVDYLL 256
           EIVIPITKEVEV+YLL
Sbjct: 236 EIVIPITKEVEVEYLL 251

>KLLA0B08481g 752482..753264 highly similar to sp|P32178
           Saccharomyces cerevisiae YPR060c ARO7 chorismate mutase
           singleton, start by similarity
          Length = 260

 Score =  367 bits (943), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 182/256 (71%), Positives = 218/256 (85%), Gaps = 5/256 (1%)

Query: 1   MDFTKPETVLNLQNIRDELVKMEDSIIFKFIERSHFPVCAPVYAPNHPDLNIPDFTGSFL 60
           MDF KPETVL+LQNIRDELVKMED+IIF FIERSHF  C+ VY  N P++ +PDF GSFL
Sbjct: 1   MDFFKPETVLDLQNIRDELVKMEDTIIFNFIERSHFATCSSVYESNVPEIKLPDFDGSFL 60

Query: 61  DWALLQMEITHSKLRRFDSPDETPFFPNDIQEPILPRINYPKILHEKASKPVNYNEKIKS 120
           DWAL++MEI HS+LRRF+SPDETPFFP+ I +PI+P +NYPKIL   A++ +NYN+KIKS
Sbjct: 61  DWALMKMEIVHSQLRRFESPDETPFFPDKILKPIIPSLNYPKILASYANQ-INYNDKIKS 119

Query: 121 IYIKEIVPLISNSDGDSKENYGSVATRDMECLQSLSRRIHFGKFVAEAKFQSDIDLYTKM 180
           IYIK IVPL+S  D ++ EN+GSVATRD+E LQSLSRRIHFGKFVAEAKFQS+ + +TK+
Sbjct: 120 IYIKTIVPLLSKRDINTWENFGSVATRDIEALQSLSRRIHFGKFVAEAKFQSEKEKFTKL 179

Query: 181 IREKDVDGIMSSITNAAVEEKILERLVRKADVYGVDPTTPVDSSEKVRRITPEYLVKIYK 240
           I ++DVDGIM++ITN+ VEEKIL+RL  KA VYGVDPT    + +  R+ITPEYLVKIYK
Sbjct: 180 ILDQDVDGIMTAITNSKVEEKILQRLNVKATVYGVDPT----NEKGDRKITPEYLVKIYK 235

Query: 241 EIVIPITKEVEVDYLL 256
           EIVIPITKEVEVDYLL
Sbjct: 236 EIVIPITKEVEVDYLL 251

>Kwal_27.12602
          Length = 257

 Score =  364 bits (934), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 176/256 (68%), Positives = 217/256 (84%), Gaps = 5/256 (1%)

Query: 1   MDFTKPETVLNLQNIRDELVKMEDSIIFKFIERSHFPVCAPVYAPNHPDLNIPDFTGSFL 60
           MDF KPETVL+L NIRDELVKMED+IIF FIERSHFP C  VY    P+L +PDF GSFL
Sbjct: 1   MDFLKPETVLDLSNIRDELVKMEDTIIFNFIERSHFPTCPTVYKEKDPNLPLPDFDGSFL 60

Query: 61  DWALLQMEITHSKLRRFDSPDETPFFPNDIQEPILPRINYPKILHEKASKPVNYNEKIKS 120
           DWAL+  EITHS+LRRF+SPD+TPFFP+ I +PILP I+YP++L   A++ +N N++IK+
Sbjct: 61  DWALMHSEITHSQLRRFESPDQTPFFPDKILKPILPSIHYPRVLSSYAAE-INLNQEIKA 119

Query: 121 IYIKEIVPLISNSDGDSKENYGSVATRDMECLQSLSRRIHFGKFVAEAKFQSDIDLYTKM 180
           +YI++I+P++S  DG+S EN+GSVAT D+ECLQSLSRRIHFGKFVAEAKFQ+D  LY+KM
Sbjct: 120 VYIEQIIPMVSKFDGESWENFGSVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKM 179

Query: 181 IREKDVDGIMSSITNAAVEEKILERLVRKADVYGVDPTTPVDSSEKVRRITPEYLVKIYK 240
           I+E+D+DGI  SITN+AVEEKILERL  KA+VYGVDP+    + E  R+ITPEYLVKIYK
Sbjct: 180 IKERDLDGIYRSITNSAVEEKILERLCLKAEVYGVDPS----NKEGYRKITPEYLVKIYK 235

Query: 241 EIVIPITKEVEVDYLL 256
           E+VIP+TK+VEVDYLL
Sbjct: 236 ELVIPLTKKVEVDYLL 251

>ADL326W [1415] [Homologous to ScYPR060C (ARO7) - SH]
           complement(124969..125748) [780 bp, 259 aa]
          Length = 259

 Score =  315 bits (808), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 156/256 (60%), Positives = 195/256 (76%), Gaps = 5/256 (1%)

Query: 1   MDFTKPETVLNLQNIRDELVKMEDSIIFKFIERSHFPVCAPVYAPNHPDLNIPDFTGSFL 60
           MDF  P++VLNL +IR ELV+MED+IIF FIERS+FP C  VY  NH  L +PDF GSFL
Sbjct: 1   MDFLDPKSVLNLDHIRHELVRMEDTIIFNFIERSYFPTCPVVYHANHERLPLPDFDGSFL 60

Query: 61  DWALLQMEITHSKLRRFDSPDETPFFPNDIQEPILPRINYPKILHEKASKPVNYNEKIKS 120
           DWA + ME+T S+LRRF++PD+ PF+P  I  PILP + YPK+L   A + +NYN++IK+
Sbjct: 61  DWAHMHMEMTQSQLRRFEAPDQVPFYPGSILPPILPPVQYPKLLAPYAPQ-INYNDRIKA 119

Query: 121 IYIKEIVPLISNSDGDSKENYGSVATRDMECLQSLSRRIHFGKFVAEAKFQSDIDLYTKM 180
           IY+  +VPL+S  +G S EN GSV + D++CLQ+LSRRIHFGKFVAEAKFQ + + YT +
Sbjct: 120 IYLDSVVPLVSLGEGTSWENLGSVTSCDIDCLQALSRRIHFGKFVAEAKFQLEPEKYTAL 179

Query: 181 IREKDVDGIMSSITNAAVEEKILERLVRKADVYGVDPTTPVDSSEKVRRITPEYLVKIYK 240
           I+ +DVDGIM SITN  VE+KIL+RL  KA VYGVDP          +R+TPEYL KIYK
Sbjct: 180 IKNRDVDGIMDSITNKFVEDKILKRLQAKATVYGVDPL----DRNCSKRVTPEYLAKIYK 235

Query: 241 EIVIPITKEVEVDYLL 256
           E VIPITKEVEV+YLL
Sbjct: 236 EYVIPITKEVEVEYLL 251

>CAGL0F03465g complement(340640..343438) similar to sp|P48524
           Saccharomyces cerevisiae YMR275c BUL1 or sp|Q03758
           Saccharomyces cerevisiae YML111w BUL2, hypothetical
           start
          Length = 932

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 43/94 (45%), Gaps = 5/94 (5%)

Query: 157 RRIHFG---KFVAEAKFQSDIDLYTKMIREKDVDGIMSSITNAAVEEKILERLVRKADVY 213
           R I FG     + E K    ++   ++I+E+ +D +       +  E IL   +   D+ 
Sbjct: 484 RVIPFGFSSNLIGERKSMDQLNDLIRLIQER-LDALKKVFKRLSKNEAILPGDILGTDIS 542

Query: 214 G-VDPTTPVDSSEKVRRITPEYLVKIYKEIVIPI 246
           G +DP+T +DS E + R   +  VK   E  + +
Sbjct: 543 GTIDPSTKLDSEEIINRKMEQLTVKNRMEGAVSL 576

>Kwal_55.21179
          Length = 533

 Score = 28.9 bits (63), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 26/62 (41%), Gaps = 5/62 (8%)

Query: 32  ERSHFPVCAPVYAPNHPDL-----NIPDFTGSFLDWALLQMEITHSKLRRFDSPDETPFF 86
           E+  F  C  VY      L     +IP  T   LD   + M++   +   F S D  PFF
Sbjct: 82  EKLFFQWCRKVYGSFKAKLLYCIASIPYETSLALDCLDVYMQLLEQEATYFASQDGAPFF 141

Query: 87  PN 88
           PN
Sbjct: 142 PN 143

>Sklu_2351.1 YGL038C, Contig c2351 332-1729 reverse complement
          Length = 465

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 45/102 (44%), Gaps = 6/102 (5%)

Query: 14  NIRDELVKMEDSIIFKFIERSHFPVCAPVYAPNHPDLNIPDFTGSFLDWALLQMEITHSK 73
           +IRD +V +   + F+F      P+   V+      L+ P+F  SF  ++   +    S 
Sbjct: 67  SIRDSVVDLRTQLTFQFPYDPEQPIPRRVWQTWKEPLDSPNFPSSFRKYSNSWL----ST 122

Query: 74  LRRFDSPDETPFFPNDIQEPILPRI--NYPKILHEKASKPVN 113
           +    SP +    P+D   P+L  I  N P+++    S P N
Sbjct: 123 IEESSSPYDYALVPDDHIIPLLQHIYGNVPQVIQAFESMPRN 164

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 143 SVATRDMECLQSLSRRIHFGKFVAEAKFQSDIDLYTKMIREKDVDGIMSSITNAAVE 199
           S+ T D E L +L+R ++ G +VAE ++++  D +     E  +D  ++SI   A +
Sbjct: 289 SIVTIDFEPLLALARCLYEGAWVAE-RYEATKDFFATNPPESSLDPTVTSIIKTATK 344

>AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH]
           complement(577332..579551) [2220 bp, 739 aa]
          Length = 739

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 22/33 (66%)

Query: 173 DIDLYTKMIREKDVDGIMSSITNAAVEEKILER 205
           D D+  KMI +KDV+   S ++N +  +++L++
Sbjct: 151 DTDVRGKMIHQKDVEKAASELSNTSAVQRVLKK 183

>CAGL0M01628g complement(181274..183079) highly similar to tr|Q04163
           Saccharomyces cerevisiae YDR389w SAC7, suppressor of
           actin mutation, hypothetical start
          Length = 601

 Score = 28.1 bits (61), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query: 53  PDFTGSFLDWALLQMEITHSKLRRFDSPDETPFFPNDIQEPI-LPRINYPKIL 104
           PD+   F +W    +    S LRR+ +  E P  P  + E    P +N P+IL
Sbjct: 156 PDYGAKFSNWEPYTVHDVASLLRRYLNNLEEPLIPLALYEKFRAPLMNRPRIL 208

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,081,809
Number of extensions: 415162
Number of successful extensions: 1356
Number of sequences better than 10.0: 39
Number of HSP's gapped: 1345
Number of HSP's successfully gapped: 39
Length of query: 256
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 157
Effective length of database: 13,168,927
Effective search space: 2067521539
Effective search space used: 2067521539
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)