Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K12210g31130616290.0
YBR104W (YMC2)32932111151e-154
Scas_718.532431810841e-149
CAGL0D01606g30530510691e-147
Scas_667.2230630510421e-143
YPR058W (YMC1)30730710301e-141
Sklu_1926.23053059701e-132
Kwal_27.125993043059561e-130
KLLA0B08503g3033049311e-126
Sklu_1275.13113068671e-116
Sklu_2398.43093068631e-116
Kwal_33.129883033058491e-114
Kwal_56.230113033068371e-112
KLLA0F17864g3073077861e-104
Scas_697.473283173631e-40
Kwal_33.154463053013592e-40
KLLA0E09680g3072923522e-39
Kwal_23.29133202943524e-39
CAGL0B04543g3173263375e-37
KLLA0C13431g3283043386e-37
ADL264C3292913386e-37
YOR100C (CRC1)3273103246e-35
CAGL0B03883g3063013219e-35
Sklu_2075.33453063091e-32
KLLA0E02772g2842873033e-32
Sklu_2127.52782902997e-32
YOR130C (ORT1)2923062772e-28
Kwal_55.213353172842747e-28
Sklu_2037.23103062684e-27
AGL311C3622892662e-26
Scas_632.92923052622e-26
Sklu_2334.23192922599e-26
Scas_640.253063142571e-25
YIL006W3732882601e-25
Kwal_26.86692962882518e-25
AFR146W2812912473e-24
Scas_714.183053112483e-24
KLLA0F03212g3052912483e-24
Scas_691.43343052484e-24
YJR095W (SFC1)3222962475e-24
ACR109W2992912465e-24
YOR222W (ODC2)3073072465e-24
YPL134C (ODC1)3102962457e-24
KLLA0D07073g2973002449e-24
CAGL0K10362g3013012395e-23
CAGL0J02002g3612902415e-23
KLLA0E13453g9062822395e-22
CAGL0K08250g2973022282e-21
Scas_662.123083102272e-21
YJL133W (MRS3)3143092255e-21
Scas_379.23013022246e-21
CAGL0M09020g3483242241e-20
ACR260W3113182221e-20
ADL049W9122832272e-20
Scas_709.93652912214e-20
YEL006W3353212195e-20
Kwal_55.208683802962206e-20
CAGL0J04114g3033082169e-20
YPR021C (AGC1)9022872229e-20
CAGL0G08910g2892822132e-19
Kwal_47.182163333182142e-19
YKR052C (MRS4)3043042106e-19
CAGL0K02365g9192832148e-19
Kwal_23.47313142962099e-19
Kwal_33.140503143112063e-18
ADL009W3792912064e-18
KLLA0E15532g3263192021e-17
Scas_582.73293062011e-17
Scas_602.88853242042e-17
Sklu_2359.69022942042e-17
KLLA0F04697g3073001983e-17
Sklu_2363.23233231974e-17
AER366W2932421939e-17
Kwal_47.173218812931952e-16
YIL134W (FLX1)3113021894e-16
Kwal_27.120813693051914e-16
Sklu_2432.52883061884e-16
Scas_578.3*5242621891e-15
Sklu_2431.53702581852e-15
CAGL0G01166g2952881814e-15
KLLA0D14036g4313191828e-15
CAGL0J01661g3273001781e-14
CAGL0M05225g3813041782e-14
Scas_721.273743141746e-14
KLLA0C11363g5173091731e-13
KLLA0E23705g3682581684e-13
AEL253W3653031675e-13
Scas_702.103022911648e-13
Kwal_23.39653071911649e-13
Kwal_23.30425423081651e-12
YPR011C3262991622e-12
AER419W4932631623e-12
CAGL0L02079g2972931594e-12
YLR348C (DIC1)2982871594e-12
Sklu_1149.22962901586e-12
CAGL0L05742g3053111586e-12
YHR002W (LEU5)3573341561e-11
AGL047C3162981561e-11
YGR096W (TPC1)3143001551e-11
Scas_589.103163221542e-11
CAGL0G03135g3072941542e-11
AFR131C3442681542e-11
Sklu_2374.75132131518e-11
YNL083W5453101519e-11
Kwal_14.22103152981471e-10
Scas_489.42972871472e-10
AGL065C3353241444e-10
YBR291C (CTP1)2992891444e-10
Scas_645.93912681437e-10
YBR192W (RIM2)3772591428e-10
Kwal_0.2322742711401e-09
CAGL0K02915g3423361411e-09
CAGL0F04213g3062811401e-09
Kwal_23.35293952861402e-09
Scas_716.293163081382e-09
Scas_562.123002801373e-09
Scas_669.63732991383e-09
Sklu_2117.22982841364e-09
Kwal_26.79672972871346e-09
Kwal_27.124813042811347e-09
KLLA0E18810g3772911348e-09
AAR036W3172941331e-08
Scas_558.22892841321e-08
AER184W3052811321e-08
CAGL0H10538g2971901321e-08
KLLA0A09383g3662291322e-08
YMR166C3683181322e-08
Kwal_23.43543432641312e-08
YMR056C (AAC1)3092841312e-08
KLLA0B12826g3192991312e-08
YNL003C (PET8)2842691302e-08
AGL064W2962731302e-08
CAGL0J05522g5192171313e-08
Scas_718.243371851293e-08
KLLA0D15015g3173021284e-08
CAGL0J09790g3002861284e-08
Kwal_27.116262992871275e-08
Scas_667.43082811276e-08
YBL030C (PET9)3181731259e-08
Scas_717.203563191251e-07
CAGL0F08305g3742691222e-07
YDL198C (YHM1)3002841213e-07
YBR085W (AAC3)3072901204e-07
AGR383W2931751195e-07
Kwal_26.79723583181196e-07
KLLA0E12353g3052801179e-07
CAGL0K11616g3202981179e-07
KLLA0E08877g2941741161e-06
Sklu_2115.42991761161e-06
KLLA0F13464g3002851152e-06
Kwal_47.192282811521142e-06
AGR191W2982751124e-06
Sklu_2430.103241851125e-06
Sklu_2442.82752661106e-06
CAGL0H03839g2822711106e-06
YGR257C (MTM1)3662631117e-06
YJR077C (MIR1)3111621107e-06
AAL014C2712711091e-05
KLLA0E02750g3042781091e-05
Kwal_33.155973051821091e-05
KLLA0D04290g1881751052e-05
Scas_673.173141801062e-05
Sklu_2433.84201341063e-05
AFL196W3612741063e-05
KLLA0B14454g3051811054e-05
CAGL0F00231g3071651044e-05
Scas_328.12271421025e-05
Scas_721.1293231801036e-05
Sklu_1119.13071821027e-05
KLLA0E18788g3813241028e-05
YER053C3002551028e-05
YKL120W (OAC1)3241761029e-05
CAGL0C02013g3293281001e-04
Kwal_27.114192981791001e-04
AER450C3081811002e-04
AFR253W3441571002e-04
Scas_613.24177171972e-04
CAGL0F07711g368269974e-04
Kwal_26.7653325185956e-04
KLLA0D09889g364271957e-04
Scas_715.4530562930.001
CAGL0D04774g32280900.003
Sklu_2435.2344256860.008
KLLA0A00979g343134830.017
KLLA0D04312g10383770.023
Kwal_55.21106328264790.052
Scas_687.15*32873790.060
Kwal_55.2133832388790.061
KLLA0B11319g35568790.065
YFR045W285124780.069
Sklu_2260.5302198770.10
YPR128C (ANT1)328244770.11
YDL119C30768760.14
KLLA0F08547g308185760.14
Kwal_34.15907312195740.25
Scas_705.9323250720.41
AFR147C315232720.43
KLLA0D04950g274273681.2
ABL023W30962671.7
AFR542W310183652.8
Sklu_2127.432365644.4
Kwal_23.575730746618.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K12210g
         (306 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   632   0.0  
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   434   e-154
Scas_718.5                                                            422   e-149
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   416   e-147
Scas_667.22                                                           405   e-143
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   401   e-141
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         378   e-132
Kwal_27.12599                                                         372   e-130
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...   363   e-126
Sklu_1275.1 , Contig c1275 314-1249                                   338   e-116
Sklu_2398.4 , Contig c2398 9476-10405                                 337   e-116
Kwal_33.12988                                                         331   e-114
Kwal_56.23011                                                         327   e-112
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...   307   e-104
Scas_697.47                                                           144   1e-40
Kwal_33.15446                                                         142   2e-40
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...   140   2e-39
Kwal_23.2913                                                          140   4e-39
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...   134   5e-37
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...   134   6e-37
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...   134   6e-37
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...   129   6e-35
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...   128   9e-35
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement               123   1e-32
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...   121   3e-32
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement        119   7e-32
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...   111   2e-28
Kwal_55.21335                                                         110   7e-28
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement        107   4e-27
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   107   2e-26
Scas_632.9                                                            105   2e-26
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        104   9e-26
Scas_640.25                                                           103   1e-25
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...   104   1e-25
Kwal_26.8669                                                          101   8e-25
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...   100   3e-24
Scas_714.18                                                           100   3e-24
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...   100   3e-24
Scas_691.4                                                            100   4e-24
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...   100   5e-24
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    99   5e-24
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    99   5e-24
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    99   7e-24
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    99   9e-24
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    97   5e-23
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    97   5e-23
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    97   5e-22
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    92   2e-21
Scas_662.12                                                            92   2e-21
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    91   5e-21
Scas_379.2                                                             91   6e-21
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    91   1e-20
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    90   1e-20
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    92   2e-20
Scas_709.9                                                             90   4e-20
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    89   5e-20
Kwal_55.20868                                                          89   6e-20
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    88   9e-20
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    90   9e-20
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    87   2e-19
Kwal_47.18216                                                          87   2e-19
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    86   6e-19
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    87   8e-19
Kwal_23.4731                                                           85   9e-19
Kwal_33.14050                                                          84   3e-18
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    84   4e-18
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    82   1e-17
Scas_582.7                                                             82   1e-17
Scas_602.8                                                             83   2e-17
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          83   2e-17
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    81   3e-17
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          80   4e-17
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    79   9e-17
Kwal_47.17321                                                          80   2e-16
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    77   4e-16
Kwal_27.12081                                                          78   4e-16
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       77   4e-16
Scas_578.3*                                                            77   1e-15
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            76   2e-15
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    74   4e-15
KLLA0D14036g complement(1203522..1204817) some similarities with...    75   8e-15
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    73   1e-14
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    73   2e-14
Scas_721.27                                                            72   6e-14
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    71   1e-13
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    69   4e-13
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    69   5e-13
Scas_702.10                                                            68   8e-13
Kwal_23.3965                                                           68   9e-13
Kwal_23.3042                                                           68   1e-12
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    67   2e-12
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    67   3e-12
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    66   4e-12
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    66   4e-12
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         65   6e-12
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    65   6e-12
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    65   1e-11
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    65   1e-11
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    64   1e-11
Scas_589.10                                                            64   2e-11
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    64   2e-11
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    64   2e-11
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       63   8e-11
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    63   9e-11
Kwal_14.2210                                                           61   1e-10
Scas_489.4                                                             61   2e-10
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    60   4e-10
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    60   4e-10
Scas_645.9                                                             60   7e-10
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    59   8e-10
Kwal_0.232                                                             59   1e-09
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    59   1e-09
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    59   1e-09
Kwal_23.3529                                                           59   2e-09
Scas_716.29                                                            58   2e-09
Scas_562.12                                                            57   3e-09
Scas_669.6                                                             58   3e-09
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            57   4e-09
Kwal_26.7967                                                           56   6e-09
Kwal_27.12481                                                          56   7e-09
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    56   8e-09
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    56   1e-08
Scas_558.2                                                             55   1e-08
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    55   1e-08
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    55   1e-08
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    55   2e-08
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    55   2e-08
Kwal_23.4354                                                           55   2e-08
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    55   2e-08
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    55   2e-08
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    55   2e-08
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    55   2e-08
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    55   3e-08
Scas_718.24                                                            54   3e-08
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    54   4e-08
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    54   4e-08
Kwal_27.11626                                                          54   5e-08
Scas_667.4                                                             54   6e-08
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    53   9e-08
Scas_717.20                                                            53   1e-07
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    52   2e-07
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    51   3e-07
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    51   4e-07
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    50   5e-07
Kwal_26.7972                                                           50   6e-07
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    50   9e-07
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    50   9e-07
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    49   1e-06
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            49   1e-06
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    49   2e-06
Kwal_47.19228                                                          49   2e-06
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    48   4e-06
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         48   5e-06
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          47   6e-06
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    47   6e-06
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    47   7e-06
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    47   7e-06
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    47   1e-05
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    47   1e-05
Kwal_33.15597                                                          47   1e-05
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    45   2e-05
Scas_673.17                                                            45   2e-05
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       45   3e-05
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    45   3e-05
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    45   4e-05
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    45   4e-05
Scas_328.1                                                             44   5e-05
Scas_721.129                                                           44   6e-05
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             44   7e-05
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    44   8e-05
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    44   8e-05
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    44   9e-05
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    43   1e-04
Kwal_27.11419                                                          43   1e-04
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    43   2e-04
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    43   2e-04
Scas_613.24                                                            42   2e-04
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    42   4e-04
Kwal_26.7653                                                           41   6e-04
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    41   7e-04
Scas_715.45                                                            40   0.001
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    39   0.003
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         38   0.008
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    37   0.017
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    34   0.023
Kwal_55.21106                                                          35   0.052
Scas_687.15*                                                           35   0.060
Kwal_55.21338                                                          35   0.061
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    35   0.065
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    35   0.069
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         34   0.10 
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    34   0.11 
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    34   0.14 
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    34   0.14 
Kwal_34.15907                                                          33   0.25 
Scas_705.9                                                             32   0.41 
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    32   0.43 
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    31   1.2  
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    30   1.7  
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    30   2.8  
Sklu_2127.4 , Contig c2127 6322-7293                                   29   4.4  
Kwal_23.5757                                                           28   8.8  

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/306 (100%), Positives = 306/306 (100%)

Query: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60
           MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK
Sbjct: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60

Query: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120
           IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK
Sbjct: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180
           HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK
Sbjct: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240
           ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT
Sbjct: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240

Query: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
           VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF
Sbjct: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300

Query: 301 VSFEMT 306
           VSFEMT
Sbjct: 301 VSFEMT 306

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  434 bits (1115), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/321 (66%), Positives = 248/321 (77%), Gaps = 16/321 (4%)

Query: 1   MSEEFPTPQLLNELED---VPPPT-----PYGRVVKDIFAGTMGGVAQVLVGQPFDTTKV 52
           MSEEFPTPQLL+ELED   V  P         RV+KDIFAGT+GG+AQVLVGQPFDTTKV
Sbjct: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKV 60

Query: 53  RLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYN 112
           RLQT+ T+   +EV++NL++NEG  AFYKG LTPLLGVGICVSVQFGVNE+MKRFF  YN
Sbjct: 61  RLQTATTRTTTLEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120

Query: 113 ADR--------VDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNER 164
           A +        VD  +   LPL QYY+CGLTGGVVNSFLA+PIE +RIRLQTQTS G +R
Sbjct: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180

Query: 165 QFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAW 224
           +FKGP+DCIKKL     LMRGL PTMIRAGHGLGTYF  YEALV +E   G  RN+IP W
Sbjct: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240

Query: 225 KLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKG 284
           KLC FGA SGT+LWLTVYP+DVVKS++Q D +  PKYKNSI    + +Y + GI AFFKG
Sbjct: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300

Query: 285 FVPTMIRAAPANAATFVSFEM 305
           F PTM+R+AP N ATF++FE+
Sbjct: 301 FGPTMVRSAPVNGATFLTFEL 321

>Scas_718.5
          Length = 324

 Score =  422 bits (1084), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 190/318 (59%), Positives = 240/318 (75%), Gaps = 13/318 (4%)

Query: 1   MSEEFPTPQLLNELEDVPPPT-------------PYGRVVKDIFAGTMGGVAQVLVGQPF 47
           MSE+F +PQL+NE +D                     RV+KDI AGT GG++QV+VGQPF
Sbjct: 1   MSEDFSSPQLINEFDDEMASNGNDNNGSSHSMAKDSTRVLKDILAGTCGGISQVIVGQPF 60

Query: 48  DTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRF 107
           DTTKVR+QTS   +G +++++ L++NEG  AFYKG L P++GVG CVSVQFGVNE+MKRF
Sbjct: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120

Query: 108 FAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFK 167
           F  +N  R    +   L L QYY+CGLTGGVVNSFLA+PIEHVRIRLQTQT  GNER+FK
Sbjct: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180

Query: 168 GPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLC 227
           GP DCI+KL K K+LMRGL P M+RAGHGLG YF  YEAL+  E +KG  R++I +WKLC
Sbjct: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240

Query: 228 SFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVP 287
           S+G+LSG +LWL +YP+DVVKS++QTD++ NP++KNS+      LY++ GI AFFKGF P
Sbjct: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300

Query: 288 TMIRAAPANAATFVSFEM 305
           TM+RAAP N ATFV+FE+
Sbjct: 301 TMLRAAPVNGATFVTFEL 318

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 78/188 (41%), Gaps = 23/188 (12%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQT------SKTKIGVIEVVQNLLRNEGALAFYKGMLT 85
            G  GGV    +  P +  ++RLQT       +   G ++ ++ L++ +   +  +G+  
Sbjct: 145 CGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRP 201

Query: 86  PLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLC--GLTGGVVNSFL 143
            +L  G  +   F   E++         DR +        +  + LC  G   GVV    
Sbjct: 202 MMLRAGHGLGCYFLTYEALIANEIKKGKDRSE--------IASWKLCSYGSLSGVVLWLA 253

Query: 144 AAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGHGLGTY 200
             P++ V+  +QT T + N R      + I  L + +   A  +G  PTM+RA    G  
Sbjct: 254 IYPLDVVKSMIQTDTLR-NPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGAT 312

Query: 201 FAAYEALV 208
           F  +E ++
Sbjct: 313 FVTFELVM 320

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  416 bits (1069), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 199/305 (65%), Positives = 234/305 (76%), Gaps = 6/305 (1%)

Query: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60
           MSEEFPTPQL+++LED  P    GRVVKD+ AGT GG+AQVL+GQPFDTTKVRLQTSK  
Sbjct: 1   MSEEFPTPQLIDDLED-HPGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVP 59

Query: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120
               EVV+NLL+NEG   FYKG LTPL+GVG CVS+QFGVNE+MKRFF A N D      
Sbjct: 60  TSAAEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDH----- 114

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180
           +  L L QYYLCGLTGG+ NSFLA+PIEHVRIRLQTQT  G + +FKGP DCIKKL   K
Sbjct: 115 NATLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQK 174

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240
            LMRGL+PTM+R GHG GTYF  YEALV K+  +G  R +IP WKLC +GALSGT LWL 
Sbjct: 175 GLMRGLIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLM 234

Query: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
           VYP+DVVKSV+QTD++  P+   ++I+  R LY + G+ AFFKGF PTM+RAAPAN  TF
Sbjct: 235 VYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTF 294

Query: 301 VSFEM 305
            +FE+
Sbjct: 295 ATFEL 299

>Scas_667.22
          Length = 306

 Score =  405 bits (1042), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 192/305 (62%), Positives = 231/305 (75%), Gaps = 5/305 (1%)

Query: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60
           MSEEFPTPQL+++LE+  P     RV+KD+ AGT GG+AQVLVGQPFDTTKVRLQTS T 
Sbjct: 1   MSEEFPTPQLIDDLEN-HPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP 59

Query: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120
              +EV++ LL+NEG   FYKG LTPL+GVG CVS+QFGVNE+MKRFF + N D      
Sbjct: 60  TTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQIL 119

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180
            +P    QYY+CGLTGG+ NSFLA+PIEHVRIRLQTQT  G   +FKGP DCI+KL    
Sbjct: 120 SLP----QYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG 175

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240
             MRGL PTM+R GHG GTYF  YEA+V  E  KG  R ++PAWKLC FGALSGT LW+ 
Sbjct: 176 GFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMM 235

Query: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
           VYP+DV+KSV+QTD++++PKY NSI    + LY + G+ AFFKGF PTM+RAAPAN ATF
Sbjct: 236 VYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATF 295

Query: 301 VSFEM 305
            +FE+
Sbjct: 296 ATFEL 300

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  401 bits (1030), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 230/307 (74%), Gaps = 8/307 (2%)

Query: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60
           MSEEFP+PQL+++LE+  P     RVVKD+ AGT GG+AQVLVGQPFDTTKVRLQTS T 
Sbjct: 1   MSEEFPSPQLIDDLEE-HPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP 59

Query: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120
              +EVV+ LL NEG   FYKG LTPL+GVG CVS+QFGVNE+MKRFF   NAD      
Sbjct: 60  TTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSS--- 116

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180
              L L QYY CG+TGG+VNSFLA+PIEHVRIRLQTQT  G   +FKGP +CIKKL   K
Sbjct: 117 --TLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK 174

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEK--GTPRNQIPAWKLCSFGALSGTILW 238
           AL+RGL PT++R GHG GTYF  YEAL+  +  K  G  R  IPAWKLC FGALSGT LW
Sbjct: 175 ALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALW 234

Query: 239 LTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAA 298
           L VYP+DV+KSV+QTD+++ PK+ NSI    + LY   GI AFFKGF PTM+RAAPAN A
Sbjct: 235 LMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGA 294

Query: 299 TFVSFEM 305
           TF +FE+
Sbjct: 295 TFATFEL 301

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  378 bits (970), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 179/305 (58%), Positives = 220/305 (72%), Gaps = 6/305 (1%)

Query: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60
           M+EE PTP ++++L+     T   RV KD+ AGT GGV+QVL+GQPFDTTKVRLQTS   
Sbjct: 1   MTEELPTPLIIDDLDGAHDST---RVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP 57

Query: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120
              ++VV+ L++NEG   FYKG LTPL+GVG CVSVQFGVNE+MKRFF + N +   P +
Sbjct: 58  TTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNS-GPNE 116

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180
              L L QYYLCG  GG  NSFLA+PIEHVRIRLQTQT  G   QF GP DCIKKL    
Sbjct: 117 --TLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN 174

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240
           +LMRGL PTM+R  HG G YF  YEAL+  E  KG  R++IP WKLC FGA SGT LWL 
Sbjct: 175 SLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLM 234

Query: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
           +YP+DV+KSV+QTDS+  PK   ++++  + +Y   G+ +FFKGF PTM+RAAPAN ATF
Sbjct: 235 IYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294

Query: 301 VSFEM 305
            +FE+
Sbjct: 295 ATFEL 299

>Kwal_27.12599
          Length = 304

 Score =  372 bits (956), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 225/305 (73%), Gaps = 7/305 (2%)

Query: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60
           M EE  +P L+++++  P  +  GRV+KD+ AGT GG+AQVLVGQPFDTTKVRLQTS T 
Sbjct: 1   MPEETSSPLLIDDIDQQPHDS--GRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP 58

Query: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120
              +EVV+ L++NEG   FYKG LTPL+GVG CVS QFGVNE+MKRFF   +AD   P K
Sbjct: 59  TTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSAD---PHK 115

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180
            + LP  QYY+CG  GGV NSFLA+PIEHVRIRLQTQT+ G   +FKGP DCI KL    
Sbjct: 116 TLTLP--QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG 173

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240
           ALMRGL PT++R   G  TYF  YEALV  +  KG  R+ +PAWKLC FGA+SG  LWLT
Sbjct: 174 ALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLT 233

Query: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
           VYP+DV+KS++QTD+++NP    +II+  R +  ++G  +FFKGF PTM+RAAPAN ATF
Sbjct: 234 VYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATF 293

Query: 301 VSFEM 305
            +FE+
Sbjct: 294 ATFEL 298

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score =  363 bits (931), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 223/304 (73%), Gaps = 8/304 (2%)

Query: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60
           M+EEFPTPQL+++LE    P    RV+KD+ AGT GG+AQVLVGQPFDTTKVRLQTS+T 
Sbjct: 1   MTEEFPTPQLIDDLES---PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS 57

Query: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120
              ++V+++L++NEG + FYKG LTPL+GVG CVS+QFGVNE+MKRFF  +     D   
Sbjct: 58  TNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF-----DEAA 112

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180
              L L QYY+CG+ GG  NSFLA+PIEH+RIRLQTQT  G   +FKGP DCIKKL    
Sbjct: 113 SQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG 172

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240
            LMRGL PTM+R  HG G YF  YEAL+  + + G  R  IPAWKLC FGA SGT+LW  
Sbjct: 173 QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTM 232

Query: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
           VYP+DV+KSV+QTD+++ PK  N+I+   R +  + G+   FKGF PTM+RAAPANAATF
Sbjct: 233 VYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATF 292

Query: 301 VSFE 304
            +FE
Sbjct: 293 ATFE 296

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score =  338 bits (867), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 159/306 (51%), Positives = 207/306 (67%), Gaps = 8/306 (2%)

Query: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60
           MS+E  TPQ++++L D P    + + +KDI +GT GG+AQVLVGQPFD TKVR+QTS   
Sbjct: 1   MSDELTTPQVVDDLSDAPE---FRKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGS 57

Query: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120
              IEV++NL++NEG LAFYKG L PL+GVG CVS QFGVNE+MKR+F      RV+  K
Sbjct: 58  PTAIEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFL-----RVNGYK 112

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180
              L L QYY CG   G  N+FLA PIEHVRIRLQ QT    + +++G  DC+KKL K K
Sbjct: 113 DQHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQK 172

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240
           ALMRG   T++R  HG G YF  YEAL++ + + G  R  IP WK+C FGA SG   W  
Sbjct: 173 ALMRGFTATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAM 232

Query: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
            YP DVVKS++Q D + +P +  ++ +  ++++   G  AF KGFVPTM+R+ P N ATF
Sbjct: 233 TYPFDVVKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATF 292

Query: 301 VSFEMT 306
            +FE+T
Sbjct: 293 ATFEVT 298

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  337 bits (863), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 205/306 (66%), Gaps = 8/306 (2%)

Query: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60
           MS+E   PQ++++L D      Y R +KDI +GT GG+AQVLVGQPFD TKVR+QTS   
Sbjct: 1   MSDELTAPQVVDDLSD---SLDYKRAIKDILSGTAGGIAQVLVGQPFDITKVRMQTSAGS 57

Query: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120
              ++VV +L++NEG L FYKG L PL+GVG CVS QFGVNE+MKR F   N D   P K
Sbjct: 58  ATAVDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGD---PSK 114

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180
             PL L QYY+CG+  G  N+FLA PIEHVRIRLQ QT      +++G  DC++KL K  
Sbjct: 115 --PLSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQG 172

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240
           ALMRG   T++R  HG G YF+ YEAL+  + +KG PR  I  WK+C FGA SG   W  
Sbjct: 173 ALMRGFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAM 232

Query: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
            YP+DVVKS++Q+D + +P +  ++ +  +++Y   G  AF KGF+P M+R+ P N ATF
Sbjct: 233 AYPIDVVKSIMQSDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVNGATF 292

Query: 301 VSFEMT 306
            +FEMT
Sbjct: 293 ATFEMT 298

>Kwal_33.12988
          Length = 303

 Score =  331 bits (849), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 201/305 (65%), Gaps = 8/305 (2%)

Query: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60
           MS+E   PQ++++L D    +   R +KDI AGT GG+AQVLVGQPFD TKVRLQTS T 
Sbjct: 1   MSDELTMPQVVDDLTD---KSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTP 57

Query: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120
              + VVQ+L++NEG   FYKG   PL+GVG+CVS QFG NE+MKR+F   N       +
Sbjct: 58  TTALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNN-----FQ 112

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180
              L L +YY CG   G  N+FLA PIEHVRI LQ QT    + +++G  DCIKKL K  
Sbjct: 113 STSLRLPEYYACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLKEG 172

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240
            LMRG  PT++R  HG G YF +YEA++  E  KG  R  IPAWKLC +GA SG++LW  
Sbjct: 173 KLMRGFTPTILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAM 232

Query: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
           VYP DV+KSV+Q+D +  P Y  ++ +  + +Y + G  AF KGF PTM+R+ P N ATF
Sbjct: 233 VYPFDVIKSVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATF 292

Query: 301 VSFEM 305
            +FEM
Sbjct: 293 TAFEM 297

>Kwal_56.23011
          Length = 303

 Score =  327 bits (837), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 155/306 (50%), Positives = 200/306 (65%), Gaps = 8/306 (2%)

Query: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60
           MSEE  +PQ++++L D      + + +KD+F GT+GGVAQVLVGQPFD TKVRLQTS   
Sbjct: 1   MSEELTSPQVVDDLVDT---HDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVP 57

Query: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120
               +V+++L++NEG LAFYKG L PL GVG CVS QFGVNE++K++F      + D   
Sbjct: 58  TTAAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWF-----RKKDGNF 112

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180
             PL L QYY CG   G  N+FLA PIEHVRIRLQ QT+  +  ++ G  DC +KL K  
Sbjct: 113 DQPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQG 172

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240
           ALMRG   T +R  HG G YF  YE L+  +   G  R  IPAWK+C +GA SG   W  
Sbjct: 173 ALMRGFTATTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAFFWAM 232

Query: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
            YP DVVKSV+Q D ++NP Y  + +   +A+Y++ G  AF KGF PTM+R+ P N ATF
Sbjct: 233 TYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATF 292

Query: 301 VSFEMT 306
            +FE+T
Sbjct: 293 AAFEIT 298

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score =  307 bits (786), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 147/307 (47%), Positives = 193/307 (62%), Gaps = 6/307 (1%)

Query: 1   MSEEF-PTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKT 59
           MS+E   TPQ++ +L D+     + + +KD+F+GT+GGVAQVLVGQPFD  KVRLQT   
Sbjct: 1   MSDELLITPQVVEDLTDLHG---FRKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPG 57

Query: 60  KIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQ 119
                E + +L++ EG + FYKG + PL+GVG CVS QFG+NE+MKR+F   N  R    
Sbjct: 58  NATAWEAITDLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYD 117

Query: 120 KHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA 179
               L L QYY CG   G  N+ LA PIEHVRIRLQ Q       ++K   DC +KL K 
Sbjct: 118 N--TLSLGQYYTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQ 175

Query: 180 KALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWL 239
            +LMRG   T++R  HG G YF  YE L+  +   G  R  I AWK C FGALSG   W 
Sbjct: 176 GSLMRGFTATLMRTSHGFGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWA 235

Query: 240 TVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAAT 299
             YP DVVKSV+Q D + NP Y  ++++  + +Y++ G+ AF KGF+PTM+R+ P N AT
Sbjct: 236 MTYPFDVVKSVMQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGAT 295

Query: 300 FVSFEMT 306
           F +FE+T
Sbjct: 296 FAAFEVT 302

>Scas_697.47
          Length = 328

 Score =  144 bits (363), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 100/317 (31%), Positives = 157/317 (49%), Gaps = 37/317 (11%)

Query: 12  NELEDVPPPTPYGRVVKD----IFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVV 67
           + L+  PP TP    ++D    + AG +GGV  VL G PFD  KVR Q+ +     I  +
Sbjct: 18  HALKARPPVTPPANAIRDNLKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQAS-STIHAI 76

Query: 68  QNLLRNEGAL-----------AFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRV 116
           + +L++  A+            FYKG++ PLLGV    +V F   +  K+      +D  
Sbjct: 77  KIILKDARAIPTSNMLVNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVT--RSDSS 134

Query: 117 DPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKL 176
             Q    L + Q    G    +  + + AP E +++ LQT  +  ++  F G    I K 
Sbjct: 135 SAQ----LTMGQMAAAGFISAIPTTLVTAPTERIKVVLQTAGAN-SKTSFIGAAKNIVKD 189

Query: 177 AKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKG------TPRNQIPAWKLCSFG 230
              K+L +G L T+ R G G   YFA+YE  + K+F         +   ++    +C  G
Sbjct: 190 GGVKSLFKGSLATLARDGPGSALYFASYE--ISKKFLNDRNATAESKTGEVNIANVCLAG 247

Query: 231 ALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALY-KQHGIPAFFKGFVPTM 289
            ++G  +WL V+P+D +K+ LQ+ S        S++ ATR +Y K+ GI  FF G  P +
Sbjct: 248 GIAGMSMWLVVFPIDTIKTKLQSSS-----GSQSMVAATREIYVKRGGIKGFFPGLGPAL 302

Query: 290 IRAAPANAATFVSFEMT 306
           +R+ PANAATF+  E+T
Sbjct: 303 LRSFPANAATFLGVELT 319

>Kwal_33.15446
          Length = 305

 Score =  142 bits (359), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 103/301 (34%), Positives = 149/301 (49%), Gaps = 29/301 (9%)

Query: 17  VPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK---IGVIEVVQNLLRN 73
           V P   Y R++  + +G   G+A+  VG PFDT KVRLQTS+      G ++ V   +R 
Sbjct: 10  VVPNEAYSRMMGFV-SGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQ 68

Query: 74  EGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCG 133
           +G   FY G   PL+G  +  SV  G   + +     Y       Q    LPL    L G
Sbjct: 69  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY-----QHEEKLPLSGCILSG 123

Query: 134 LTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLPTM 190
           +  G   SF+AAP+E  + +LQ Q      R ++GP D IKK+  A   + + +GL+ T+
Sbjct: 124 VLAGWSVSFIAAPVELAKAKLQVQYDAQTTR-YRGPLDVIKKVYAADGIRGMYKGLVSTL 182

Query: 191 IRAGHGLGTYFAAYEALVVKEFEKGT--PRNQIPAWKLCSFGALSGTI-LWLTVYPVDVV 247
           I   H +  ++ +YE L+ + F+  T      I  W     G  S +   W T YP DV+
Sbjct: 183 IFRTHFV-YWWGSYE-LLTRWFKANTNLSDTAINFWA----GGFSASFGFWTTAYPSDVI 236

Query: 248 KSVLQTDSIENPKYKNSII---KATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           K V+    + N KY  S+     A   +++  GI  FFKGFVP+ +R+ PANAA   SFE
Sbjct: 237 KQVI----LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292

Query: 305 M 305
            
Sbjct: 293 F 293

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score =  140 bits (352), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/292 (35%), Positives = 151/292 (51%), Gaps = 23/292 (7%)

Query: 23  YGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---GVIEVVQNLLRNEGALAF 79
           Y R++  + AG   GVA+  VG PFDT KVRLQTS+ +    G ++ V    RN+G   F
Sbjct: 21  YSRIMGFV-AGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGF 79

Query: 80  YKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVV 139
           Y G   PL+G  +  SV  G   + +     Y    V P     LPL    + G+  G  
Sbjct: 80  YLGFTPPLVGWILMDSVMLGCLHNYRMLMHKY----VYPNDE-KLPLSGCIISGVLAGWS 134

Query: 140 NSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHG 196
            SF+A PIE  + +LQ Q  +   R +KGP D IKK+  A   + L +GL+ T+I   H 
Sbjct: 135 VSFIAPPIELAKAKLQVQYDKTTTR-YKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF 193

Query: 197 LGTYFAAYEALVVKEFEKGTPRNQ--IPAWKLCSFGALSGTI-LWLTVYPVDVVKSVLQT 253
           +  ++ +YE L+ + F + T  ++  I  W     G  S +   W T YP DVVK V+  
Sbjct: 194 V-YWWGSYE-LLTRWFRENTKMSEAAINFWA----GGFSASFGFWTTAYPSDVVKQVVLC 247

Query: 254 DSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
           +   +  +K S   A + +Y+  GI  FFKGFVP+ +R+ PANAA   +FE 
Sbjct: 248 NDKYDGSFK-SWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEF 298

>Kwal_23.2913
          Length = 320

 Score =  140 bits (352), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 93/294 (31%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRN----EGAL------ 77
           + + AG +GGV  VL G PFD  KVR Q+++   G ++ +  +L       G L      
Sbjct: 30  ESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQAS-GTLDAISRVLHEAKSKSGPLPLNQIK 88

Query: 78  AFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVD----PQKHVPLPLHQYYLCG 133
            FY+G++ PLLGV    +V F   +  KR     +    D      K  PL   Q  L G
Sbjct: 89  GFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAG 148

Query: 134 LTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRA 193
               +  + + AP E V++ LQT  S      F G    + +    ++L +G L T+ R 
Sbjct: 149 FFSAIPTTLITAPTERVKVVLQTSESG----SFLGAARTLIREGGVRSLFQGTLATLARD 204

Query: 194 GHGLGTYFAAYEALVVKEF-EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQ 252
           G G   YFA+YE  V K F  +    + +    +C  G ++G  +W+ V+P+D +K+ LQ
Sbjct: 205 GPGSALYFASYE--VSKRFLSRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQ 262

Query: 253 TDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMT 306
           + S        S+++A R +Y + G+  FF G  P ++R+ PANAATF+  E T
Sbjct: 263 SSS-----RSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFLGVEFT 311

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 28/58 (48%)

Query: 26  VVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGM 83
           VV    AG + G++  +   P DT K +LQ+S     +++  + +    G   F+ G+
Sbjct: 233 VVSICVAGGVAGMSMWIGVFPIDTIKTKLQSSSRSQSMVQAAREIYTRAGLRGFFPGL 290

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score =  134 bits (337), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 101/326 (30%), Positives = 154/326 (47%), Gaps = 47/326 (14%)

Query: 7   TPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEV 66
           TP   N LE       +   +K + AG +GGV  VL G PFD  KVR Q+++ K   ++ 
Sbjct: 4   TPAETNILEH--KTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAK-STMDA 60

Query: 67  VQNLLRNEGALA------------------FYKGMLTPLLGVGICVSVQFGVNESMKRFF 108
           V  +L+   +L+                  FYKG++ PL+GV    +V F   +  KR  
Sbjct: 61  VSIILKEARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLV 120

Query: 109 AAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKG 168
               A         PL   Q    G    +  + + AP E +++ LQT +      +FKG
Sbjct: 121 TWKQAS------DAPLTTAQMATAGFISAIPTTLVTAPTERIKVVLQTNS------EFKG 168

Query: 169 PF----DCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYE---ALVVKEFEKGTPRNQI 221
            F      I      K+L  G L T+ R G G   YFA+YE   A + K   K   ++++
Sbjct: 169 SFIKAAKHIVSTGGVKSLFNGSLATLARDGPGSALYFASYELSKAFLNKSVAK-KDKDEV 227

Query: 222 PAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQH-GIPA 280
               +C  G ++G  +WL V+P+D +K+ LQ  +        S+++AT+ +Y Q  GI  
Sbjct: 228 NLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVATTP-----ISMVQATKDIYIQRGGIKG 282

Query: 281 FFKGFVPTMIRAAPANAATFVSFEMT 306
           FF G  P ++R+ PANAATF+  E+T
Sbjct: 283 FFPGLGPALLRSFPANAATFLGVELT 308

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score =  134 bits (338), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 97/304 (31%), Positives = 153/304 (50%), Gaps = 43/304 (14%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALA-------- 78
           +K + AG +GGV  VL G PFD  KVR Q+++ +   ++ V ++L+     A        
Sbjct: 29  LKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQAR-SAMDAVSHILQAARQAAGPTSLNAV 87

Query: 79  --FYKGMLTPLLGVGICVSVQFGVNESMKRFFAAY------NADRVDPQKHVPLPLHQYY 130
             FYKG++ PLLGV    +V F   +  K+   +        A  V+P+    L L Q  
Sbjct: 88  RGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPE----LTLSQMA 143

Query: 131 LCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPF-DCIKKLAKA---KALMRGL 186
             G    +  + + AP E V++ LQT        Q K  F D  K++ +    ++L +G 
Sbjct: 144 AAGFISAIPTTLVTAPTERVKVVLQT-------TQGKASFLDAAKQIVRTQGFQSLFKGS 196

Query: 187 LPTMIRAGHGLGTYFAAYEALVVKEF---EKGTPRNQIPAWKLCSFGALSGTILWLTVYP 243
           L T+ R G G   YFA+YE  + KE+     G    ++    +C  G ++G  +W+ V+P
Sbjct: 197 LATLSRDGPGSALYFASYE--ICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVVFP 254

Query: 244 VDVVKSVLQTDSIENPKYKNSIIKATRALYKQH-GIPAFFKGFVPTMIRAAPANAATFVS 302
           +D VK+ LQ+ S      + S+++ TR +Y    GI  FF G  P ++R+ PANAATF+ 
Sbjct: 255 IDTVKTQLQSSS-----KRQSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFPANAATFLG 309

Query: 303 FEMT 306
            E+T
Sbjct: 310 VELT 313

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score =  134 bits (338), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 147/291 (50%), Gaps = 31/291 (10%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLL---RNEGALA------ 78
           K + AG +GGV  VL G PFD  KVR Q+++   G ++ V+ +L   R +  L+      
Sbjct: 49  KSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQAS-GTVDAVRKILVEARAQSGLSAVNMMR 107

Query: 79  -FYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGG 137
            FYKG++ PLLGV    +V F   +  K+    +N +         L   Q    G    
Sbjct: 108 GFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVT-WNDNSGK------LTTAQLATAGFISA 160

Query: 138 VVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGL 197
           +  + + AP E V++ LQTQ++             I      ++L RG L T+ R G G 
Sbjct: 161 IPTTLVMAPTERVKVVLQTQSNH----SLGSAAKHILATGGVRSLFRGSLATLARDGPGS 216

Query: 198 GTYFAAYEAL-VVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSI 256
             YFA+YEA         GT  N++    +C  G ++G  +W+ V+P+D +K+ LQ+ + 
Sbjct: 217 ALYFASYEATKAYLNARSGT--NELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSSNT 274

Query: 257 ENPKYKNSIIKATRALYK-QHGIPAFFKGFVPTMIRAAPANAATFVSFEMT 306
                + ++++ATR +Y  + GI  FF G  P ++R+ PANAATF+  E+T
Sbjct: 275 -----RQTMMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVELT 320

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score =  129 bits (324), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 146/310 (47%), Gaps = 37/310 (11%)

Query: 18  PP--PTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRN-- 73
           PP    P    +K   AG +GGV  V  G PFD  KVR Q  +     +  + N+++   
Sbjct: 25  PPIKSNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQAN-STVHAITNIIKEAK 83

Query: 74  ---EGAL------AFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPL 124
              +G L       FYKG++ PLLGV    +V F   +  K+     N      +    L
Sbjct: 84  TQVKGTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNE----L 139

Query: 125 PLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMR 184
            + Q    G    +  + + AP E V++ LQT +S+G+   F      I K     +L +
Sbjct: 140 TMGQMAAAGFISAIPTTLVTAPTERVKVVLQT-SSKGS---FIQAAKTIVKEGGIASLFK 195

Query: 185 GLLPTMIRAGHGLGTYFAAYEALVVKEF-EKGTPRNQ------IPAWKLCSFGALSGTIL 237
           G L T+ R G G   YFA+YE  + K +     PR        +    +C  G ++G  +
Sbjct: 196 GSLATLARDGPGSALYFASYE--ISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSM 253

Query: 238 WLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHG-IPAFFKGFVPTMIRAAPAN 296
           WL V+P+D +K+ LQ  S      + +++ AT+ +Y Q G I  FF G  P ++R+ PAN
Sbjct: 254 WLAVFPIDTIKTKLQASST-----RQNMLSATKEIYLQRGGIKGFFPGLGPALLRSFPAN 308

Query: 297 AATFVSFEMT 306
           AATF+  EMT
Sbjct: 309 AATFLGVEMT 318

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score =  128 bits (321), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 99/301 (32%), Positives = 150/301 (49%), Gaps = 29/301 (9%)

Query: 23  YGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGV-------IEVVQNLLRNEG 75
           Y RV+  + AG   GVA+  VG PFDT KVRLQTS+   G        ++ V   L+N+G
Sbjct: 7   YSRVMGFV-AGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQG 65

Query: 76  ALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLT 135
               Y G   PL G  +  S   G   + +     Y    V P+ H  LPL    + G+ 
Sbjct: 66  IRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKY----VYPE-HDKLPLSGCIISGVM 120

Query: 136 GGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK-----------AKALMR 184
            G   SF+AAP+E  + +LQ Q       ++ GP D ++K+ K            ++L +
Sbjct: 121 AGWTVSFIAAPVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYK 179

Query: 185 GLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPV 244
           GL+ T+I   + +  ++ +YE L+ + F+K T  +  PA    + G  +    W + YP 
Sbjct: 180 GLISTLIFRSNFV-FWWGSYE-LITQWFQKNTNLSA-PAINFWAGGLSASFGFWTSAYPS 236

Query: 245 DVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           DVVK V+  +   +  +K S   A   +Y+Q GI  FFKGF+P+ +R+ PANAA   +FE
Sbjct: 237 DVVKQVVLCNDKYDGSFK-SWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFE 295

Query: 305 M 305
            
Sbjct: 296 F 296

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score =  123 bits (309), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 93/306 (30%), Positives = 154/306 (50%), Gaps = 29/306 (9%)

Query: 12  NELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---GVIEVVQ 68
           ++++  PP   Y R++  + +G   G+A+  VG PFDT KVRLQTS+      G ++ V 
Sbjct: 47  SDIQQPPPSEAYSRIMGFV-SGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVY 105

Query: 69  NLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRF---FAAYNADRVDPQKHVPLP 125
                +G   FY G   PL+G  +  SV  G   + +     +  YN ++        LP
Sbjct: 106 KTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEK--------LP 157

Query: 126 LHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KAL 182
           L    + G+  G   SF+AAP+E  + +LQ Q       ++ GP D IKK+  +   + L
Sbjct: 158 LSGCIISGVMAGWSVSFIAAPVELAKAKLQVQY-DAKTTKYTGPVDVIKKVYSSNGVRGL 216

Query: 183 MRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQ--IPAWKLCSFGALSGTI-LWL 239
            +GL  T+I   + +  ++ +YE L+ + F++ T  +   I  W     G  S +   W 
Sbjct: 217 YKGLTSTLIFRTNFV-FWWGSYE-LLTRWFKEHTNMSDTAINFWS----GGFSASFGFWT 270

Query: 240 TVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAAT 299
           T YP DV+K V+  +   +  +++  + A + +++  G   FFKGFVP+ +R+ PANAA 
Sbjct: 271 TAYPSDVIKQVVLCNDKYDGTFRSWKL-AAKDIWRTRGYRGFFKGFVPSFLRSFPANAAA 329

Query: 300 FVSFEM 305
             +FE 
Sbjct: 330 LAAFEF 335

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score =  121 bits (303), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 85/287 (29%), Positives = 133/287 (46%), Gaps = 25/287 (8%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEVVQNLLRNEGAL-AFYKGM 83
           +KDI  G++ G    ++  PFDT KVRLQT    +       +++   +EG    FY+G+
Sbjct: 8   LKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKGFYQGI 67

Query: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFL 143
            +PL G  +  +V F        F   +   +         PL +    G   G   SF+
Sbjct: 68  ASPLFGAALENAVLFVSFNQCTNFLDEFTQLK---------PLTKTIYSGAFAGACASFI 118

Query: 144 AAPIEHVRIRLQTQT---SQGNERQFKGPFDCIKKLAKAKALM---RGLLPTMIRAGHGL 197
             P+E V+ +LQ      S     +    +  IK + K K L+   +G L T +R   G 
Sbjct: 119 LTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGG 178

Query: 198 GTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIE 257
             +F  YE + +K         +   W+L   GA +G +   +V+P D VKSV QT+ + 
Sbjct: 179 AVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEHV- 237

Query: 258 NPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
                 SI+ A + + + HGI  F++G   T+IRAAPANA  F ++E
Sbjct: 238 ------SIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYE 278

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 85/211 (40%), Gaps = 32/211 (15%)

Query: 9   QLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK-------- 60
             L+E   + P T      K I++G   G     +  P +  K +LQ S           
Sbjct: 90  NFLDEFTQLKPLT------KTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTR 143

Query: 61  -IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQ 119
              V   ++++++ +G L  ++G L+  +   +  +V F   E MK  FA+ +    + +
Sbjct: 144 HTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHP--AEKE 201

Query: 120 KHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA 179
            H      +  + G + GV+ +    P + V+   QT+             + +KK+ + 
Sbjct: 202 NHT----WELLVSGASAGVLFNASVFPADTVKSVCQTE--------HVSIVNALKKVLRT 249

Query: 180 KALM---RGLLPTMIRAGHGLGTYFAAYEAL 207
             +    RGL  T+IRA     T F  YE L
Sbjct: 250 HGITGFYRGLGITLIRAAPANATVFYTYETL 280

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 40/83 (48%), Gaps = 4/83 (4%)

Query: 223 AWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGI-PAF 281
           A K  ++G+++G I  +  YP D VK  LQT          S I++T   Y   GI   F
Sbjct: 7   ALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRST---YTDEGIWKGF 63

Query: 282 FKGFVPTMIRAAPANAATFVSFE 304
           ++G    +  AA  NA  FVSF 
Sbjct: 64  YQGIASPLFGAALENAVLFVSFN 86

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score =  119 bits (299), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 86/290 (29%), Positives = 134/290 (46%), Gaps = 27/290 (9%)

Query: 23  YGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEVVQNLLRNEGAL-AF 79
           +    KDI  G++ G    ++  PFDT KVRLQT    +       ++    NEG    F
Sbjct: 3   FEEAAKDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGF 62

Query: 80  YKGMLTPLLGVGICVSVQFGVNESMKRFFAAYN-ADRVDPQKHVPLPLHQYYLCGLTGGV 138
           Y+G+ +PL G  +  +V           F ++N A R+   + +  PL +    G   G 
Sbjct: 63  YQGIGSPLAGAALENAV----------LFVSFNQAKRLLDVESLLSPLSKTVWAGAFAGA 112

Query: 139 VNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA---LMRGLLPTMIRAGH 195
             SF+  P+E ++ +LQ       +         IK +   +    L +G   T IR   
Sbjct: 113 CASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESG 172

Query: 196 GLGTYFAAYEALVVKEFEKGTPR-NQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTD 254
           G   +F  YE  VVK +     +  Q   W+L + GA +G     +++P D +KS +QTD
Sbjct: 173 GGAAWFTTYE--VVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTD 230

Query: 255 SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
            I+       +  ATR +Y + GI  F++G   T+IRA PANAA F ++E
Sbjct: 231 HID-------LSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score =  111 bits (277), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 91/306 (29%), Positives = 142/306 (46%), Gaps = 34/306 (11%)

Query: 14  LEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEVVQNLL 71
           +ED          + DI  G++ G    ++  PFDT KVRLQT  + +       ++   
Sbjct: 1   MEDSKKKGLIEGAILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTY 60

Query: 72  RNEG-ALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPL-PLHQY 129
           +NEG A  F++G+ +PL  VG C+      N ++   F +YN      +KH  + PL Q 
Sbjct: 61  QNEGIARGFFQGIASPL--VGACLE-----NATL---FVSYNQCSKFLEKHTNVFPLGQI 110

Query: 130 YLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGP--FDCIKKLAKAKAL---MR 184
            + G   G   S +  P+E V+ +LQ    Q    + K       IK +   + L    +
Sbjct: 111 LISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQ 170

Query: 185 GLLPTMIRAGHGLGTYFAAYEALVVKEFEKGT------PRNQIPAWKLCSFGALSGTILW 238
           G   T IR   G   +FA YE  +VK+  K         R++   W+L   G  +G    
Sbjct: 171 GQSGTFIRESFGGVAWFATYE--IVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFN 228

Query: 239 LTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAA 298
            +++P D VKSV+QT+ I       S+  A + ++ + G+  F++G   T+ RA PANAA
Sbjct: 229 ASIFPADTVKSVMQTEHI-------SLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAA 281

Query: 299 TFVSFE 304
            F  FE
Sbjct: 282 VFYIFE 287

>Kwal_55.21335
          Length = 317

 Score =  110 bits (274), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 129/284 (45%), Gaps = 23/284 (8%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEVVQNLLRNEGAL-AFYKGM 83
           +KDI  G++ G A  ++  P DT KVRLQT    +       ++   + EG +  FY+G+
Sbjct: 46  LKDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKGFYQGV 105

Query: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFL 143
            +PL+G  +  +V F      + F   Y +           PL Q  L G   G   S++
Sbjct: 106 ASPLVGAALENAVLFVTFNRAQNFLQQYESVS---------PLSQTVLSGAFAGACTSYV 156

Query: 144 AAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA---LMRGLLPTMIRAGHGLGTY 200
             P+E ++  LQ    +G   +    +  +K + + K    L +G   T IR   G   +
Sbjct: 157 LTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVW 216

Query: 201 FAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPK 260
           F  YE+L      +     +   W+L + GA +G     +++P D +KS  QT  +    
Sbjct: 217 FTTYESLK-SYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQHL---- 271

Query: 261 YKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
               I+ AT+ +  + G    ++G   T+IRAAPANA  F ++E
Sbjct: 272 ---GIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 80/208 (38%), Gaps = 30/208 (14%)

Query: 9   QLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIE--- 65
             L + E V P      + + + +G   G     V  P +  K  LQ S  +        
Sbjct: 128 NFLQQYESVSP------LSQTVLSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSK 181

Query: 66  ---VVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHV 122
               V+++++++G    ++G  +  +      +V F   ES+K + A     R D + H 
Sbjct: 182 IWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSYLAR---RRNDTENHT 238

Query: 123 PLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKK-LAKA-- 179
                +    G + GV  +    P + ++   QTQ          G  D  K+ LA++  
Sbjct: 239 ----WELLASGASAGVAFNASIFPADTIKSTAQTQ--------HLGIVDATKRILARSGP 286

Query: 180 KALMRGLLPTMIRAGHGLGTYFAAYEAL 207
             L RGL  T+IRA       F  YE L
Sbjct: 287 AGLYRGLGITLIRAAPANAIVFYTYETL 314

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score =  107 bits (268), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 82/306 (26%), Positives = 139/306 (45%), Gaps = 36/306 (11%)

Query: 26  VVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ---TSKTKIGVIEVVQNLLRNEGALAF--- 79
           V K++ +G   G    +   P D  KVRLQ   T+K   G  +VV+ ++++    +F   
Sbjct: 8   VQKEMISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHSFFRE 67

Query: 80  -YKGMLTPLLGVGICVSVQFGV------------NESMKRFFAAYNADRVDPQKHVPLPL 126
            Y+G+   LLG  +   + FG+            N  +KRF    N D+        +  
Sbjct: 68  TYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDK-------EMTS 120

Query: 127 HQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKAL---M 183
             Y L     GV  S L  PI  ++ R+ + TS  + R ++   D IKKL + + L    
Sbjct: 121 LMYLLAAAMSGVATSVLTNPIWVIKTRIMS-TSFVDSRSYRSTVDGIKKLYRIEGLAGFW 179

Query: 184 RGLLPTMIRAGHGLGTYFAAYEALVVKEF--EKGTPRNQIPAWKLCSFGALSGTILWLTV 241
           RGL+P++     G   YF  Y+ L    F  +    + ++   +  +  +LS  +    V
Sbjct: 180 RGLVPSLFGVSQG-AIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAV 238

Query: 242 YPVDVVKSVLQT---DSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAA 298
           YP+ ++KS LQ+    ++ NPK  + + K    +Y + G+   +KG +  +IRA P+   
Sbjct: 239 YPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCI 298

Query: 299 TFVSFE 304
           TF  +E
Sbjct: 299 TFCVYE 304

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  107 bits (266), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 86/289 (29%), Positives = 134/289 (46%), Gaps = 22/289 (7%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI------GVIEVVQNLLRNEGALAFYKG 82
           ++ AG   G+ + L   P DT KVR+Q  +         G +    N+   EG LAFYKG
Sbjct: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119

Query: 83  MLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSF 142
           +   ++G+   ++++F   E    F+    ADR   Q  V +     +L G+  GV  + 
Sbjct: 120 LGAVVIGIIPKMAIRFSSYE----FYRTLLADR---QTGV-VSTGNTFLAGVGAGVTEAV 171

Query: 143 LAA-PIEHVRIRLQTQTSQG--NERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGHG 196
           L   P+E V+IRLQ Q   G   +++++        + K +   AL RG+  T  R    
Sbjct: 172 LVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATN 231

Query: 197 LGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTD-S 255
            G  F  Y  L+ +  E    +N +P+W+    G +SG I   +  P+D +K+ LQ D S
Sbjct: 232 QGANFTVYSKLMERLQEYHGSQN-LPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKS 290

Query: 256 IENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
             N      I    R L ++ G  A +KG  P ++R AP  A TF  +E
Sbjct: 291 TRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 8/88 (9%)

Query: 46  PFDTTKVRLQTSKTK------IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFG 99
           P DT K RLQ  K+       + +  + + L++ EG  A YKG+   ++ V    +V F 
Sbjct: 277 PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFT 336

Query: 100 VNESMKRFFAAYNADRVDPQKHVPLPLH 127
           V E ++R             K  P PLH
Sbjct: 337 VYEFVRRHLEGLGL--FGSAKPKPKPLH 362

>Scas_632.9
          Length = 292

 Score =  105 bits (262), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 137/305 (44%), Gaps = 35/305 (11%)

Query: 15  EDVPPPTPYGRV---VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEVVQN 69
           E +  P     V   + DI  G++ G    ++  PFDT KVRLQT  + I       ++ 
Sbjct: 3   ESIDHPIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTWSCIKY 62

Query: 70  LLRNEGAL-AFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPL-PLH 127
              NEG    F++G+ +PL G  +               F +YN      +K   + PL 
Sbjct: 63  TYHNEGVWRGFFQGIGSPLFGAAL----------ENATLFVSYNQCSNVLEKFTNVSPLS 112

Query: 128 QYYLCGLTGGVVNSFLAAPIEHVRIRLQT---QTSQGNERQFKGPFDCIKKLAKAKALM- 183
              L G   G   SF+  P+E ++ +LQ    QT+   + +       +  + + K ++ 
Sbjct: 113 NILLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILG 172

Query: 184 --RGLLPTMIRAGHGLGTYFAAYEALV--VKEFEKGTPRNQIPAWKLCSFGALSGTILWL 239
             +G   T IR   G   +FA YE +   +K+  K T       W+L   GA +G     
Sbjct: 173 LWQGQSSTFIRESLGGVAWFATYEVMKQGLKDRRKDTENK---TWELLVSGASAGLAFNA 229

Query: 240 TVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAAT 299
           +++P D VKS++QT+ I       ++I A + +   +GI  F++G   T+IRA PANA  
Sbjct: 230 SIFPADTVKSMMQTEHI-------TLINAVKKVLTTYGITGFYRGLGITLIRAVPANATV 282

Query: 300 FVSFE 304
           F  +E
Sbjct: 283 FYMYE 287

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 77/211 (36%), Gaps = 30/211 (14%)

Query: 9   QLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGV----- 63
           Q  N LE     +P   +   + +G   G     V  P +  K +LQ S  +  V     
Sbjct: 97  QCSNVLEKFTNVSPLSNI---LLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIK 153

Query: 64  ----IEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQ 119
               I  +  +LR +G L  ++G  +  +   +     F   E MK+          D +
Sbjct: 154 HTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATYEVMKQGLK-------DRR 206

Query: 120 KHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA 179
           K       +  + G + G+  +    P + V+  +QT+             + +KK+   
Sbjct: 207 KDTENKTWELLVSGASAGLAFNASIFPADTVKSMMQTEHIT--------LINAVKKVLTT 258

Query: 180 KALM---RGLLPTMIRAGHGLGTYFAAYEAL 207
             +    RGL  T+IRA     T F  YE L
Sbjct: 259 YGITGFYRGLGITLIRAVPANATVFYMYETL 289

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score =  104 bits (259), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 85/292 (29%), Positives = 134/292 (45%), Gaps = 26/292 (8%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI-------GVIEVVQNLLRNEGALAFYK 81
           ++ AG   G+ + L   P DT KVR+Q  +          G I+  +N+   EG LA YK
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALYK 72

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G+   ++G+   ++++F   E    F+ +  AD+    +   +     +L G+  G   +
Sbjct: 73  GLGAVVIGIIPKMAIRFSSYE----FYRSALADK----QTGSVSTGNTFLAGVGAGTTEA 124

Query: 142 FLAA-PIEHVRIRLQTQ----TSQGNERQFKGPFDC--IKKLAKAKALMRGLLPTMIRAG 194
            L   P+E V+IRLQ Q     +  + R       C  I K     AL RG+  T  R  
Sbjct: 125 VLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQA 184

Query: 195 HGLGTYFAAYEALVVKEF-EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQT 253
              G  F  Y  L  KEF ++    + +P+W+    G +SG I   +  P+D +K+ LQ 
Sbjct: 185 TNQGANFTVYSKL--KEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQK 242

Query: 254 D-SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           D S  N    + I+   + L K+ G  A +KG  P ++R AP  A TF  +E
Sbjct: 243 DKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 294

>Scas_640.25
          Length = 306

 Score =  103 bits (257), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 89/314 (28%), Positives = 142/314 (45%), Gaps = 47/314 (14%)

Query: 12  NELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ----------TSKTKI 61
           N     P P  Y        AG + G+++++V  P D  K R+Q          ++    
Sbjct: 4   NHNTQAPLPFRY-----QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYK 58

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVN-ESMKRFFAAYNADRVDPQK 120
           GVI+ +  +++ EG +  YKG+ +P+L      +V+F  N E +K + + +   ++  Q 
Sbjct: 59  GVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI 118

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA- 179
            V        L G + G+  + +  P E V+IRLQ   S+     FKGP + +K + K  
Sbjct: 119 SV--------LSGASAGITEALVIVPFELVKIRLQDVNSK-----FKGPVEVLKHIIKQD 165

Query: 180 --KALMRGLLPTMIR-----AGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGAL 232
             K L  G+  T+ R     AG+  G  F   E L V + ++   RN      LC+ G +
Sbjct: 166 GLKGLYSGVESTVWRNAVWNAGY-FGVIFQVRELLPVAKSKQEKTRND-----LCA-GFV 218

Query: 233 SGTILWLTVYPVDVVKSVLQTDS---IENPKYKNSIIKATRALYKQHGIPAFFKGFVPTM 289
            GT   +   P DVVKS +Q+D    I   +  N    +   +Y + G  A +KGFVP +
Sbjct: 219 GGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKV 278

Query: 290 IRAAPANAATFVSF 303
           +R  P  A   V F
Sbjct: 279 LRLGPGGAVLLVVF 292

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 88/199 (44%), Gaps = 24/199 (12%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI-GVIEVVQNLLRNEGALAFYKGMLTPL 87
            + +G   G+ + LV  PF+  K+RLQ   +K  G +EV++++++ +G    Y G+ + +
Sbjct: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTV 178

Query: 88  LGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLC-GLTGGVVNSFLAAP 146
               +  +  FGV   ++       + +   +           LC G  GG        P
Sbjct: 179 WRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRND---------LCAGFVGGTFGVMFNTP 229

Query: 147 IEHVRIRLQTQTSQGNE-----RQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHGLG 198
            + V+ R+Q   S GNE     R++   +  + K+      +AL +G +P ++R G G  
Sbjct: 230 FDVVKSRIQ---SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGA 286

Query: 199 TYFAAYEAL--VVKEFEKG 215
                +  +  V +EF +G
Sbjct: 287 VLLVVFTNVMNVFREFHEG 305

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEV------VQNLLRNEGALAFY 80
           D+ AG +GG   V+   PFD  K R+Q+   +I  GV +       V  +   EG  A Y
Sbjct: 212 DLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALY 271

Query: 81  KGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADR 115
           KG +  +L +G   +V   V  ++   F  ++  R
Sbjct: 272 KGFVPKVLRLGPGGAVLLVVFTNVMNVFREFHEGR 306

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score =  104 bits (260), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 83/288 (28%), Positives = 132/288 (45%), Gaps = 28/288 (9%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTS--KTKI------GVIEVVQNLLRNEGALAFYKG 82
           FAG + GVA      P D  K RLQ    +T+       G++  +  ++R+EG    YKG
Sbjct: 86  FAGFLSGVAVC----PLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 83  MLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSF 142
           ++  +LG      + F V E  K+FF       + PQ              +T G  ++ 
Sbjct: 142 LVPIVLGYFPTWMIYFSVYEFSKKFFHG-----IFPQ----FDFVAQSCAAITAGAASTT 192

Query: 143 LAAPIEHVRIRLQTQTSQGNE-RQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHGLG 198
           L  PI  V+ RL  Q++ G     +KG FD  +KL      KAL  GL+P+++   H + 
Sbjct: 193 LTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFH-VA 251

Query: 199 TYFAAYEALVVK--EFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSI 256
            +F  YE L V+   + +    N I   +L    ++S  I     YP +++++ +Q  S 
Sbjct: 252 IHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSD 311

Query: 257 ENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
                +  +    +A Y Q G+  F+ GF   ++R  PA+A T VSFE
Sbjct: 312 IPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSI----ENPKYKNSIIKATRALYKQHGIPAFFKGF 285
           GA +G +  + V P+DV K+ LQ   +    ENP Y+  I+     + +  G    +KG 
Sbjct: 84  GAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRG-IMGTLSTIVRDEGPRGLYKGL 142

Query: 286 VPTMIRAAPANAATFVSFEMT 306
           VP ++   P     F  +E +
Sbjct: 143 VPIVLGYFPTWMIYFSVYEFS 163

>Kwal_26.8669
          Length = 296

 Score =  101 bits (251), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 133/288 (46%), Gaps = 35/288 (12%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKTK------IGVIEVVQNLLRNEGALAFYKGMLT 85
           AG + G++++LV  P D  K R+Q   +        GV++ ++ ++  EGA   YKG+ +
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74

Query: 86  PLLGVGICVSVQFGVNESMKRFFA-AYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA 144
           P+L      + +F  N+  ++ +   +  +++     +        L G + G   +F+ 
Sbjct: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSI--------LSGASAGCCEAFVV 126

Query: 145 APIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGHGLGTYF 201
            P E V+IRLQ  +S      +KGP D ++K+   +   A+  GL  T+ R G     YF
Sbjct: 127 VPFELVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181

Query: 202 A---AYEALVVKEFEKGT-PRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSI- 256
                  AL+ +   K    RN + A      G++ GTI  L   P DVVKS +Q  ++ 
Sbjct: 182 GIIFQVRALLPEAKSKSQQTRNDLIA------GSIGGTIGSLMSTPFDVVKSRIQNTAVV 235

Query: 257 -ENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303
               +  N    +   +YK+ G  A +KGFVP ++R  P      V F
Sbjct: 236 AGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 82/181 (45%), Gaps = 13/181 (7%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQ-TSKTKIGVIEVVQNLLRNEGALAFYKGMLTPL 87
            I +G   G  +  V  PF+  K+RLQ  S +  G I+VV+ ++  EG LA Y G+ + L
Sbjct: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170

Query: 88  LGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPI 147
              G+  +  FG+   ++       +     +  +        + G  GG + S ++ P 
Sbjct: 171 WRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDL--------IAGSIGGTIGSLMSTPF 222

Query: 148 EHVRIRLQ-TQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHGLGTYFAA 203
           + V+ R+Q T    G  R++   +  I  + K    +AL +G +P ++R G G G     
Sbjct: 223 DVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVV 282

Query: 204 Y 204
           +
Sbjct: 283 F 283

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 80/186 (43%), Gaps = 18/186 (9%)

Query: 123 PLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK---A 179
           PLP    +  G   G+    +  P++ V+ R+Q Q S G   Q+KG  DCIK++     A
Sbjct: 6   PLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGA 65

Query: 180 KALMRGLLPTMIRAGHGLGTYFAA---YEALVVKEF--EKGTPRNQIPAWKLCSFGALSG 234
             L +G+   ++       T FA    ++ +  +EF  EK T    I +      GA +G
Sbjct: 66  SRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILS------GASAG 119

Query: 235 TILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
                 V P ++VK  LQ  S     YK   I   R +  Q G+ A + G   T+ R   
Sbjct: 120 CCEAFVVVPFELVKIRLQDVS---SSYKGP-IDVVRKIIAQEGVLAMYNGLESTLWRHGV 175

Query: 295 ANAATF 300
            NA  F
Sbjct: 176 WNAGYF 181

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 99.8 bits (247), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 84/291 (28%), Positives = 132/291 (45%), Gaps = 32/291 (10%)

Query: 25  RVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEVVQNLLRNEGAL-AFYK 81
           +  KD+  G + G    LV  PFDT KVRLQT    +       V +  + EG    FY+
Sbjct: 7   KAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTTWSCVSHTYKQEGLWRGFYQ 66

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYN-ADRVDPQKHVPLPLHQYYLCGLTGGVVN 140
           GM +P+          FG        F ++N A  V    +   PL +    G   G   
Sbjct: 67  GMASPV----------FGAFLEHAVLFVSFNRAQAVLENCYSCGPLEKVVFAGAIAGACT 116

Query: 141 SFLAAPIEHVRIRLQTQTSQG-NERQFKGPFDCIKKLAKAKAL---MRGLLPTMIRAGHG 196
           S++  P+E V+ +LQ     G +  ++      ++ + K   L    +G   T IR   G
Sbjct: 117 SYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAG 176

Query: 197 LGTYFAAYEALVVKEF---EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQT 253
              +F AYE  V+K +    +G+  N +  W+L + GA +G     +++P D VKS +QT
Sbjct: 177 GAVWFTAYE--VLKGWLARRRGSTENTV--WELLASGAGAGAAFHASIFPADTVKSTMQT 232

Query: 254 DSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           + +        +  A R + K+HG   F++G   T++RA PANA  F  +E
Sbjct: 233 EHL-------GLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 83/185 (44%), Gaps = 24/185 (12%)

Query: 134 LTGGVVNSF---LAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTM 190
           L GGV  S    +  P + V++RLQTQ++      F   + C+    K + L RG    M
Sbjct: 13  LYGGVAGSLGKLVEYPFDTVKVRLQTQSAA----LFPTTWSCVSHTYKQEGLWRGFYQGM 68

Query: 191 IRAGHG-------LGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYP 243
                G       L   F   +A++   +  G      P  K+   GA++G      + P
Sbjct: 69  ASPVFGAFLEHAVLFVSFNRAQAVLENCYSCG------PLEKVVFAGAIAGACTSYVLTP 122

Query: 244 VDVVKSVLQTDS---IENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
           V++VK  LQ  +   +  P+Y  +++   RA+ KQ+G+   ++G   T IR +   A  F
Sbjct: 123 VELVKCKLQVSNLTGVSGPRY-TAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWF 181

Query: 301 VSFEM 305
            ++E+
Sbjct: 182 TAYEV 186

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 46  PFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESM 104
           P DT K  +QT    +G    V+ +L+  G   FY+G+   LL      +V F V ES+
Sbjct: 222 PADTVKSTMQTEHLGLG--PAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYESL 278

>Scas_714.18
          Length = 305

 Score =  100 bits (248), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 144/311 (46%), Gaps = 49/311 (15%)

Query: 23  YGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEVVQNLLRNEGAL-AF 79
           +G  +++I AG++ G     +  PFDT KVRLQT +  +       ++    NEG L  F
Sbjct: 9   FGAALREILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTWSCIKYTYENEGILEGF 68

Query: 80  YKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVV 139
           Y+G+ +PL+G  +  ++ F        F  A+     +    + + +   +      G  
Sbjct: 69  YQGIESPLIGAALENAILFLAYNQCSSFLNAFT----EFSAFLIILISAGF-----AGSC 119

Query: 140 NSFLAAPIEHVRIRLQTQTSQ----------------------GNERQFKGPFDCIKKLA 177
            SF+  P+E ++ +LQ                           G  R  +     IK + 
Sbjct: 120 ASFVLTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTR-IIPTIKSII 178

Query: 178 KAKALM---RGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQI-PAWKLCSFGALS 233
           K K L    +G   T IR   G   +FA YE  ++K+  +  P++++   W+L   GA +
Sbjct: 179 KEKGLFGLWQGQSSTFIRESIGSVVWFATYE--LMKQTLR-DPKSEVNTTWQLLISGATA 235

Query: 234 GTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAA 293
           G     +V+P D VKS++QT+ +       ++++  R++ ++ G+  F++G   T++RA 
Sbjct: 236 GLAFNGSVFPADTVKSIMQTEHL-------ALMETVRSILERDGVAGFYRGLGITLLRAV 288

Query: 294 PANAATFVSFE 304
           P+NAA F ++E
Sbjct: 289 PSNAAVFYTYE 299

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score =  100 bits (248), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 82/291 (28%), Positives = 131/291 (45%), Gaps = 25/291 (8%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIG-------VIEVVQNLLRNEGALAFYK 81
           ++ AG   G+ + L   P DT KVR+Q  K  +G        I+    + RNEG LAFYK
Sbjct: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G+   ++G+   ++++F   E  +   A     +V             ++ G+  G+  +
Sbjct: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVST--------GNTFIAGVGAGITEA 124

Query: 142 FLAAPIEHV-RIRLQTQTSQGNER--QFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGH 195
            +      V +IRLQ Q     E   ++K        + K +   AL RG+  T  R   
Sbjct: 125 VVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184

Query: 196 GLGTYFAAYEALVVKEFEKGTPRNQ-IPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTD 254
             G  F  Y  L  KEF +G    + +P+W+    G +SG I   +  P+D +K+ LQ D
Sbjct: 185 NQGANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKD 242

Query: 255 -SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
            S +N      I    + L ++ G  A +KG  P ++R AP  A TF ++E
Sbjct: 243 KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 10/69 (14%)

Query: 46  PFDTTKVRLQTSKT--------KIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQ 97
           P DT K RLQ  K+        +I +I   + L++ EG  A YKG+   ++ V    +V 
Sbjct: 231 PLDTIKTRLQKDKSTKNMSGLKRITIIG--KQLIQEEGFRALYKGITPRVMRVAPGQAVT 288

Query: 98  FGVNESMKR 106
           F   E +++
Sbjct: 289 FTAYEFIRK 297

>Scas_691.4
          Length = 334

 Score =  100 bits (248), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 87/305 (28%), Positives = 138/305 (45%), Gaps = 40/305 (13%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGV-----IEVVQNLLRNEGALAFYKGM 83
           ++ AG   G+ + L   P DT KVR+Q +K   G+     I   +N+  +EG LA YKG+
Sbjct: 16  NLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKGL 75

Query: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFL 143
              ++G+   ++++F   E        +  + +  ++   +     +L G+  G+  + L
Sbjct: 76  GAVVIGIIPKMAIRFSSYE--------FYRNALTDKETRTITTGNTFLAGVGAGITEAVL 127

Query: 144 AA-PIEHVRIRLQTQ------------TSQGNERQFKGP--------FDCIKKLAKAKAL 182
              P+E V+IRLQ Q            ++ G       P           I K   A AL
Sbjct: 128 VVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGAL 187

Query: 183 MRGLLPTMIRAGHGLGTYFAAYEALVVKEF-EKGTPRNQIPAWKLCSFGALSGTILWLTV 241
            RG+  T  R     G  F  Y  L  K++ +K   R  +P+W+    G +SG I   + 
Sbjct: 188 YRGVSLTAARQATNQGANFTVYSYL--KDYLQKYHNRESLPSWETSCIGLISGAIGPFSN 245

Query: 242 YPVDVVKSVLQTD-SIE-NPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAAT 299
            P+D +K+ LQ D SI  N  +K   I  T+ L K+ G  A +KG  P ++R AP  A T
Sbjct: 246 APLDTIKTRLQKDKSISSNSAWKKIYIIGTQ-LIKEEGFRALYKGITPRVMRVAPGQAVT 304

Query: 300 FVSFE 304
           F  +E
Sbjct: 305 FTVYE 309

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 10/88 (11%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSKT--------KIGVIEVVQNLLRNEGALAFYKGML 84
           G + G        P DT K RLQ  K+        KI +I     L++ EG  A YKG+ 
Sbjct: 234 GLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGT--QLIKEEGFRALYKGIT 291

Query: 85  TPLLGVGICVSVQFGVNESMKRFFAAYN 112
             ++ V    +V F V E +++     N
Sbjct: 292 PRVMRVAPGQAVTFTVYEFVRKHLETLN 319

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 99.8 bits (247), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 130/296 (43%), Gaps = 30/296 (10%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGV--------IEVVQNLLRNEGALAFY 80
           ++ AG   G+ + L   P DT KVR+Q  +   G+        I+  + + + EG LA Y
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALY 72

Query: 81  KGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVN 140
           KG+   ++G+   ++++F   E  +       +  V             ++ G+  G+  
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTG--------NTFVAGVGAGITE 124

Query: 141 SFLAA-PIEHVRIRLQTQTSQGNERQFKGPFD-------CIKKLAKAKALMRGLLPTMIR 192
           + L   P+E V+IRLQ Q    +E      ++        I K     AL RG+  T  R
Sbjct: 125 AVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAAR 184

Query: 193 AGHGLGTYFAAYEALVVKEFEKGTPR-NQIPAWKLCSFGALSGTILWLTVYPVDVVKSVL 251
                G  F  Y  L  KEF +   + + +P+W+    G +SG I   +  P+D +K+ L
Sbjct: 185 QATNQGANFTVYSKL--KEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRL 242

Query: 252 QTD---SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           Q D   S+E       II     L K+ G  A +KG  P ++R AP  A TF  +E
Sbjct: 243 QKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 298

 Score = 32.3 bits (72), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 35/84 (41%), Gaps = 8/84 (9%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSKT--------KIGVIEVVQNLLRNEGALAFYKGML 84
           G + G        P DT K RLQ  K+           +I +   LL+ EG  A YKG+ 
Sbjct: 221 GLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGIT 280

Query: 85  TPLLGVGICVSVQFGVNESMKRFF 108
             ++ V    +V F V E ++   
Sbjct: 281 PRVMRVAPGQAVTFTVYEYVREHL 304

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 99.4 bits (246), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 134/291 (46%), Gaps = 39/291 (13%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQ------TSKTKIGVIEVVQNLLRNEGALAFYKGML 84
           FAG + GV+++LV  P D  K R+Q            GV++ ++ ++  EG    YKG+ 
Sbjct: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGIS 75

Query: 85  TPLLGVGICVSVQFGVNESMKRFFA-AYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFL 143
           +P+L      + +F  N+  ++ +  A+  +++      PL +    L G + G V +F+
Sbjct: 76  SPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQ----PLSM----LAGASAGCVEAFV 127

Query: 144 AAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRA----GHG 196
             P E V+IRLQ  +S      +KGP D ++K+   +   A+  GL  T+ R     G  
Sbjct: 128 VVPFELVKIRLQDASSS-----YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGY 182

Query: 197 LGTYFAAYEALVVKEFEKGTPRNQIPAWKL-CSFGALSGTILWLTVYPVDVVKSVLQTDS 255
            G  F A   L     +     N + +  + CS G +  T       P DVVKS +Q  +
Sbjct: 183 FGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------PFDVVKSRIQNTA 235

Query: 256 I---ENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303
           +      KY N  + +   +Y++ G  A +KGFVP ++R  P      V F
Sbjct: 236 VIPGVVRKY-NWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 75/186 (40%), Gaps = 20/186 (10%)

Query: 124 LPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA-- 181
           LP    +  G   GV    +  P++ V+ R+Q Q   G    + G  DC+KK+   +   
Sbjct: 9   LPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVG 68

Query: 182 -LMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEK------GTPRNQIPAWKLCSFGALSG 234
            L +G+   ++       T FA  +     EF+K      G  +   P   L   GA +G
Sbjct: 69  RLYKGISSPILMEAPKRATKFACND-----EFQKLYKQAFGVEKLSQPLSMLA--GASAG 121

Query: 235 TILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
            +    V P ++VK  LQ  S     YK   +   R +  + G+ A + G   T+ R A 
Sbjct: 122 CVEAFVVVPFELVKIRLQDAS---SSYKGP-VDVVRKIVAREGVLAMYNGLESTLWRHAL 177

Query: 295 ANAATF 300
            N   F
Sbjct: 178 WNGGYF 183

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 80/186 (43%), Gaps = 15/186 (8%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQ-TSKTKIGVIEVVQNLLRNEGALAFYKGMLTPL 87
            + AG   G  +  V  PF+  K+RLQ  S +  G ++VV+ ++  EG LA Y G+ + L
Sbjct: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172

Query: 88  LGVGICVSVQFGVNESMKRFF-AAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAP 146
               +     FG+    +    AA+N  +      +   +         G  +   L+ P
Sbjct: 173 WRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSI---------GCSIGCMLSTP 223

Query: 147 IEHVRIRLQ-TQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHGLGTYFA 202
            + V+ R+Q T    G  R++      +  + +    +AL +G +P ++R G G G    
Sbjct: 224 FDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLV 283

Query: 203 AYEALV 208
            +  ++
Sbjct: 284 VFTGVL 289

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 7/73 (9%)

Query: 26  VVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIE-------VVQNLLRNEGALA 78
           +  D+ + ++G     ++  PFD  K R+Q +    GV+         +  + R EG  A
Sbjct: 203 ITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRA 262

Query: 79  FYKGMLTPLLGVG 91
            YKG +  +L +G
Sbjct: 263 LYKGFVPKVLRLG 275

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 99.4 bits (246), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 78/307 (25%), Positives = 139/307 (45%), Gaps = 45/307 (14%)

Query: 20  PTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK-------------IGVIEV 66
           P P+   +    +G + G++++ V  P D  K R Q   T               GVI+ 
Sbjct: 9   PLPF---IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDC 65

Query: 67  VQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAA-YNADRVDPQKHVPLP 125
           ++ +++ EG    Y+G+ +P+L      + +F  N+  ++ F   +N +    +  +   
Sbjct: 66  LKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIA-- 123

Query: 126 LHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALM-- 183
                  G + G+  + +  P E ++IR+Q   S      + GP DC+KK  K + +M  
Sbjct: 124 ------AGASAGMTEAAVIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIMGL 172

Query: 184 -RGLLPTMIRAGHGLGTYFAAY----EALVVKEFEKGTPRNQIPAWKLCSFGALSGTILW 238
            +G+  TM R     G YF        ++ V + +    RN + A      GA+ GT+  
Sbjct: 173 YKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIA------GAIGGTVGT 226

Query: 239 LTVYPVDVVKSVLQT-DSIENP-KYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPAN 296
           +   P DVVKS +Q+ D++ +  K  N  + +   +Y++ G  A +KGFVP + R AP  
Sbjct: 227 MLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGG 286

Query: 297 AATFVSF 303
           +   V F
Sbjct: 287 SLMLVVF 293

 Score = 35.0 bits (79), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 36/87 (41%), Gaps = 7/87 (8%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLL-------RNEGALAFYK 81
           D+ AG +GG    ++  PFD  K R+Q+       ++     L       R EG  A YK
Sbjct: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFF 108
           G +  +  +    S+   V   M  FF
Sbjct: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFF 300

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 99.0 bits (245), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 84/296 (28%), Positives = 132/296 (44%), Gaps = 42/296 (14%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKTK----------------IGVIEVVQNLLRNEG 75
           AG + GV+++LV  P D  K R+Q   T                  GV++ +  +++ EG
Sbjct: 17  AGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEG 76

Query: 76  ALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLT 135
               YKG+ +P+L      +++F  N++ + F+      ++ P  +  +        G +
Sbjct: 77  FSHLYKGITSPILMEAPKRAIKFSGNDTFQTFY-----KKIFPTPNGEMTQKIAIYSGAS 131

Query: 136 GGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKL---AKAKALMRGLLPTMIR 192
            G V +F+ AP E V+IRLQ   SQ     FK P + +K         +L  GL  T+ R
Sbjct: 132 AGAVEAFVVAPFELVKIRLQDVNSQ-----FKTPIEVVKNSVVKGGVLSLFNGLEATIWR 186

Query: 193 -----AGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVV 247
                AG+  G  F   + L   +      RN + A      GA+ GT+  L   P DVV
Sbjct: 187 HVLWNAGY-FGIIFQIRKLLPAAKTSTEKTRNDLIA------GAIGGTVGCLLNTPFDVV 239

Query: 248 KSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303
           KS +Q  S    KY N  + +   +Y++ G  A +KGF P ++R AP      V F
Sbjct: 240 KSRIQRSSGPLRKY-NWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVF 294

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 98.6 bits (244), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 86/300 (28%), Positives = 135/300 (45%), Gaps = 38/300 (12%)

Query: 20  PTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ------TSKTKIGVIEVVQNLLRN 73
           P P+   V    AG + GV+++LV  P D  K  +Q      +     GV + ++ +   
Sbjct: 6   PLPF---VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62

Query: 74  EGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAA-YNADRVDPQKHVPLPLHQYYLC 132
           EG    YKG+ +P+L      + +F  N+  ++ +   + A+++      PL +    L 
Sbjct: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ----PLSI----LS 114

Query: 133 GLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPT 189
           G + G+  SF+  P E V+IRLQ  +S+     F  P   +K + + +   A+  GL  T
Sbjct: 115 GASAGICESFVVVPFELVKIRLQDVSSK-----FTSPIAVVKNIVEKEGILAMYNGLEST 169

Query: 190 MIRAGHGLGTYFA---AYEALVVKEFEKGT-PRNQIPAWKLCSFGALSGTILWLTVYPVD 245
           M R G     YF       AL+ K   K    RN + A      G + GT+  L   P D
Sbjct: 170 MWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLA------GTVGGTLSSLLSTPFD 223

Query: 246 VVKSVLQTDSI--ENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303
           VVKS +Q  ++    P+  N    A   +YK+ G  A +KGFVP ++R  P      V F
Sbjct: 224 VVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 96.7 bits (239), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 134/301 (44%), Gaps = 43/301 (14%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEVVQNLLRNEGAL-AFYKGML 84
           +DI  G++ G    ++  PFDT KVRLQT    +       +    +NEG +  F++G+ 
Sbjct: 15  RDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGIIKGFFQGIA 74

Query: 85  TPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA 144
           +PL G  I  +  F       +F   Y              L    + G   G   SF+ 
Sbjct: 75  SPLAGAAIENAALFLSYNQCSKFLQHYTNVS---------DLTNILISGAFAGSCASFVL 125

Query: 145 APIEHVRIRLQTQTSQ--------GN---ERQFKGPFDCIKKLAKAKA---LMRGLLPTM 190
            P+E ++ +LQ    Q        GN   ER  +     I+ + K +    L +G   T 
Sbjct: 126 TPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTR-IIPTIQAVIKNRGFIGLWQGQSGTF 184

Query: 191 IRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPA-------WKLCSFGALSGTILWLTVYP 243
           IR   G   +FA YE  ++K++ K     + P+       W+L + GA +G     +++P
Sbjct: 185 IRESFGGVAWFATYE--LMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFP 242

Query: 244 VDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303
            D VKS++QT+ +        +  A + ++ + G+  F++G   T+IRA PANA  F  +
Sbjct: 243 ADTVKSMMQTEHL-------GLKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVY 295

Query: 304 E 304
           E
Sbjct: 296 E 296

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 75/198 (37%), Gaps = 30/198 (15%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK---IGV-------------IEVVQNLLRN 73
           + +G   G     V  P +  K +LQ S  +   +GV             I  +Q +++N
Sbjct: 111 LISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKN 170

Query: 74  EGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAA-YNADRVDPQKHVPLPLHQYYLC 132
            G +  ++G     +         F   E MK++  + +N +  DP         +    
Sbjct: 171 RGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKSRHNIE--DPSLPNDNKTWELLAS 228

Query: 133 GLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKAL---MRGLLPT 189
           G + G+  +    P + V+  +QT+          G    IKK+   K L    RGL  T
Sbjct: 229 GASAGLAFNASIFPADTVKSMMQTE--------HLGLKTAIKKIFVEKGLRGFYRGLGIT 280

Query: 190 MIRAGHGLGTYFAAYEAL 207
           +IRA     T F  YE L
Sbjct: 281 LIRAIPANATVFYVYETL 298

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 97.4 bits (241), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 133/290 (45%), Gaps = 28/290 (9%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------GVIEVVQNLLRNEGALAFYKG 82
           +G + G+   +V  P D  K RLQ    +          G I  +  ++R+EG    YKG
Sbjct: 74  SGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKG 133

Query: 83  MLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSF 142
           ++  ++G      + F V E  K      +++              +    +T G V++ 
Sbjct: 134 LVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSN---------WSFVSHSFSAITAGAVSTV 184

Query: 143 LAAPIEHVRIRLQTQTSQG-NERQFKGPFDCIKKLAK---AKALMRGLLPTMIRAGHGLG 198
           +  PI  V+ RL  QT  G N   ++G +D  KK+      KAL  GL+P+++   H + 
Sbjct: 185 VTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGLLH-VA 243

Query: 199 TYFAAYEALVVK----EFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTD 254
            +F  YE L V     + ++ +  ++I   +L    ++S  +  +  YP +++++ LQ  
Sbjct: 244 IHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLK 303

Query: 255 SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           S + P ++  +I   +  Y Q GI  F+ GF   + R  PA+A T VSFE
Sbjct: 304 S-DLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFE 352

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 75/171 (43%), Gaps = 17/171 (9%)

Query: 131 LCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQ---FKGPFDCIKKLAK---AKALMR 184
           + G   G+++  +  P++  + RLQ Q  Q    +   ++G    +  + +    + L +
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 185 GLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLC--SFGALS-GTILWLTV 241
           GL+P ++        YF+ Y      EF K   R     W     SF A++ G +  +  
Sbjct: 133 GLVPIIMGYFPTWMIYFSVY------EFCKDNLRTNSSNWSFVSHSFSAITAGAVSTVVT 186

Query: 242 YPVDVVKS--VLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMI 290
            P+ VVK+  +LQT    N  +      A + +  Q G+ A + G VP+++
Sbjct: 187 NPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLL 237

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 96.7 bits (239), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 121/282 (42%), Gaps = 19/282 (6%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSKTKI---GVIEVVQNLLRNEGALAFYKGMLTPLLG 89
           G++ G     V  P D  K R+Q  +  +     I+ V  + + +G    Y G+   L+G
Sbjct: 511 GSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGLGPQLIG 570

Query: 90  VGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEH 149
           V    +++  VN+ M+++F           K   +  +Q  L G T G        P+E 
Sbjct: 571 VAPEKAIKLTVNDFMRQYFM---------NKSRTIKWYQEILSGATAGACQVVFTNPLEI 621

Query: 150 VRIRLQTQTSQ--GNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEAL 207
           V+IRLQ ++     N R   G    I++L   + L +G    ++R       YF  Y  L
Sbjct: 622 VKIRLQMRSDYVGENARPQLGAVGIIRQLG-LRGLYKGAAACLLRDVPFSAIYFPTYAHL 680

Query: 208 VVKEFE----KGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKN 263
               F         RN++  W+L   G ++G        P DV+K+ LQ D  +      
Sbjct: 681 KKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYT 740

Query: 264 SIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
            +I A R + K+  I +FFKG    ++R++P    T  +FEM
Sbjct: 741 GVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEM 782

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 84/187 (44%), Gaps = 23/187 (12%)

Query: 126 LHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---AL 182
           +H + L G   G + + +  PI+ V+ R+Q   +Q N  Q+K   DC+ K+ + K    L
Sbjct: 505 IHNFTL-GSIAGCIGATVVYPIDLVKTRMQ---AQRNSVQYKNSIDCVVKIFQTKGIRGL 560

Query: 183 MRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQ---IPAWKLCSFGALSGTILWL 239
             GL P +I    G+    A    L V +F +    N+   I  ++    GA +G    +
Sbjct: 561 YSGLGPQLI----GVAPEKAI--KLTVNDFMRQYFMNKSRTIKWYQEILSGATAGACQVV 614

Query: 240 TVYPVDVVKSVLQTDSI---ENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPAN 296
              P+++VK  LQ  S    EN + +   +   R L    G+   +KG    ++R  P +
Sbjct: 615 FTNPLEIVKIRLQMRSDYVGENARPQLGAVGIIRQL----GLRGLYKGAAACLLRDVPFS 670

Query: 297 AATFVSF 303
           A  F ++
Sbjct: 671 AIYFPTY 677

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQTS-----KTKIGVIEVVQNLLRNEGALAFYKG 82
           + AG + G+    +  PFD  K RLQ        T  GVI   + +L+ E   +F+KG
Sbjct: 704 LLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKG 761

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 92.4 bits (228), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 134/302 (44%), Gaps = 30/302 (9%)

Query: 13  ELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---GVIEVVQN 69
           + E +PP  P   +   + AG   G+ +  V  P D  K R+Q+S +     G+I+ +  
Sbjct: 6   DYEALPPCAP---LHHQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISK 62

Query: 70  LLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK-HVPLPLHQ 128
           +   EG+LA +KG+ + +LG G   +V F   E  K       +  +DPQ  H   P+ +
Sbjct: 63  ITTAEGSLALWKGVQSVILGAGPAHAVYFATYEFSK-------SKLIDPQDMHTHQPI-K 114

Query: 129 YYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLP 188
             + G+    V   L  P + ++ R+Q  T +      K  +       +  A      P
Sbjct: 115 TAISGMAATTVADALMNPFDVIKQRMQLNTRESVWHVTKNIYH-----KEGFAAFYYSYP 169

Query: 189 TMIRAGHGLGTYFAAYEALVVKEFEK-GTPRNQIPAWKLCSFGALSGTILWLTVYPVDVV 247
           T +     +   FAA+   + +   K   P N+   +  C  G LSG        P+D +
Sbjct: 170 TTLV----MNIPFAAFNFAIYESATKFMNPSNEYNPFIHCISGGLSGATCAAITTPLDCI 225

Query: 248 KSVLQ---TDSIENP--KYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVS 302
           K+VLQ   ++++ N   K  N+  +A  A+YK HG   F +G  P +I   PA A ++ S
Sbjct: 226 KTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTS 285

Query: 303 FE 304
           +E
Sbjct: 286 YE 287

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 2/77 (2%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTM 289
           GA +G +    ++PVD +K+ +Q+ S  +      +IK    +    G  A +KG    +
Sbjct: 23  GAFAGIMEHSVLFPVDAIKTRIQSSS--SGAATQGLIKQISKITTAEGSLALWKGVQSVI 80

Query: 290 IRAAPANAATFVSFEMT 306
           + A PA+A  F ++E +
Sbjct: 81  LGAGPAHAVYFATYEFS 97

>Scas_662.12
          Length = 308

 Score = 92.0 bits (227), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 130/310 (41%), Gaps = 45/310 (14%)

Query: 26  VVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ------TSKTKIGVIEVVQNLLRNEGALAF 79
           + K+I +G   G    L+  P D  KVRLQ      T + + G   ++  L+ N   +  
Sbjct: 7   IQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGS 66

Query: 80  -----------YKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQ 128
                      Y+G+   LLG  +  S+ F +  S K +    N             LH 
Sbjct: 67  QGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNY------------LHN 114

Query: 129 -----YYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---K 180
                +   GL  G+  + L  P+  ++ R+ + TS+ ++  +K      K L      K
Sbjct: 115 NNTTIFLTSGLISGISTTLLTNPLWVIKTRIMS-TSRHHKDSYKSIRHGFKSLLTKEGPK 173

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVK---EFEKGTPRNQIPAWKLCSFGALSGTIL 237
           A+  GLLP+++    G   YF  Y+ L +       K    N     K+    +LS  + 
Sbjct: 174 AIWMGLLPSLLGVSQG-AIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLS 232

Query: 238 WLTVYPVDVVKSVLQT-DSIEN--PKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
            ++VYP  ++KS LQT  S+ N  P+     I   R +Y+ +GI   +KG    ++RA P
Sbjct: 233 VMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIP 292

Query: 295 ANAATFVSFE 304
           +   TF  +E
Sbjct: 293 STCITFCIYE 302

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 74/184 (40%), Gaps = 15/184 (8%)

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180
           H   P+ +  + GL+ G + + +  P++ +++RLQ   +   ++  KG    I +L    
Sbjct: 2   HELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNS 61

Query: 181 ALM--------------RGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKL 226
             M              RGL   ++        YF  Y +     F+     N      L
Sbjct: 62  KKMGSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIFL 121

Query: 227 CSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFV 286
            S G +SG    L   P+ V+K+ + + S  +     SI    ++L  + G  A + G +
Sbjct: 122 TS-GLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLL 180

Query: 287 PTMI 290
           P+++
Sbjct: 181 PSLL 184

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 91.3 bits (225), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 137/309 (44%), Gaps = 26/309 (8%)

Query: 6   PTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---- 61
           P P +  +L D      +  +   + AG   G+ +  V  P D  K R+Q++  K     
Sbjct: 13  PIPAIPMDLPDYEALPTHAPLYHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAK 72

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
            ++  + ++  +EG LA +KG+ + +LG G   +V FG  E  K+       D  D Q H
Sbjct: 73  NMLSQISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKKNLI----DSSDTQTH 128

Query: 122 VPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA 181
            P    +  + G      +  L  P + ++ R+Q  TS    +  K  +      ++  A
Sbjct: 129 HPF---KTAISGACATTASDALMNPFDTIKQRIQLNTSASVWQTTKQIYQ-----SEGLA 180

Query: 182 LMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKG-TPRNQIPAWKLCSFGALSGTILWLT 240
                 PT +     +   FAA+  ++ +   K   P N+      C  G++SG+     
Sbjct: 181 AFYYSYPTTLV----MNIPFAAFNFVIYESSTKFLNPSNEYNPLIHCLCGSISGSTCAAI 236

Query: 241 VYPVDVVKSVLQ-----TDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPA 295
             P+D +K+VLQ     T S+E  +  ++  KA  A+Y+ +G   F++G+ P ++   PA
Sbjct: 237 TTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPA 296

Query: 296 NAATFVSFE 304
            A ++ ++E
Sbjct: 297 TAISWTAYE 305

>Scas_379.2
          Length = 301

 Score = 90.9 bits (224), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 132/302 (43%), Gaps = 31/302 (10%)

Query: 13  ELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS--KTKIGVIEVVQNL 70
           + E +P   P       + AG   G+ +  V  P D  K R+Q++  K+   ++  +  +
Sbjct: 13  DYEALPDSAPLSH---QLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKI 69

Query: 71  LRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYY 130
              EG+LA +KG+ + +LG G   +V F   E  K++      D  D Q H PL   +  
Sbjct: 70  STAEGSLALWKGVQSVILGAGPAHAVYFATYEYTKKYLI----DEKDMQTHQPL---KTA 122

Query: 131 LCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLL--P 188
           L G    +    L  P + ++ R+Q  T+          ++  K++ K +         P
Sbjct: 123 LSGTVATIAADALMNPFDTLKQRMQLNTN-------TTVWNVTKQIYKNEGFSAFYYSYP 175

Query: 189 TMIRAGHGLGTYFAAYEALVVKEFEKG-TPRNQIPAWKLCSFGALSGTILWLTVYPVDVV 247
           T +     +   FAA+  ++ +   K   P N       C  G LSG        P+D +
Sbjct: 176 TTL----AMNIPFAAFNFMIYESATKFFNPTNDYNPLVHCLSGGLSGATCAAITTPLDCI 231

Query: 248 KSVLQ-----TDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVS 302
           K+VLQ     + S++  K  N+  KAT+A+Y+ HG   F++G  P +    PA A  + +
Sbjct: 232 KTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTA 291

Query: 303 FE 304
           +E
Sbjct: 292 YE 293

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTM 289
           GA +G +    ++P+D +K+ +Q+ S    K  ++++     +    G  A +KG    +
Sbjct: 30  GAFAGIMEHSVMFPIDALKTRIQSTS---AKSTSNMLSQMAKISTAEGSLALWKGVQSVI 86

Query: 290 IRAAPANAATFVSFEMT 306
           + A PA+A  F ++E T
Sbjct: 87  LGAGPAHAVYFATYEYT 103

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 90.9 bits (224), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 129/324 (39%), Gaps = 56/324 (17%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI------------------------- 61
           V ++ AG   G+ + L   P DT KVR+Q  K +                          
Sbjct: 12  VVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGG 71

Query: 62  ---------GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYN 112
                    G I   +N+   EG LA YKG+   ++G+   ++++F   E  +   A   
Sbjct: 72  DATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA--- 128

Query: 113 ADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAA-PIEHVRIRLQTQTSQGNERQFKGPFD 171
               D Q  V +     ++ G+  GV  + L   P+E V+IRLQ Q    N    K  + 
Sbjct: 129 ----DKQTGV-VSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYT 183

Query: 172 -------CIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEF-EKGTPRNQIPA 223
                   I K     AL RG+  T  R     G  F  Y  L  +EF ++      +P+
Sbjct: 184 NAVQAGYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKL--REFLQEYHGTETLPS 241

Query: 224 WKLCSFGALSGTILWLTVYPVDVVKSVLQTD---SIENPKYKNSIIKATRALYKQHGIPA 280
           W+    G +SG I   +  P+D +K+ LQ D   S +       I      L K+ G  A
Sbjct: 242 WETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRA 301

Query: 281 FFKGFVPTMIRAAPANAATFVSFE 304
            +KG  P ++R AP  A TF  +E
Sbjct: 302 LYKGITPRVMRVAPGQAVTFTVYE 325

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 8/82 (9%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSKTKI--------GVIEVVQNLLRNEGALAFYKGML 84
           G + G        P DT K RLQ  K+           +  +   LL+ EG  A YKG+ 
Sbjct: 248 GLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGIT 307

Query: 85  TPLLGVGICVSVQFGVNESMKR 106
             ++ V    +V F V E ++R
Sbjct: 308 PRVMRVAPGQAVTFTVYEFVRR 329

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 90.1 bits (222), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 86/318 (27%), Positives = 136/318 (42%), Gaps = 48/318 (15%)

Query: 8   PQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ-------TSKTK 60
           P+L  + E +P   P   +V  + AG   G+ +  +  P D  K R+Q       ++ T+
Sbjct: 4   PEL--DYEALPENAP---LVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATR 58

Query: 61  I--GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDP 118
           +   ++  +  +   EG+LA +KG+ + +LG G   +V F   E  K        D  D 
Sbjct: 59  LPSNMLAQIAKISTTEGSLALWKGVQSVVLGAGPAHAVYFATYEMCKSRLI----DPEDR 114

Query: 119 QKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK 178
           Q H PL   +  L G    V    L  P + ++ RLQ             P D + K A 
Sbjct: 115 QTHQPL---KTALSGTLATVAADALMNPFDTIKQRLQLH-----------PSDSMTKCAV 160

Query: 179 AKALMRGL------LPTMIRAGHGLGTYFAAYEALVVKEFEK-GTPRNQIPAWKLCSFGA 231
                 G+       PT I     +   FAA   ++ +   K   P N    W  C  G 
Sbjct: 161 RMYQREGIAAFFYSYPTTI----AMNIPFAALNFVIYESSTKIFNPSNNYNPWIHCLCGG 216

Query: 232 LSGTILWLTVYPVDVVKSVLQ---TDSIENPKYK--NSIIKATRALYKQHGIPAFFKGFV 286
           +SG        P+D VK+VLQ    DS+++  +K  ++  KA  A++K +G   FF+G  
Sbjct: 217 ISGATCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLK 276

Query: 287 PTMIRAAPANAATFVSFE 304
           P +I   PA A ++ S+E
Sbjct: 277 PRIISNMPATAISWTSYE 294

 Score = 34.7 bits (78), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 14/106 (13%)

Query: 204 YEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQ----TDSIENP 259
           YEAL         P N    ++L + GA +G +    ++P+D +K+ +Q    T S    
Sbjct: 8   YEAL---------PENAPLVYQLAA-GAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAAT 57

Query: 260 KYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
           +  ++++     +    G  A +KG    ++ A PA+A  F ++EM
Sbjct: 58  RLPSNMLAQIAKISTTEGSLALWKGVQSVVLGAGPAHAVYFATYEM 103

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 121/283 (42%), Gaps = 21/283 (7%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQT----SKTKIGVIEVVQNLLRNEGALAFYKGMLTPLL 88
           G++ G    +V  P D  K R+Q     SK K   I+ +  +L  EG    Y G+   L+
Sbjct: 531 GSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYK-NSIDCLLKILSKEGVRGLYSGLGPQLI 589

Query: 89  GVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIE 148
           GV    +++  VN+ M+   A       D +  +P  +    + G T G        P+E
Sbjct: 590 GVAPEKAIKLTVNDHMRATLAG-----RDGKLSLPCEI----ISGATAGACQVVFTNPLE 640

Query: 149 HVRIRLQTQTSQGNE--RQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEA 206
            V+IRLQ ++    +  R        IK L     L RG    ++R       YF  Y  
Sbjct: 641 IVKIRLQVKSDYVADAARNSVNAISVIKNLGLI-GLYRGAGACLLRDIPFSAIYFPTYAH 699

Query: 207 LVVKEF----EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYK 262
           +    F    +    RN++  W+L   G L+G        P DV+K+ LQ D  +     
Sbjct: 700 IKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVY 759

Query: 263 NSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
           N I  A R + K+ GI +FFKG    ++R++P    T  ++E+
Sbjct: 760 NGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEI 802

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 228 SFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVP 287
           + G+++G I  + VYP+D+VK+ +Q    +  KYKNSI    + L K+ G+   + G  P
Sbjct: 529 TLGSVAGCIGAMVVYPIDMVKTRMQAQR-DFSKYKNSIDCLLKILSKE-GVRGLYSGLGP 586

Query: 288 TMIRAAPANA 297
            +I  AP  A
Sbjct: 587 QLIGVAPEKA 596

 Score = 34.7 bits (78), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK-----IGVIEVVQNLLRNEGALAFYKG 82
           + +G + G+    +  PFD  K RLQ    K      G+ +  + +L+ EG  +F+KG
Sbjct: 724 LVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKG 781

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 74/180 (41%), Gaps = 16/180 (8%)

Query: 130 YLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK---AKALMRGL 186
           +  G   G + + +  PI+ V+ R+Q Q       ++K   DC+ K+      + L  GL
Sbjct: 528 FTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFS---KYKNSIDCLLKILSKEGVRGLYSGL 584

Query: 187 LPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKL-CSF--GALSGTILWLTVYP 243
            P +I    G+    A    L V +  + T   +     L C    GA +G    +   P
Sbjct: 585 GPQLI----GVAPEKAI--KLTVNDHMRATLAGRDGKLSLPCEIISGATAGACQVVFTNP 638

Query: 244 VDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303
           +++VK  LQ  S        + + A   + K  G+   ++G    ++R  P +A  F ++
Sbjct: 639 LEIVKIRLQVKSDYVADAARNSVNAISVI-KNLGLIGLYRGAGACLLRDIPFSAIYFPTY 697

>Scas_709.9
          Length = 365

 Score = 89.7 bits (221), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 125/291 (42%), Gaps = 27/291 (9%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI-------GVIEVVQNLLRNEGALAFYKGM 83
            +G + G    ++  P D TK RLQ    +        GV+  +  ++ +EG    YKG+
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFL 143
           +  +LG      + F V E  K  +      RV P          +    +T G  ++ L
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLYP-----RVLPNS----DFISHSCSAITAGAASTVL 179

Query: 144 AAPIEHVRIRLQTQTSQGNER-QFKGPFDCIKKLAK---AKALMRGLLPTMIRAGHGLGT 199
             PI  V+ RL  QT  G  R  ++G  D  KK+      + L  GL+P+M    H +  
Sbjct: 180 TNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLLH-VAI 238

Query: 200 YFAAYEALVVKEF------EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQT 253
           +F  YE L  +           +  + +   +L    + S  +  +  YP +++++ +Q 
Sbjct: 239 HFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQL 298

Query: 254 DSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
            S +    K+ ++   +  Y+  G+  F+ GF   ++R  PA+A T VSFE
Sbjct: 299 KSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFE 349

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 32/69 (46%), Gaps = 5/69 (7%)

Query: 25  RVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI-----GVIEVVQNLLRNEGALAF 79
            + + I A +   +   ++  P +  + R+Q    K+      ++++++   R EG L F
Sbjct: 267 HLTRLIIASSASKMLASILTYPHEILRTRMQLKSDKLLISKHKLLDLIKRTYRYEGLLGF 326

Query: 80  YKGMLTPLL 88
           Y G  T LL
Sbjct: 327 YSGFATNLL 335

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 89.0 bits (219), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 131/321 (40%), Gaps = 34/321 (10%)

Query: 4   EFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQT------- 56
            +  P  LN L+    P    RV     +G + G    ++  PFD  K RLQ        
Sbjct: 22  NYAIPTKLNRLKKNADP----RVAA--ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMT 75

Query: 57  --SKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNAD 114
             S+   G       + ++EGA   YKG+   +LG    + + F V +  +++       
Sbjct: 76  HQSQHYKGFFGTFATIFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRKY------- 128

Query: 115 RVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGN-ERQFKGPFDCI 173
            VD   H P   +      +T G +++    PI  V+ RL  QT  G     +KG  D  
Sbjct: 129 SVDIFPHSPFLSNAS--SAITAGAISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTF 186

Query: 174 KKLAK---AKALMRGLLPTMIRAGHGLGTYFAAYEALVVK-----EFEKGTPRNQIPAWK 225
           +K+ +   AKAL  GL+P ++     +   F  YE L ++       +  T        K
Sbjct: 187 RKIIQQEGAKALYAGLVPALL-GMLNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQK 245

Query: 226 LCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGF 285
           L     LS  +     YP +++++ +Q  S      +  ++   +  Y+Q G   F+ GF
Sbjct: 246 LILASMLSKMVASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGF 305

Query: 286 VPTMIRAAPANAATFVSFEMT 306
              ++R  PA   T VSFE +
Sbjct: 306 ATNLVRTVPAAVVTLVSFEYS 326

>Kwal_55.20868
          Length = 380

 Score = 89.4 bits (220), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 124/296 (41%), Gaps = 32/296 (10%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQT-------SKTKIGVIEVVQNLLRNEGALAFYKGM 83
            +G M G    +   P D  K RLQ        S    G++  +  ++R+EGA   YKG+
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGL 139

Query: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFL 143
           +  ++G      + F V E  K+ +         P+         +    LT G V++ L
Sbjct: 140 VPIIMGYFPTWMIYFSVYERSKKLY---------PRIFPSFDFISHSASALTAGTVSTIL 190

Query: 144 AAPIEHVRIRLQTQTS-QGNERQFKGPFDCIKKLAKAKAL---MRGLLPTMIRAGHGLGT 199
             P+  V+ RL  QT    N   +   FD   K+   + L     GLLP+++   H +  
Sbjct: 191 TNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGLFH-VAI 249

Query: 200 YFAAYEALVV----KEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQ--- 252
           +F  YE L V          T  + +   +L    + S  +     YP +++++ +Q   
Sbjct: 250 HFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKA 309

Query: 253 --TDSIE--NPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
             TD +       ++ +I+  +  YK  G+  F+ GF   + R  PA+A T VSFE
Sbjct: 310 YPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFE 365

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 87.8 bits (216), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 81/308 (26%), Positives = 131/308 (42%), Gaps = 45/308 (14%)

Query: 20  PTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ--------TSKTKIGVIEVVQNLL 71
           P P+   +    +G   GV+++LV  P D  K R+Q        +     GVI+ +  ++
Sbjct: 5   PLPF---IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61

Query: 72  RNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAA-YNADRVDPQKHVPLPLHQYY 130
           + EG    YKG+ +P+L      + +F  N+S ++ F   Y  D++  Q  +        
Sbjct: 62  KREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISI-------- 113

Query: 131 LCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLL 187
           L G   GV  + +  P E V+IRLQ   S     +F GP + + K  +     +L  GL 
Sbjct: 114 LSGSLAGVTEACVIVPFELVKIRLQDVNS-----KFNGPMEVVFKTIRETGILSLYNGLE 168

Query: 188 PTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCS---FGALSGTILWLTVYPV 244
            TM R     G YF      V+ +     P+ +    K  +    G + G   + T + +
Sbjct: 169 STMWRNAFWNGGYFG-----VIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTI 223

Query: 245 -DVVKSVLQT-------DSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPAN 296
             VVKS +Q+       D    PKY N    +   +Y + G  A +KGF+P ++R  P  
Sbjct: 224 LSVVKSRIQSGATTTLADGTVVPKY-NWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGG 282

Query: 297 AATFVSFE 304
               V F 
Sbjct: 283 GIMLVVFN 290

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 90.1 bits (222), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 125/287 (43%), Gaps = 28/287 (9%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSKTKI---GVIEVVQNLLRNEGALAFYKGMLTPLLG 89
           G++ G     V  P D  K R+Q  ++       I+ +  ++  EG    Y G+   L+G
Sbjct: 537 GSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGPQLIG 596

Query: 90  VGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEH 149
           V    +++  VN+ M+        +R+   K+  L L    + G + G        P+E 
Sbjct: 597 VAPEKAIKLTVNDFMR--------NRL-TDKNGKLSLFPEIISGASAGACQVIFTNPLEI 647

Query: 150 VRIRLQTQTS-------QGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFA 202
           V+IRLQ Q+        Q NE   +     +KKL   + L  G+   ++R       YF 
Sbjct: 648 VKIRLQVQSDYVGENIQQANETATQ----IVKKLG-LRGLYNGVAACLMRDVPFSAIYFP 702

Query: 203 AYEALVVKEFE----KGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIEN 258
            Y  L    F+      T RN++  W+L + GA++G        P DV+K+ LQ D  + 
Sbjct: 703 TYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKG 762

Query: 259 PKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
               N I  A R + K+    +FFKG    ++R++P    T  ++E+
Sbjct: 763 ETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYEL 809

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 77/185 (41%), Gaps = 11/185 (5%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIG-----VIEVVQNLLRNEGALAFYKGM 83
           +I +G   G  QV+   P +  K+RLQ     +G       E    +++  G    Y G+
Sbjct: 627 EIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGV 686

Query: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFL 143
              L+      ++ F     +K+    ++ D  D  K   L   +    G   G+  +FL
Sbjct: 687 AACLMRDVPFSAIYFPTYAHLKK--DLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFL 744

Query: 144 AAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHGLGTY 200
             P + ++ RLQ    +G E ++ G F  I+ + K    ++  +G    ++R+    G  
Sbjct: 745 TTPFDVIKTRLQIDPRKG-ETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFT 803

Query: 201 FAAYE 205
            AAYE
Sbjct: 804 LAAYE 808

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 228 SFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVP 287
           S G+++G I    VYP+D +K+ +Q       +YKNSI    + + ++ GI   + G  P
Sbjct: 535 SLGSIAGCIGATVVYPIDFIKTRMQAQR-SLAQYKNSIDCLLKIISRE-GIKGLYSGLGP 592

Query: 288 TMIRAAPANA 297
            +I  AP  A
Sbjct: 593 QLIGVAPEKA 602

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 86.7 bits (213), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 127/282 (45%), Gaps = 13/282 (4%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQ---TSKTKIGVIEVVQNLLRNEGALA--FYKG 82
           K++ +G   G    L+  P D  KVRLQ   TS TK G   +   ++ ++ +L    Y+G
Sbjct: 10  KEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRELYRG 69

Query: 83  MLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSF 142
           +   L+G  I   + F      K +   YN  R+   K   L    Y     + G++ + 
Sbjct: 70  LTVNLVGNTIAWGLYFASYRVAKDYLINYN-HRIRNDK--DLSSWMYLSASASSGMLTTV 126

Query: 143 LAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFA 202
           L  P+  ++ R+ ++ +  +    K   D IK     + L +GL+P ++    G   +F 
Sbjct: 127 LTNPLWVIKTRMMSK-ANSDLTSMKVLRDLIKN-DGVQGLWKGLVPALVGVSQG-ALHFT 183

Query: 203 AYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYK 262
            Y+ L  K   K    ++I   +  +  ++S  +    VYP  ++KS LQ+       +K
Sbjct: 184 CYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQSFQASENDFK 243

Query: 263 NSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
             ++  ++ +Y + G+  F+KG    ++R+ P+   TF  +E
Sbjct: 244 --LLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 80/173 (46%), Gaps = 13/173 (7%)

Query: 125 PLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCI--KKLAKAKAL 182
           PL +  + GLT G V + +  P++  ++RLQ   +   ++ ++  +  I    L+  + L
Sbjct: 7   PLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTREL 66

Query: 183 MRGLLPTMIRAGHGLGTYFAAYEALVVKEF-----EKGTPRNQIPAWKLCSFGALSGTIL 237
            RGL   ++      G YFA+Y   V K++      +      + +W   S  A SG + 
Sbjct: 67  YRGLTVNLVGNTIAWGLYFASYR--VAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLT 124

Query: 238 WLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMI 290
            +   P+ V+K+ + + +  +     + +K  R L K  G+   +KG VP ++
Sbjct: 125 TVLTNPLWVIKTRMMSKANSDL----TSMKVLRDLIKNDGVQGLWKGLVPALV 173

>Kwal_47.18216
          Length = 333

 Score = 87.0 bits (214), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 133/318 (41%), Gaps = 50/318 (15%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQT-------SKTKIGVIEVVQNLLRNEGALAFYK 81
           ++ AG   G+ + L   P DT KVR+Q         +   G I   +++   EG LA YK
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G+   ++G+   ++++F   E    FF    ADR   Q  V +     ++ G+  G+  +
Sbjct: 73  GLGAVVIGIIPKMAIRFTSYE----FFRTLLADR---QTGV-VSTGNTFVAGVGAGITEA 124

Query: 142 FLAA-PIEHVRIRLQTQTSQGN--ERQFKGPFD--------------------------- 171
            +   P+E V+IRLQ Q  +    + Q  G                              
Sbjct: 125 VMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQ 184

Query: 172 ---CIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCS 228
               I K    +AL RG+  T  R     G  F  Y  L  +  ++    + +P+W+   
Sbjct: 185 AAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR-LQEYHQTDMLPSWETSL 243

Query: 229 FGALSGTILWLTVYPVDVVKSVLQTD-SIENPKYKNSIIKATRALYKQHGIPAFFKGFVP 287
            G +SG +   +  P+D +K+ LQ D S       + I+   R L ++ G  A +KG  P
Sbjct: 244 IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITP 303

Query: 288 TMIRAAPANAATFVSFEM 305
            ++R AP  A TF  +E+
Sbjct: 304 RVMRVAPGQAVTFTVYEL 321

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 64/153 (41%), Gaps = 11/153 (7%)

Query: 64  IEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVP 123
           I+    +++ EG  A Y+G+              F V  ++K     Y+   +       
Sbjct: 183 IQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDM------- 235

Query: 124 LPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---K 180
           LP  +  L GL  G +  F  AP++ ++ RLQ   S   +  +       ++L +    +
Sbjct: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFR 295

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFE 213
           AL +G+ P ++R   G    F  YE L+ K+ E
Sbjct: 296 ALYKGITPRVMRVAPGQAVTFTVYE-LIRKKLE 327

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 46  PFDTTKVRLQTSKTKIG------VIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFG 99
           P DT K RLQ  K+         ++ + + L+R EG  A YKG+   ++ V    +V F 
Sbjct: 258 PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFT 317

Query: 100 VNESMKR 106
           V E +++
Sbjct: 318 VYELIRK 324

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 85.5 bits (210), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 80/304 (26%), Positives = 134/304 (44%), Gaps = 33/304 (10%)

Query: 13  ELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS----KTKIGVIEVVQ 68
           + E +P   P   +   + AG   G+ +  +  P D  K R+Q +        G+I  + 
Sbjct: 13  DYEALPSHAP---LHSQLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQIS 69

Query: 69  NLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQ 128
            +   EG++A +KG+ + +LG G   +V FG  E    F  A      D Q H P+   +
Sbjct: 70  KISTMEGSMALWKGVQSVILGAGPAHAVYFGTYE----FCKARLISPEDMQTHQPM---K 122

Query: 129 YYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK--ALMRGL 186
             L G    +    L  P + V+ RLQ  T   N R     ++  K++ + +  A     
Sbjct: 123 TALSGTIATIAADALMNPFDTVKQRLQLDT---NLR----VWNVTKQIYQNEGFAAFYYS 175

Query: 187 LPTMIRAGHGLGTYFAAYEALVVKEFEKG-TPRNQIPAWKLCSFGALSGTILWLTVYPVD 245
            PT +     +   FAA+  ++ +   K   P+N       C  G +SG        P+D
Sbjct: 176 YPTTL----AMNIPFAAFNFMIYESASKFFNPQNSYNPLIHCLCGGISGATCAALTTPLD 231

Query: 246 VVKSVLQ-----TDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
            +K+VLQ     T SIE  K  N+  +A+RA+ + HG   F++G  P ++   PA A ++
Sbjct: 232 CIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISW 291

Query: 301 VSFE 304
            ++E
Sbjct: 292 TAYE 295

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 87.0 bits (214), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 70/283 (24%), Positives = 115/283 (40%), Gaps = 20/283 (7%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSKT---KIGVIEVVQNLLRNEGALAFYKGMLTPLLG 89
           G++ G     +  P D  K R+Q  ++       I+    +L  EG    Y G+   L+G
Sbjct: 550 GSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGPQLIG 609

Query: 90  VGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEH 149
           V    +++  VN+ M+      N           L L    + G + G        P+E 
Sbjct: 610 VAPEKAIKLTVNDYMRNKLKDKNGK---------LGLLSEIISGASAGACQVIFTNPLEI 660

Query: 150 VRIRLQTQ---TSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEA 206
           V+IRLQ +    ++  E         IK+L     L +G    ++R       YF  Y  
Sbjct: 661 VKIRLQVKGEYVAENAENAKLTALQIIKRLG-LPGLYKGAAACLLRDVPFSAIYFPTYAH 719

Query: 207 LVVKEFE----KGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYK 262
           L    F         R+++  W+L S GAL+G        P DV+K+ LQ D  +     
Sbjct: 720 LKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIY 779

Query: 263 NSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
             II A R + ++    +FFKG    ++R++P    T  ++E+
Sbjct: 780 KGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYEL 822

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 45/192 (23%), Positives = 79/192 (41%), Gaps = 19/192 (9%)

Query: 26  VVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ---------TSKTKIGVIEVVQNLLRNEGA 76
           ++ +I +G   G  QV+   P +  K+RLQ             K+  +++++ L    G 
Sbjct: 637 LLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRL----GL 692

Query: 77  LAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTG 136
              YKG    LL      ++ F     +KR    +N D  D  K   L   +    G   
Sbjct: 693 PGLYKGAAACLLRDVPFSAIYFPTYAHLKRDL--FNFDPNDKNKRSRLNTWELLSAGALA 750

Query: 137 GVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLPTMIRA 193
           G+  ++L  P + ++ RLQ    +G E  +KG     + + +    K+  +G    ++R+
Sbjct: 751 GMPAAYLTTPFDVIKTRLQIDPKKG-ETIYKGIIHAARTILREESFKSFFKGGAARVLRS 809

Query: 194 GHGLGTYFAAYE 205
               G   AAYE
Sbjct: 810 SPQFGFTLAAYE 821

>Kwal_23.4731
          Length = 314

 Score = 85.1 bits (209), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 131/296 (44%), Gaps = 21/296 (7%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQ---TSKTKIGVIEVVQNLLRNEGALA-----F 79
           ++I AG   G    +   P D  K+RLQ    +    G  EV++ ++R+  A +      
Sbjct: 15  REIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREA 74

Query: 80  YKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDP------QKHVPLPLHQYYLCG 133
           Y+G+   L+G  I   + FG+    K     Y   ++        QK   +    Y    
Sbjct: 75  YRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASA 134

Query: 134 LTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKAL---MRGLLPTM 190
              G+  + L  PI  ++ R+ + +SQ +ER +K  +D I+K+   +      RGL+P++
Sbjct: 135 ALSGLGTAILTNPIWVIKTRIMSTSSQASER-YKTTWDGIRKVYAHEGFSGFWRGLVPSL 193

Query: 191 IRAGHGLGTYFAAYEALVVKEFEKG--TPRNQIPAWKLCSFGALSGTILWLTVYPVDVVK 248
                G   YF  Y++L  + F +   T   ++   +  +  ++S  +    VYP  ++K
Sbjct: 194 FGVAQG-AIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPFQLLK 252

Query: 249 SVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           S LQ+ +    +         ++++++ G+   +KG    ++RA P+   TF  +E
Sbjct: 253 SNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYE 308

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 77/189 (40%), Gaps = 23/189 (12%)

Query: 125 PLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA----- 179
           PL +  + GL  G + +    P++ V++RLQ   +  +   +K     I + +KA     
Sbjct: 12  PLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVF 71

Query: 180 KALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSF---------- 229
           +   RGL   +I      G YF  Y       +  G  + + P     SF          
Sbjct: 72  REAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPT--QSSFQKDKAMGPSL 129

Query: 230 ----GALSGTILWLTVYPVDVVKS-VLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKG 284
                ALSG    +   P+ V+K+ ++ T S  + +YK +     R +Y   G   F++G
Sbjct: 130 YLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTT-WDGIRKVYAHEGFSGFWRG 188

Query: 285 FVPTMIRAA 293
            VP++   A
Sbjct: 189 LVPSLFGVA 197

>Kwal_33.14050
          Length = 314

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 133/311 (42%), Gaps = 38/311 (12%)

Query: 13  ELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIE------- 65
           + E +P   P   +   + AG   G+ +  +  P D  K R+Q     IG          
Sbjct: 6   DYESLPTNAP---LTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPS 62

Query: 66  -VVQNLLR---NEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
            +VQ + R    EG++A +KG+ + +LG G   +V F   E  K    +Y  D  D Q H
Sbjct: 63  NIVQQIARISTTEGSMALWKGVQSVILGAGPAHAVYFATYEMCK----SYLIDPQDFQTH 118

Query: 122 VPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA 181
            PL   +    G+   V    L  P + ++ R+Q +T   +       +    ++ + + 
Sbjct: 119 QPL---KTAASGIAATVAADLLMNPFDTIKQRMQLRTFSKDRM-----WSVASRIYRNEG 170

Query: 182 LMRGL--LPTMIRAGHGLGTY-FAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILW 238
           L       PT I        + FA YE+   K F    P N       C  G +SG    
Sbjct: 171 LAAFFYSYPTTIAMNIPFAAFNFAIYES-ATKFFN---PENTYNPLIHCLCGGISGATCA 226

Query: 239 LTVYPVDVVKSVLQ---TDSIENPKYK--NSIIKATRALYKQHGIPAFFKGFVPTMIRAA 293
               P+D +K+VLQ   ++S+ +P ++  ++  +A  A+ K +G   F++G  P +I   
Sbjct: 227 AITTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNM 286

Query: 294 PANAATFVSFE 304
           PA A ++ ++E
Sbjct: 287 PATAISWTAYE 297

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSI------ENPKYKNSIIKATRALYKQHGIPAFFK 283
           GA +G +    ++P+D +K+ +Q  S          K  ++I++    +    G  A +K
Sbjct: 23  GAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMALWK 82

Query: 284 GFVPTMIRAAPANAATFVSFEM 305
           G    ++ A PA+A  F ++EM
Sbjct: 83  GVQSVILGAGPAHAVYFATYEM 104

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 84.0 bits (206), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 125/291 (42%), Gaps = 33/291 (11%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQT------SKTKIGVIEVVQNLLRNEGALAFYKGMLT 85
           +G + G    ++  P D  K RLQ        +   G++  +  +LR+EG    YKG+  
Sbjct: 90  SGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAP 149

Query: 86  PLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAA 145
            +LG      + F V E  K+ + +Y          +P     +    LT G +++ L  
Sbjct: 150 IVLGYFPTWMLYFSVYEKCKQRYPSY----------LPGGFVSHAASALTAGAISTALTN 199

Query: 146 PIEHVRIRLQTQTSQGNER-QFKGPFDCIKKLAKAKAL---MRGLLPTMIRAGHGLGTYF 201
           PI  V+ RL  Q+    +   ++   D  +K+ +++ L     GL+P++    H +  +F
Sbjct: 200 PIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGLFH-VAIHF 258

Query: 202 AAYEALVVKEFEKGTP--------RNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQT 253
             YE L +    + TP         N++   +L     LS  +  +  YP +++++ +Q 
Sbjct: 259 PVYEKLKI-WLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQV 317

Query: 254 DSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
                P    +++   RA     G   F+ GF   ++R  PA+  T VSFE
Sbjct: 318 RHSGVPPSLLNLLGRIRA---SEGYVGFYSGFATNLVRTVPASVITLVSFE 365

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 82.4 bits (202), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/319 (23%), Positives = 131/319 (41%), Gaps = 43/319 (13%)

Query: 13  ELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQT-SKTKIG--------- 62
           + E +P   P   +   + AG   G+ +  +  P D  K R+Q  S+ K           
Sbjct: 10  DYEALPDTAP---LSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGA 66

Query: 63  -----------VIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAY 111
                      +++ +  +   EG+LA ++G+ + ++G G   +V F   E  K      
Sbjct: 67  GAASGGAGAGTLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLI-- 124

Query: 112 NADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFD 171
             D  D   H PL   +  + G+   V    L  P + ++ RLQ Q+   +   ++  F+
Sbjct: 125 --DAKDFNTHQPL---KTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFN 179

Query: 172 CIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKG-TPRNQIPAWKLCSFG 230
             K             PT +     +   FAA   ++ +   K   P N    W  C  G
Sbjct: 180 IYKNEGPMAFFYS--YPTTL----AMNIPFAALNFVIYESSTKFFNPTNAYNPWIHCLCG 233

Query: 231 ALSGTILWLTVYPVDVVKSVLQ-----TDSIENPKYKNSIIKATRALYKQHGIPAFFKGF 285
            ++G        P+D +K+VLQ     T  +E+ K  N+  KA +A+++ +G   F++G 
Sbjct: 234 GIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGL 293

Query: 286 VPTMIRAAPANAATFVSFE 304
            P +I   PA A ++ S+E
Sbjct: 294 QPRVISNIPATAISWTSYE 312

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 87/211 (41%), Gaps = 24/211 (11%)

Query: 4   EFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVR--LQTSKTKI 61
           EF   QL++  +D     P    +K   +G    VA   +  PFDT K R  LQ+  +  
Sbjct: 117 EFCKEQLIDA-KDFNTHQP----LKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDS 171

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
            +  +  N+ +NEG +AF+    T L       ++ F + ES  +FF   NA   +P  H
Sbjct: 172 SMWRMAFNIYKNEGPMAFFYSYPTTLAMNIPFAALNFVIYESSTKFFNPTNA--YNPWIH 229

Query: 122 VPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA-- 179
                    LCG   G   + +  P++ ++  LQ + S     +     +  KK A+A  
Sbjct: 230 C--------LCGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIW 281

Query: 180 -----KALMRGLLPTMIRAGHGLGTYFAAYE 205
                K   RGL P +I         + +YE
Sbjct: 282 QSYGWKGFWRGLQPRVISNIPATAISWTSYE 312

>Scas_582.7
          Length = 329

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 132/306 (43%), Gaps = 33/306 (10%)

Query: 13  ELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK------IGVIEV 66
           + E +P   P       + AG   G+ +     P D  K R+Q++ TK        +I+ 
Sbjct: 26  DYEALPAHAPLSH---QLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQ 82

Query: 67  VQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPL 126
           +  +   EG+LA +KG+ + +LG G   +V F   E  K           D Q+    P+
Sbjct: 83  ISKISTMEGSLALWKGVQSVILGAGPAHAVYFATYEFTKAHLIP------DSQRETHQPI 136

Query: 127 HQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGL 186
            +  + G T  V + F   P + ++ R+Q      ++ + +  ++  KK+   + L    
Sbjct: 137 -KVAVSGATATVASDFFMNPFDTIKQRMQI-----SDLKKEKVYNVAKKIYNLEGLSAFY 190

Query: 187 --LPTMIRAGHGLGTYFAAYEALVVKEFEK-GTPRNQIPAWKLCSFGALSGTILWLTVYP 243
              PT I     +   FAA+  ++ +   K   P +       C  G +SG I      P
Sbjct: 191 YSYPTTI----AMNIPFAAFNFMIYESASKFFNPLHHYNPLIHCLCGGISGAIAAAVTTP 246

Query: 244 VDVVKSVLQTD-----SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAA 298
           +D +K+V+Q       S+E  K  N+  KAT A+   +G   F++G  P ++   PA A 
Sbjct: 247 LDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAI 306

Query: 299 TFVSFE 304
           ++ ++E
Sbjct: 307 SWTAYE 312

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIE-NPKYKNSIIKATRALYKQHGIPAFFKGFVPT 288
           GA +G +   T++P+D +K+ +Q+ + +   +   SIIK    +    G  A +KG    
Sbjct: 43  GAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGVQSV 102

Query: 289 MIRAAPANAATFVSFEMT 306
           ++ A PA+A  F ++E T
Sbjct: 103 ILGAGPAHAVYFATYEFT 120

>Scas_602.8
          Length = 885

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/324 (25%), Positives = 139/324 (42%), Gaps = 36/324 (11%)

Query: 7   TPQLLN------ELEDVPPPTPYGR-----VVKDIFAGTMGGVAQVL---VGQPFDTTKV 52
            P  LN      ELE +   + Y       +   IF  ++G VA  +   +  P D  K 
Sbjct: 465 NPNYLNDLVHRLELERIGKESLYRNYYFYPIFDSIFNFSLGSVAGCIGATLVYPIDFIKT 524

Query: 53  RLQTSKTKI---GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFA 109
           R+Q  ++       I+ +  +   EG    Y G+   L+GV    +++  VN+ M++   
Sbjct: 525 RMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGPQLIGVAPEKAIKLTVNDFMRK--- 581

Query: 110 AYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKG- 168
                 VD + ++ L      L G T G        P+E V+IRLQ ++   N    K  
Sbjct: 582 ----SLVDKKGNLQLGAE--VLSGATAGACQVVFTNPLEIVKIRLQVKSEYTNAMIPKSQ 635

Query: 169 --PFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFE----KGTPRNQIP 222
              F  IK+L K   L +G+   ++R       YF  Y  L    F+        R+++ 
Sbjct: 636 LTAFQIIKEL-KLIGLYKGVGACLLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLK 694

Query: 223 AWKLCSFGALSGTILWLTVYPVDVVKSVLQTD-SIENPKYKNSIIKATRALYKQHGIPAF 281
            W+L + GAL+G        P DV+K+ LQ +  +   +Y   I+ A R + K+    +F
Sbjct: 695 TWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYT-GILHAVRTILKEESFRSF 753

Query: 282 FKGFVPTMIRAAPANAATFVSFEM 305
           FKG    ++R++P    T  ++E+
Sbjct: 754 FKGGAARVMRSSPQFGFTLAAYEL 777

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 123/294 (41%), Gaps = 26/294 (8%)

Query: 26  VVKDIFAGTMGGVAQVL---VGQPFDTTKVRLQTSKT---KIGVIEVVQNLLRNEGALAF 79
           +   I+  T+G +A  +   V  P D  K R+Q  ++       I+    +   EG    
Sbjct: 515 IFDSIYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGI 574

Query: 80  YKGMLTPLLGVGICVSVQFGVNESMK-RFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGV 138
           Y G+   L+GV    +++  VN+ M+ R             KH  L  +   L G   G 
Sbjct: 575 YSGLGPQLIGVAPEKAIKLTVNDYMRGRLM----------DKHANLKWYFEILSGACAGA 624

Query: 139 VNSFLAAPIEHVRIRLQTQTSQGNE--RQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHG 196
                  P+E V+IRLQ ++    +  +        IK+L   K L +G+   ++R    
Sbjct: 625 CQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTALGVIKQLG-IKGLYKGIAACLMRDVPF 683

Query: 197 LGTYFAAYEALVVKEFEKGTP-----RNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVL 251
              YF  Y A + K+  K  P     RN++  W+L   G L+G        P DV+K+ L
Sbjct: 684 SAIYFPTY-AHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRL 742

Query: 252 QTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
           Q D  +       I  A R + K+    +FFKG    ++R++P    T  ++E+
Sbjct: 743 QIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEI 796

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 80.9 bits (198), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 135/300 (45%), Gaps = 35/300 (11%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---GVIEVVQNLLRNEGAL-----AF 79
           K+I +G   G    +V  P D  K+RLQ +   +        VQ ++++           
Sbjct: 14  KEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEA 73

Query: 80  YKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHV---PLPLHQYYLCGLTG 136
           Y+G+   ++G  +   + FG+    K    + +++     K +    +    Y +     
Sbjct: 74  YRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGAS 133

Query: 137 GVVNSFLAAPIEHVRIR-LQTQTSQGNERQFKGPFDCIKKLAKAKAL---MRGLLPTMIR 192
           G+  + L  P+  ++ R + T++SQG    +    + I ++   + L    RGL+P++  
Sbjct: 134 GLATALLTNPMWVIKTRIMSTKSSQG----YTSILNAITRIYTEEGLKTFWRGLVPSLFG 189

Query: 193 AGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFG-----ALSGTILWLTVYPVDVV 247
              G   YFA Y+ L +K       RN I   +L +       +LS  I   +VYP+ ++
Sbjct: 190 VTQG-ALYFAIYDTLKLKYLH---DRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLL 245

Query: 248 KSVLQT---DSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           K+ LQT   +  EN K  NS+I   R+++  +GI  F+KG    ++RA P+   TF  +E
Sbjct: 246 KTNLQTFRTEHNENSK-MNSLI---RSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYE 301

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 72/180 (40%), Gaps = 18/180 (10%)

Query: 125 PLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA----- 179
           PL +  + GLT G + + +  P++ +++RLQ          +      I K         
Sbjct: 11  PLQKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLL 70

Query: 180 KALMRGLLPTMIRAGHGLGTYFAAYEAL--VVKEFEKG--------TPRNQIPAWKLCSF 229
           K   RGL   +I      G YF  Y     VV                R    +  L S 
Sbjct: 71  KEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSA 130

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTM 289
           GA SG    L   P+ V+K+ +   S ++ +   SI+ A   +Y + G+  F++G VP++
Sbjct: 131 GA-SGLATALLTNPMWVIKTRIM--STKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSL 187

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 80.5 bits (197), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 83/323 (25%), Positives = 138/323 (42%), Gaps = 36/323 (11%)

Query: 11  LNELEDV-PPPTPYGRVVKD-----IFAGTMGGVAQVLVGQPFDTTKVRLQ----TSKTK 60
           ++EL  V P P+    ++K+       AG + G     V  PF+  K+ LQ    T+   
Sbjct: 1   MSELAQVLPQPSYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYN 60

Query: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120
            G++  V+ + R EG    ++G     + +    +VQF V E+ K+ F   +  +   Q 
Sbjct: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL 120

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAA-PIEHVRIRLQTQTSQ---------GNERQFKGPF 170
                L    LCG       S LA  P++ VR RL  QT+           N  +  G +
Sbjct: 121 QNWQRLFSGALCGGC-----SVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVW 175

Query: 171 DCIKKLAKA----KALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKL 226
           D + +  K     K L RG+ PT +     +   FA YE    KEF      N +  +  
Sbjct: 176 DLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF--KEFMPEGTDNTLANFYK 233

Query: 227 CSFGALSGTILWLTVYPVDVVKSVLQTDSIENP----KYKNSIIKATRALYKQHGIPAFF 282
            S GALSG +     YP D+++   Q  ++       +YK S++ A   + K  G   ++
Sbjct: 234 LSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYK-SVMDALITIGKTEGFRGYY 292

Query: 283 KGFVPTMIRAAPANAATFVSFEM 305
           KG    + +  P+ A +++ +E+
Sbjct: 293 KGLTANLFKVIPSTAVSWLVYEV 315

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 79.0 bits (193), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 107/242 (44%), Gaps = 21/242 (8%)

Query: 72  RNEGALAFYKGMLTPLLGVGICVSVQFGVNESMK----RFFAAYNADRVDPQKHVPLPLH 127
           R +     Y+G+   LLG  +  ++ FG     K    R     +A  +  ++   LP H
Sbjct: 58  RQQWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRR---LPAH 114

Query: 128 QYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMR 184
            Y L   + G+  + L  PI  ++ R+   +  G    +K  FD + KL + +   A  R
Sbjct: 115 AYMLAAGSSGIATAVLTNPIWVIKTRIMATSRAG---PYKSTFDGVYKLYQTEGVLAFWR 171

Query: 185 GLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPR--NQIPAWKLCSFGALSGTILWLTVY 242
           G++P+++    G   YFA Y+ L        T +   ++   ++     +S  I   +VY
Sbjct: 172 GVVPSLLGVSQG-AIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVY 230

Query: 243 PVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVS 302
           P  ++KS LQ      P   + I +  + +Y + GI  F++G    ++RA PA   TF  
Sbjct: 231 PFQLLKSKLQ--DFGAP---SGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFV 285

Query: 303 FE 304
           +E
Sbjct: 286 YE 287

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 72/178 (40%), Gaps = 10/178 (5%)

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPF-DCIKKLAKA 179
           H    L +  + GLT G + +  + P++ +++RLQ          + G   D  ++    
Sbjct: 3   HELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFERQQWG 62

Query: 180 KALMRGLLPTMIRAGHGLGTYFAAYEAL-------VVKEFEKGTPRNQIPAWKLCSFGAL 232
           + L RGL   ++        YF  Y          +  E   G    ++PA         
Sbjct: 63  RELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGS 122

Query: 233 SGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMI 290
           SG    +   P+ V+K+ +   S   P YK S       LY+  G+ AF++G VP+++
Sbjct: 123 SGIATAVLTNPIWVIKTRIMATSRAGP-YK-STFDGVYKLYQTEGVLAFWRGVVPSLL 178

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%)

Query: 46  PFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMK 105
           PF   K +LQ      G+ ++VQ +   EG   FY+G+   LL       + F V E++K
Sbjct: 231 PFQLLKSKLQDFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENIK 290

>Kwal_47.17321
          Length = 881

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 119/293 (40%), Gaps = 19/293 (6%)

Query: 22  PYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKT---KIGVIEVVQNLLRNEGALA 78
           P    + +   G++ G        P D  K R+Q  +        I+    +   EG   
Sbjct: 496 PIFDSIYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRG 555

Query: 79  FYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGV 138
            Y G+   L+GV    +++  VN+ +++         +D    + LPL    + G   G 
Sbjct: 556 IYSGLGPQLVGVAPEKAIKLTVNDYVRKLL-------MDENNRLTLPLE--IISGAAAGA 606

Query: 139 VNSFLAAPIEHVRIRLQTQTSQGNE--RQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHG 196
                  P+E V+IRLQ ++   +   +        +K L   + L +GL+  ++R    
Sbjct: 607 CQVIFTNPLEIVKIRLQVRSEYADSLPKSQLTALGVVKSLG-LRGLYKGLVACLMRDVPF 665

Query: 197 LGTYFAAYEALVVKEF----EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQ 252
              YF  Y  L    F    +    R ++  W+L + G L+G        P DV+K+ LQ
Sbjct: 666 SAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQ 725

Query: 253 TDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
            D  +       I+ A R + K+    +FFKG    ++R++P    T  ++E+
Sbjct: 726 IDPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEI 778

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 77.4 bits (189), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 126/302 (41%), Gaps = 32/302 (10%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTS-----KTKIGVIEVVQNLLR---NEGALA- 78
           K++ +G   G    LV  P D  KVRLQ S     K   G   V++ ++R   N G    
Sbjct: 11  KEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVT 70

Query: 79  --FYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQ-----YYL 131
              Y+G+   L G  I   V FG+    K       A   + Q       H+     Y  
Sbjct: 71  NELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLS 130

Query: 132 CGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLP 188
            G + G++ + L  PI  ++ R+ + TS+G +  +   ++ +++L +    + L +GL+P
Sbjct: 131 AGASSGLMTAILTNPIWVIKTRIMS-TSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVP 189

Query: 189 TMIRAGHGLGTYFAAYEALVVKEFEKGTPR------NQIPAWKLCSFGALSGTILWLTVY 242
            +     G   YFA Y+ L  ++  +            +   ++ S G +    L   VY
Sbjct: 190 ALFGVSQG-ALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTL---VY 245

Query: 243 PVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVS 302
           P  ++KS LQ+      K++  +    + +    G    +KG    ++RA P+   TF  
Sbjct: 246 PFQLLKSNLQSFRANEQKFR--LFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFCV 303

Query: 303 FE 304
           +E
Sbjct: 304 YE 305

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 82/189 (43%), Gaps = 21/189 (11%)

Query: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180
           H   PL +  + GL+ G V + +  P++ +++RLQ   +   +  + GPF  IK++ ++ 
Sbjct: 4   HQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHY-GPFMVIKEIIRSS 62

Query: 181 A---------LMRGLLPTMIRAGHGLGTYFAAY---EALVVKEFEK-GTPR-------NQ 220
           A         L RGL   +       G YF  Y   + L+ K   K G  +       ++
Sbjct: 63  ANSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHK 122

Query: 221 IPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPA 280
           + +    S GA SG +  +   P+ V+K+ + + S        S+    + L +  G   
Sbjct: 123 MNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQG 182

Query: 281 FFKGFVPTM 289
            +KG VP +
Sbjct: 183 LWKGLVPAL 191

>Kwal_27.12081
          Length = 369

 Score = 78.2 bits (191), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 134/305 (43%), Gaps = 52/305 (17%)

Query: 42  LVGQPFDTTKVRLQT----------SKTKIGVI------------EVVQNLLRNEGALAF 79
           +V  PFD  K RLQ+          S  K   +             ++ NL + EG  + 
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSL 127

Query: 80  YKGMLTPLLGVGICVSVQFGVNESMKRFFA-AYNADRVDPQKHVPLPLHQYYLCGLTGGV 138
           +KG+   L+GV    S+ F    + K+ ++ A+N     P  H+        +   T G 
Sbjct: 128 FKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHL--------ISAATAGW 179

Query: 139 VNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGH 195
             S    PI  ++ RLQ   + G+ RQ+K  +DC+K + + +    L +GL  + + +  
Sbjct: 180 ATSTATNPIWLIKTRLQLDKA-GHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVE 238

Query: 196 GLGTYFAAYEALV-------------VKEFEKGTPRNQIPAWKLCSFGA-LSGTILWLTV 241
           G+  +   YE +              + E EK T   +I  W   S  A L+  +  +  
Sbjct: 239 GILQWL-LYEQMKQMIKMRSIEKFGHISEGEKNTSE-KIKEWCQRSGSAGLAKFLASIVT 296

Query: 242 YPVDVVKSVLQTDSIENPKYK-NSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
           YP +VV++ L+   +EN K K   +I++ R + K+ G+ + + G  P ++R  P +   F
Sbjct: 297 YPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMF 356

Query: 301 VSFEM 305
            ++E+
Sbjct: 357 GTWEL 361

 Score = 35.4 bits (80), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 17/81 (20%)

Query: 243 PVDVVKSVLQTD-------SIENPKYKNSIIKATRA----------LYKQHGIPAFFKGF 285
           P DVVK+ LQ+D       ++ + K  N +    R           LYK  G  + FKG 
Sbjct: 72  PFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLFKGL 131

Query: 286 VPTMIRAAPANAATFVSFEMT 306
            P ++   PA +  F ++  T
Sbjct: 132 GPNLVGVIPARSINFFTYGTT 152

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 77.0 bits (188), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/306 (24%), Positives = 128/306 (41%), Gaps = 42/306 (13%)

Query: 14  LEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKT-KIGVIEVVQNLLR 72
           +   P P  Y       + G  GG+   +   P D  KVRLQT+   K  ++ +   +LR
Sbjct: 1   MSSAPEPVKY-----PWWYGGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILR 55

Query: 73  NEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYL- 131
           NEG    Y G+   +L      + +FGV + +K        +R  P++++   L  Y L 
Sbjct: 56  NEGVPGLYSGLTAAILRQCTYTTARFGVYDFVK--------ERYIPKEYLNSML--YLLP 105

Query: 132 CGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNE--RQFKGPFDCIKKLAKAKA---LMRGL 186
           C +  G V   +  P + V IR+Q  +S   E  R +K   D + K+   +    L  G 
Sbjct: 106 CSMFSGAVGGLIGNPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGW 165

Query: 187 LPTMIRAGHGLGTYFAAYEALVVKEF---EKGTPRNQIPAWKLCSFGA--LSGTILWLTV 241
            P ++R      +    Y+  + K +     G  ++     K   F +  L+G +     
Sbjct: 166 QPNLVRGILMTSSQVVTYD--IAKNYLVQNVGLDKDN----KSTHFASSLLAGLVATTVC 219

Query: 242 YPVDVVKSVLQTDSIENPKYKNSIIKATRALY---KQHGIPAFFKGFVPTMIRAAPANAA 298
            P DV+K+ +         +K+S   A R L    KQ G    F+G++P+ +R  P    
Sbjct: 220 SPADVIKTRVMN------AHKHSHDSAVRILLDAVKQEGPSFMFRGWLPSFVRLGPNTIL 273

Query: 299 TFVSFE 304
            F++ E
Sbjct: 274 IFLTVE 279

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 75/193 (38%), Gaps = 22/193 (11%)

Query: 123 PLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK---- 178
           P P+   +  G  GG+V      P++  ++RLQT  +         P   + ++A     
Sbjct: 5   PEPVKYPWWYGGFGGIVACVATHPLDLAKVRLQTAPA---------PKPTLVRMASQILR 55

Query: 179 ---AKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGT 235
                 L  GL   ++R        F  Y+  V + +      N +     CS    SG 
Sbjct: 56  NEGVPGLYSGLTAAILRQCTYTTARFGVYD-FVKERYIPKEYLNSMLYLLPCSM--FSGA 112

Query: 236 ILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYK---QHGIPAFFKGFVPTMIRA 292
           +  L   P DVV   +Q DS    + + +   A   LYK     G+   F G+ P ++R 
Sbjct: 113 VGGLIGNPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRG 172

Query: 293 APANAATFVSFEM 305
               ++  V++++
Sbjct: 173 ILMTSSQVVTYDI 185

>Scas_578.3*
          Length = 524

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 118/262 (45%), Gaps = 15/262 (5%)

Query: 54  LQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNA 113
           L  +K +  +I+ +++L R  G  AFY G    +  +    S++FG  E  KR  A  + 
Sbjct: 258 LNLAKIRSPIIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSG 317

Query: 114 DRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCI 173
           D++       L   Q Y+ G   GV+      PI+ ++ R+Q    +GN +         
Sbjct: 318 DKLVND----LSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTA 373

Query: 174 KKLAKA-------KALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEK-GTPRNQIPAWK 225
           K++ K        + ++ G L     A   LGT+ A  +  + ++ +K   P   +    
Sbjct: 374 KEMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSY 433

Query: 226 LCSF--GALSGTILWLTVYPVDVVKSVLQTD-SIENPKYKNSIIKATRALYKQHGIPAFF 282
           L     GA SGT+    VYP++++++ LQ   +  +P              K+ G+P F+
Sbjct: 434 LLVLPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFY 493

Query: 283 KGFVPTMIRAAPANAATFVSFE 304
           KG VPT+++  PA +  ++ +E
Sbjct: 494 KGLVPTLVKVCPAVSIGYLCYE 515

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 82/184 (44%), Gaps = 10/184 (5%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQTS------KTKIGVIEVVQNLLRNEGALAFYKGMLT 85
           AG + GV   +   P DT K R+Q +      K    +I   + + +  G   FY+G+L 
Sbjct: 332 AGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYRGVLL 391

Query: 86  PLLGVGICVSVQFGVNESMKRFFAAYNADRVD-PQKHVPLPLHQYYLCGLTGGVVNSFLA 144
             LG+    ++  G   ++K+++    + +++ P+K V L        G   G V +   
Sbjct: 392 GALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGATAV 451

Query: 145 APIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKAL---MRGLLPTMIRAGHGLGTYF 201
            PI  +R RLQ Q +  +   + G  D   +  K + +    +GL+PT+++    +   +
Sbjct: 452 YPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCPAVSIGY 511

Query: 202 AAYE 205
             YE
Sbjct: 512 LCYE 515

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (51%), Gaps = 17/93 (18%)

Query: 230 GALSGTILWLTVYPVDVVKSVL--QTD---SIENPKY------------KNSIIKATRAL 272
           G LSG I      P+D +K  L  +TD   ++ NPK             ++ IIKA R+L
Sbjct: 215 GGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAIRSL 274

Query: 273 YKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
           Y+Q G+ AF+ G   ++ +  P ++  F +FE+
Sbjct: 275 YRQGGLRAFYVGNGLSVFKICPESSIKFGTFEL 307

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 10/81 (12%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTSKTK------IGVIEVVQNLLRNEGALAFYKGML 84
           F+GT+G  A      P +  + RLQ   T        G  +V    L+ EG   FYKG++
Sbjct: 442 FSGTVGATAVY----PINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLV 497

Query: 85  TPLLGVGICVSVQFGVNESMK 105
             L+ V   VS+ +   E  K
Sbjct: 498 PTLVKVCPAVSIGYLCYEKFK 518

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 122/258 (47%), Gaps = 28/258 (10%)

Query: 66  VVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLP 125
           ++ N+ RNEG  + +KG+   L+GV    S+ F    + K     Y+    + Q+ V + 
Sbjct: 117 IISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEI---YSKTLNNGQEAVWIH 173

Query: 126 LHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALM-- 183
           L    +   T G   S    PI  V+ RLQ   + G  +++K  +DC+K + + + ++  
Sbjct: 174 L----MAAATAGWATSTATNPIWLVKTRLQLDKA-GTTKKYKNSWDCLKNVVQKEGILGL 228

Query: 184 -RGLLPTMIRAGHGLGTYFAAYEALV-------------VKEFEKGTPRNQIPAWKLCSF 229
            +GL  + + +  G+   +  YE +              + E EK T  ++I  W   S 
Sbjct: 229 YKGLSASYLGSVEGI-LQWVLYEQMKHIIKQRSMEKFGNISEVEKSTS-DKIKEWCQRSG 286

Query: 230 GA-LSGTILWLTVYPVDVVKSVLQTDSIENPKYK-NSIIKATRALYKQHGIPAFFKGFVP 287
            A L+  +  +  YP +VV++ L+   +EN K K   ++++ R + K+ G+ + + G  P
Sbjct: 287 SAGLAKFVASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTP 346

Query: 288 TMIRAAPANAATFVSFEM 305
            ++R  P +   F ++E+
Sbjct: 347 HLLRTVPNSIIMFGTWEL 364

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 81/198 (40%), Gaps = 24/198 (12%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQ-----TSKTKIGVIEVVQNLLRNEGALAFYKGML 84
           + A    G A      P    K RLQ     T+K      + ++N+++ EG L  YKG+ 
Sbjct: 174 LMAAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLS 233

Query: 85  TPLLGV--GICVSVQFGVNESMKRFFAAYNADRV----DPQKHVPLPLHQYYLCGLTGGV 138
              LG   GI   +Q+ + E MK      + ++     + +K     + ++  C  +G  
Sbjct: 234 ASYLGSVEGI---LQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEW--CQRSGSA 288

Query: 139 -----VNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMR---GLLPTM 190
                V S +  P E VR RL+    +  + ++ G    I+ + K + L     GL P +
Sbjct: 289 GLAKFVASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHL 348

Query: 191 IRAGHGLGTYFAAYEALV 208
           +R        F  +E ++
Sbjct: 349 LRTVPNSIIMFGTWELVI 366

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 34/84 (40%), Gaps = 20/84 (23%)

Query: 243 PVDVVKSVLQTDSIE----------NPKYKNSIIKATRA----------LYKQHGIPAFF 282
           P DVVK+ LQ+D  +           P   N I +  R           +Y+  G  + F
Sbjct: 72  PFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLF 131

Query: 283 KGFVPTMIRAAPANAATFVSFEMT 306
           KG  P ++   PA +  F ++  T
Sbjct: 132 KGLGPNLVGVIPARSINFFTYGTT 155

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 62/167 (37%), Gaps = 27/167 (16%)

Query: 143 LAAPIEHVRIRLQTQTSQG-----------NE--------RQFKGPFDCIKKLAKA---K 180
           +  P + V+ RLQ+   Q            N+        R FK  F  I  + +    +
Sbjct: 69  VTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFR 128

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRN-QIPAWKLCSFGALSGTILWL 239
           +L +GL P ++         F  Y     KE    T  N Q   W      A +G     
Sbjct: 129 SLFKGLGPNLVGVIPARSINFFTYG--TTKEIYSKTLNNGQEAVWIHLMAAATAGWATST 186

Query: 240 TVYPVDVVKSVLQTDSI-ENPKYKNSIIKATRALYKQHGIPAFFKGF 285
              P+ +VK+ LQ D      KYKNS     + + ++ GI   +KG 
Sbjct: 187 ATNPIWLVKTRLQLDKAGTTKKYKNS-WDCLKNVVQKEGILGLYKGL 232

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 74.3 bits (181), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 126/288 (43%), Gaps = 31/288 (10%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTSKT-KIGVIEVVQNLLRNEGALAFYKGMLTPLLG 89
           + G   G+  V+   P D TKVRLQ +   K  ++++++++L+NEG +  Y G+   LL 
Sbjct: 11  WYGGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLR 70

Query: 90  VGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLT------GGVVNSFL 143
                + +FG+ +++K        + V P+  +    + +YL G +      GG+  +F 
Sbjct: 71  QCTYTTARFGMYDALK--------EHVIPRDKLT---NMWYLLGASMVSGALGGLAGNF- 118

Query: 144 AAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA----LMRGLLPTMIRAGHGLGT 199
            A + ++R++  +       R +K   D + K+ KA+      + G  P M+R      +
Sbjct: 119 -ADLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTAS 177

Query: 200 YFAAYEAL---VVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSI 256
               Y+     +V ++     +N      L S   L+G +      P DV+K+++     
Sbjct: 178 QVVTYDMFKNFLVTKYNMDPKKNST---HLTS-SLLAGFVATTVCSPADVIKTIVMNAHK 233

Query: 257 ENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           +     +S  K       + G    F+G+VP+  R AP     F + E
Sbjct: 234 KPGHNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAME 281

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 58/130 (44%), Gaps = 11/130 (8%)

Query: 182 LMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIP-AWKLCSFGALSGTILWLT 240
           L  GL  +++R        F  Y+AL     E   PR+++   W L     +SG +  L 
Sbjct: 60  LYAGLSASLLRQCTYTTARFGMYDALK----EHVIPRDKLTNMWYLLGASMVSGALGGLA 115

Query: 241 VYPVDVVKSVLQTDSI----ENPKYKNSIIKATRALYKQHGIPAFF-KGFVPTMIRAAPA 295
               D++   +Q DS     +   YKN+I    + +YK  G  + F  G+ P M+R    
Sbjct: 116 GNFADLINIRMQNDSALPLDKRRNYKNAIDGMVK-IYKAEGAKSLFLTGWKPNMVRGVLM 174

Query: 296 NAATFVSFEM 305
            A+  V+++M
Sbjct: 175 TASQVVTYDM 184

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 74.7 bits (182), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 77/319 (24%), Positives = 124/319 (38%), Gaps = 59/319 (18%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------------------GVIEVVQN 69
            +G + G    ++  P D  K RLQ    ++                     G+   +  
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 70  LLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQY 129
           ++R+E     YKG++  +LG      + F V E  K  +  Y  +              +
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNS---------EFLSH 218

Query: 130 YLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQG--NERQFKGPFDCIKKLAKA---KALMR 184
            +  LT G +++ L  PI  V+ RL  Q+ +       +K   D   K+ K    K+   
Sbjct: 219 SMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYS 278

Query: 185 GLLPTMIRAGHGLGTYFAAYEAL--VVKEFEKGTPRNQ-----------------IPAWK 225
           GL+P++    H +  +F  YE L  V+  +  G P  +                     +
Sbjct: 279 GLIPSLFGLLH-VAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGR 337

Query: 226 LCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGF 285
           L      S  I     YP +++++ LQ  S   P  K SII+ T   Y + GI  F+ GF
Sbjct: 338 LIVASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIK-SIIRTT---YAKEGIRGFYSGF 393

Query: 286 VPTMIRAAPANAATFVSFE 304
           +  M R  PA+A T VSFE
Sbjct: 394 LTNMFRTVPASAITLVSFE 412

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 125/300 (41%), Gaps = 31/300 (10%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGMLTP 86
            AG + G     V  PF+  K+ LQ    T+    G+ + +  + + E     ++G    
Sbjct: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87

Query: 87  LLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAP 146
            + V    +VQF V E  K+     +      Q +    L    LCG    VV ++   P
Sbjct: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCG-GCSVVATY---P 143

Query: 147 IEHVRIRLQTQT------SQGNERQFKGPFDCIKKLAKAKA-------LMRGLLPTMIRA 193
           ++ VR RL  QT      S+        P    K L+KA A       L RG+ PT +  
Sbjct: 144 LDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGI 203

Query: 194 GHGLGTYFAAYEALVVKEF----EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVK- 248
              +   FA YE L  KEF    E G    +   +KL S GA+SG +     YP D+++ 
Sbjct: 204 VPYVALNFAVYEQL--KEFMPSDENGNSSMRDSLYKL-SMGAISGGVAQTITYPFDLLRR 260

Query: 249 --SVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMT 306
              VL     E   + NS+  A   + K  G   ++KG    + +  P+ A +++ +E+T
Sbjct: 261 RFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 26/197 (13%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRL--------QTSKTKI-------GVIEVVQNLLRNE 74
           +F+G + G   V+   P D  + RL        + SK++        GV +++      E
Sbjct: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186

Query: 75  GA-LAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCG 133
           G  +  Y+G+    LG+   V++ F V E +K F  +      +    +   L++  +  
Sbjct: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDE----NGNSSMRDSLYKLSMGA 242

Query: 134 LTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQF--KGPFDCIKKLAKA---KALMRGLLP 188
           ++GGV  + +  P + +R R Q     GNE  F     +D +  + K    K   +GL  
Sbjct: 243 ISGGVAQT-ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTA 301

Query: 189 TMIRAGHGLGTYFAAYE 205
            + +        +  YE
Sbjct: 302 NLFKVVPSTAVSWLVYE 318

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/304 (24%), Positives = 141/304 (46%), Gaps = 36/304 (11%)

Query: 25  RVVKDIFAGTMGGVAQVLVGQPFDTTKVR-----LQTSKTKIGVIEVVQNLLRNEGALAF 79
           R+  DI+       A+ L+    +TT+ R     LQ +      + ++ N+ R EG  + 
Sbjct: 83  RLQSDIYQNMYKSQAEALM---MNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRSL 139

Query: 80  YKGMLTPLLGVGICVSVQFGVNESMKRFFA-AYNADRVDPQKHVPLPLHQYYLCGLTGGV 138
           +KG+   L+GV    S+ F    + K  ++ A+N  +  P  H+        +   T G 
Sbjct: 140 FKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPWIHL--------MAAATAGW 191

Query: 139 VNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGH 195
             +    PI  V+ R+Q   + G  R +K  +DC+K + + +    L RGL  + + +  
Sbjct: 192 ATATATNPIWMVKTRVQLDKA-GKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVE 250

Query: 196 GLGTYFAAYEAL--VVKE--FEK--------GTPRNQIPAWKLCSFGA-LSGTILWLTVY 242
           G+  +   YE L  ++K+   EK         T  ++I  W   S GA L+  +  +  Y
Sbjct: 251 GILQWL-LYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTY 309

Query: 243 PVDVVKSVLQTDSIENPKYK-NSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFV 301
           P +VV++ L+   +EN K K   ++++ R + K+ G+ + + G  P ++R  P +   F 
Sbjct: 310 PHEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFG 369

Query: 302 SFEM 305
           ++E+
Sbjct: 370 TWEV 373

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 37/89 (41%), Gaps = 25/89 (28%)

Query: 243 PVDVVKSVLQTDSIEN---------------PKYKNSIIKATRA----------LYKQHG 277
           P D+VK+ LQ+D  +N               P+  N  ++A             +Y+Q G
Sbjct: 76  PFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEG 135

Query: 278 IPAFFKGFVPTMIRAAPANAATFVSFEMT 306
             + FKG  P ++   PA +  F ++  T
Sbjct: 136 FRSLFKGLGPNLVGVIPARSINFFTYGTT 164

>Scas_721.27
          Length = 374

 Score = 71.6 bits (174), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 137/314 (43%), Gaps = 63/314 (20%)

Query: 42  LVGQPFDTTKVRLQTS------KTKIGVIE-----------------------VVQNLLR 72
           +V  PFD  K RLQ+       K+K   +                        ++ N+ +
Sbjct: 68  VVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYK 127

Query: 73  NEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFA-AYNADRVDPQKHVPLPLHQYYL 131
            EG  + +KG+   L+GV    S+ F    + K  ++ A+N  +  P  H+        +
Sbjct: 128 REGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPLIHL--------M 179

Query: 132 CGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLP 188
              T G   S    PI  ++ R+Q   + G  R++K  +DC+K + K++    L RGL  
Sbjct: 180 SAATAGWATSTATNPIWMIKTRVQLDKA-GTTRKYKNSWDCLKTVLKSEGIYGLYRGLSA 238

Query: 189 TMIRAGHGLGTYFAAYEAL--VVKE--FEK--------GTPRNQIPAWKLCSFGALSGT- 235
           + + +  G+  +   YE +  ++K+   EK         +   +I  W  C     +G  
Sbjct: 239 SYLGSIEGILQWL-LYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEW--CQRSGSAGVA 295

Query: 236 --ILWLTVYPVDVVKSVLQTDSIEN--PKYKNSIIKATRALYKQHGIPAFFKGFVPTMIR 291
             I  +  YP +VV++ L+   +EN  PKY   ++++ R + K+ G+ + + G  P ++R
Sbjct: 296 KFIASIVTYPHEVVRTRLRQMPMENGKPKY-TGLVQSFRVIIKEEGLASMYSGLTPHLMR 354

Query: 292 AAPANAATFVSFEM 305
             P +   F ++E+
Sbjct: 355 TVPNSIIMFGTWEL 368

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 24/88 (27%)

Query: 243 PVDVVKSVLQTD--------------SIENPKYKNSIIKATRA----------LYKQHGI 278
           P D+VK+ LQ+D              +  N K  NS+++A             +YK+ G 
Sbjct: 72  PFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKREGF 131

Query: 279 PAFFKGFVPTMIRAAPANAATFVSFEMT 306
            + FKG  P ++   PA +  F ++  T
Sbjct: 132 RSLFKGLGPNLVGVIPARSINFFTYGTT 159

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 125/309 (40%), Gaps = 41/309 (13%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRL------------------------QTSKTKIGVIEVV 67
           AG   GV       PFD  KV L                          SK K  +I+  
Sbjct: 205 AGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIKAA 264

Query: 68  QNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVP-LPL 126
             L R  G  AFY G    ++ V    +++FG  E  KR  A     R++  K    L  
Sbjct: 265 TTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMA-----RLENVKDTSELSR 319

Query: 127 HQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA------- 179
              Y+ G  GGV   F   PI+ ++ R+Q      N ++        K++ +        
Sbjct: 320 LSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFY 379

Query: 180 KALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEK-GTPRNQIPAWKLCSF--GALSGTI 236
           + +  G++     A   LGT+ A  +  + KE +K G P +++    L     GA SGT+
Sbjct: 380 RGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTV 439

Query: 237 LWLTVYPVDVVKSVLQTD-SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPA 295
               VYP++++++ LQ   +  +P   N      +   ++ G    FKG VP + +  PA
Sbjct: 440 GATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPA 499

Query: 296 NAATFVSFE 304
            + +++ +E
Sbjct: 500 VSISYLCYE 508

 Score = 62.8 bits (151), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 94/209 (44%), Gaps = 11/209 (5%)

Query: 9   QLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS------KTKIG 62
           +++  LE+V   +   R+   I AG +GGVA      P DT K R+Q +      K    
Sbjct: 303 RIMARLENVKDTSELSRLSTYI-AGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSI 361

Query: 63  VIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVD-PQKH 121
           +++  + + +  G   FY+G+   ++G+    ++  G   ++K+++    A +   P+  
Sbjct: 362 LLQTAKEMYQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDE 421

Query: 122 VPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA-- 179
           V +        G   G V + L  PI  +R RLQ Q +  +   + G  D +KK  +   
Sbjct: 422 VIISNLIVLPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREG 481

Query: 180 -KALMRGLLPTMIRAGHGLGTYFAAYEAL 207
            + L +GL+P + +    +   +  YE L
Sbjct: 482 YQGLFKGLVPNLAKVCPAVSISYLCYENL 510

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 76/181 (41%), Gaps = 26/181 (14%)

Query: 129 YYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQG----NERQFKGPFDCIKKLAKAKALMR 184
           +++ G   GVV+    AP + +++ L  +T       N +      +    L+K K+ + 
Sbjct: 202 FFIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLI 261

Query: 185 GLLPTMIRAGHGLGTYFAAYEALVVKEFEKG------------------TPRNQIPAWKL 226
               T+ R G GL  ++      VVK F +                     ++     +L
Sbjct: 262 KAATTLYRQG-GLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRL 320

Query: 227 CSF--GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKAT-RALYKQHGIPAFFK 283
            ++  G L G     +VYP+D +K  +Q   +     K+SI+  T + +Y+Q GI  F++
Sbjct: 321 STYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYR 380

Query: 284 G 284
           G
Sbjct: 381 G 381

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%)

Query: 260 KYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
           K K+ +IKA   LY+Q G+ AF+ G    +++  P +A  F SFEM
Sbjct: 255 KIKSPLIKAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEM 300

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 10/83 (12%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI------GVIEVVQNLLRNEGALAFYKGML 84
           F+GT+G      +  P +  + RLQ   T        G  +V++  ++ EG    +KG++
Sbjct: 435 FSGTVGAT----LVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLV 490

Query: 85  TPLLGVGICVSVQFGVNESMKRF 107
             L  V   VS+ +   E++KR 
Sbjct: 491 PNLAKVCPAVSISYLCYENLKRL 513

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 118/258 (45%), Gaps = 29/258 (11%)

Query: 66  VVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFA-AYNADRVDPQKHVPL 124
           ++ N+ R EG  + +KG+   L+GV    S+ F    + K  ++   N  +  P  H+  
Sbjct: 116 IIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIHL-- 173

Query: 125 PLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---A 181
                 L   T G   S +  PI  V+ RLQ    +   + +K   DCIK + K +    
Sbjct: 174 ------LAAATAGWATSTVTNPIWLVKTRLQLD--KAGTKTYKNSLDCIKSVVKNEGVLG 225

Query: 182 LMRGLLPTMIRAGHGLGTYFAAYEAL--VVKE--FEK--------GTPRNQIPAWKLCSF 229
           L +GL  + + +  G+  +   YE +  ++KE   EK         +  +++  W   S 
Sbjct: 226 LYKGLSASYLGSVEGILQWI-LYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSG 284

Query: 230 GA-LSGTILWLTVYPVDVVKSVLQTDSIENPKYK-NSIIKATRALYKQHGIPAFFKGFVP 287
            A L+  +  +  YP +VV++ L+    EN K K   ++++ R + K+ G+ + + G  P
Sbjct: 285 SAGLAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTP 344

Query: 288 TMIRAAPANAATFVSFEM 305
            ++R  P +   F ++E+
Sbjct: 345 HLLRTVPNSIIMFGTWEL 362

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 87/199 (43%), Gaps = 24/199 (12%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQT----SKTKIGVIEVVQNLLRNEGALAFYKGMLT 85
           + A    G A   V  P    K RLQ     +KT    ++ ++++++NEG L  YKG+  
Sbjct: 173 LLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSA 232

Query: 86  PLLGV--GICVSVQFGVNESMKRFFAAYNADRV----DPQKHVPLPLHQYYLCGLTGGV- 138
             LG   GI   +Q+ + E MKR     + ++     +  K     + ++  C  +G   
Sbjct: 233 SYLGSVEGI---LQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEW--CQRSGSAG 287

Query: 139 ----VNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALM---RGLLPTMI 191
               V S +  P E VR RL+   ++  + ++ G     + + K + L+    GL P ++
Sbjct: 288 LAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLL 347

Query: 192 RAGHGLGTYFAAYEALVVK 210
           R        F  +E LV+K
Sbjct: 348 RTVPNSIIMFGTWE-LVIK 365

 Score = 35.0 bits (79), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 23/86 (26%)

Query: 243 PVDVVKSVLQTDSIENPKYKNSIIK---------ATRAL-------------YKQHGIPA 280
           P DVVK+ LQ+D +   +YK++ ++          +R+L             Y+Q G  +
Sbjct: 70  PFDVVKTRLQSD-VFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRS 128

Query: 281 FFKGFVPTMIRAAPANAATFVSFEMT 306
            FKG  P ++   PA +  F+++  T
Sbjct: 129 LFKGLGPNLVGVIPARSINFLTYGTT 154

 Score = 28.1 bits (61), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 62/172 (36%), Gaps = 27/172 (15%)

Query: 143 LAAPIEHVRIRLQTQTSQGNER--------------------QFKGPFDCIKKLAKA--- 179
           +  P + V+ RLQ+   +   +                     FK  F  I  + +    
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 180 KALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRN-QIPAWKLCSFGALSGTILW 238
           ++L +GL P ++         F  Y     K+    T  N Q   W      A +G    
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGT--TKDIYSRTLNNGQEAPWIHLLAAATAGWATS 184

Query: 239 LTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMI 290
               P+ +VK+ LQ D      YKNS +   +++ K  G+   +KG   + +
Sbjct: 185 TVTNPIWLVKTRLQLDKAGTKTYKNS-LDCIKSVVKNEGVLGLYKGLSASYL 235

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 130/303 (42%), Gaps = 55/303 (18%)

Query: 46  PFDTTKVRLQ------------TSKTKI---------GVIEVVQNLLRNEGALAFYKGML 84
           PFD  K RLQ            T++T +           + ++QN+   EG  + +KG+ 
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 85  TPLLGVGICVSVQF---GVN-ESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVN 140
             L+GV    S+ F   GV  ++  R     N  +  P  H        +L G T G   
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLL---NDGQEAPWIH--------FLAGATAGWAT 177

Query: 141 SFLAAPIEHVRIRLQ-TQTSQGNERQFKGPFDCIKKLAKAKALM---RGLLPTMIRAGHG 196
           S    PI  V+ RLQ  + + G  R++K  +DC+K + + + ++   +GL  + + +   
Sbjct: 178 STATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVES 237

Query: 197 LGTYFAAYEAL-------VVKEFEKGTPRNQIPAWKLCSFGALSGT------ILWLTVYP 243
           +   +  YE +        ++EF   +  N+    K+  +   SG+         +  YP
Sbjct: 238 I-LQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYP 296

Query: 244 VDVVKSVLQTDSIENPKYK-NSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVS 302
            +VV++ L+    EN K K   + ++   + K+ G  + + G  P ++R  P +   F +
Sbjct: 297 HEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGT 356

Query: 303 FEM 305
           +E+
Sbjct: 357 WEL 359

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 18/81 (22%)

Query: 243 PVDVVKSVLQTDSIENPKYKNSIIKATRALYK-----------------QHGIPAFFKGF 285
           P DVVK+ LQ+D + +  YK      T  +Y+                 Q G  + FKG 
Sbjct: 69  PFDVVKTRLQSD-VFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGL 127

Query: 286 VPTMIRAAPANAATFVSFEMT 306
            P ++   PA +  F ++ +T
Sbjct: 128 GPNLVGVIPARSINFFTYGVT 148

>Scas_702.10
          Length = 302

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 117/291 (40%), Gaps = 40/291 (13%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTS---KTKIGVIEVVQNLLRNEGALAFYKGMLTPL 87
           + G   G+   ++  P D  KVRLQ +   K  +G   ++  +LRNE  +  Y G+   +
Sbjct: 14  WYGGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLG--RMLTTILRNENVMGLYSGLSAAV 71

Query: 88  LGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYL--CGLTGGVVNSFLAA 145
           L      +V+FG  + MK        + + PQ H+       YL  C +  G +   +  
Sbjct: 72  LRQCTYTTVRFGAYDLMK--------ENLIPQGHIN---DMVYLLPCSMFSGAIGGLVGN 120

Query: 146 PIEHVRIRLQTQTSQGNE--RQFKGPFDCIKKL----AKAKALMRGLLPTMIRAGHGLGT 199
             + V IR+Q  ++   E  R ++   D + K+       K L+ G  P M+R      +
Sbjct: 121 FADVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTAS 180

Query: 200 YFAAYEA----LVVK-EFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKS-VLQT 253
               Y+     LV K  F+       + A        L+G +      P DV+K+ ++  
Sbjct: 181 QVVTYDVFKNYLVTKLSFDPKKNSTHLSA------SLLAGLVATTICSPADVIKTRIMNA 234

Query: 254 DSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
              E+     S IK   +  K+ G    F+G++P   R  P     F + E
Sbjct: 235 HKTES----ESAIKILTSAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIE 281

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 71/193 (36%), Gaps = 13/193 (6%)

Query: 117 DPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKL 176
            P K +  P    +  G   G+    +  P++  ++RLQ       +         I + 
Sbjct: 4   SPTKQIKYP----WWYGGAAGIFACVMTHPLDLAKVRLQAAPLP--KPTLGRMLTTILRN 57

Query: 177 AKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTI 236
                L  GL   ++R        F AY+ +      +G   + +    L      SG I
Sbjct: 58  ENVMGLYSGLSAAVLRQCTYTTVRFGAYDLMKENLIPQGHINDMV---YLLPCSMFSGAI 114

Query: 237 LWLTVYPVDVVKSVLQTDSIENPK----YKNSIIKATRALYKQHGIPAFFKGFVPTMIRA 292
             L     DVV   +Q DS   P+    Y+N+I    +    + GI     G+ P M+R 
Sbjct: 115 GGLVGNFADVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRG 174

Query: 293 APANAATFVSFEM 305
               A+  V++++
Sbjct: 175 VLMTASQVVTYDV 187

>Kwal_23.3965
          Length = 307

 Score = 67.8 bits (164), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 92/191 (48%), Gaps = 16/191 (8%)

Query: 119 QKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK 178
           +K   +P+ Q  + G   G+    + AP++ ++IRLQ Q +  NE Q+ G     K+L +
Sbjct: 7   RKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLA--NEAQYGGILVTFKRLVR 64

Query: 179 ---AKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSF-GALSG 234
               +AL +G +P M        T F +Y  L      K   ++Q+PA       GALSG
Sbjct: 65  QEGVRALWKGNVPAMAMYILYGSTQFTSYAIL-----NKLLSKSQLPAQIHTGMVGALSG 119

Query: 235 TILWLTVYPVDVVKSVLQTDSIENPKYK-NSIIKATRALYKQHGIPAFFKGFVPTMIRAA 293
           T   +  YP D    VL+T  I N   + ++++   + +++  G   FFKG   +++  A
Sbjct: 120 TCSAIASYPCD----VLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIA 175

Query: 294 PANAATFVSFE 304
            A ++   ++E
Sbjct: 176 VATSSILATYE 186

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/303 (18%), Positives = 123/303 (40%), Gaps = 40/303 (13%)

Query: 26  VVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI----GVIEVVQNLLRNEGALAFYK 81
           V + + AG + G++  +V  P DT K+RLQ          G++   + L+R EG  A +K
Sbjct: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWK 73

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G +  +    +  S QF     + +  +         +  +P  +H   + G   G  ++
Sbjct: 74  GNVPAMAMYILYGSTQFTSYAILNKLLS---------KSQLPAQIHT-GMVGALSGTCSA 123

Query: 142 FLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHGLG 198
             + P + +R R     S    R+        +++ +    +   +G+  +++       
Sbjct: 124 IASYPCDVLRTRFIANHS----RELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATS 179

Query: 199 TYFAAYEALVVKEFEKGTPRNQIPAWKL--CSFGALSGTILWLTVYPVDVVK---SVLQT 253
           +  A YE+  VK F +  P       +L   S   ++G +    V+P+D V+    V+  
Sbjct: 180 SILATYES--VKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDW 237

Query: 254 DSIENPKYKNSIIKATRA------------LYKQHGIPAFFKGFVPTMIRAAPANAATFV 301
             + +P + N   KA ++            + ++ G+ A + G+   + ++ P+   +  
Sbjct: 238 QQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLG 297

Query: 302 SFE 304
            +E
Sbjct: 298 VYE 300

>Kwal_23.3042
          Length = 542

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 119/308 (38%), Gaps = 39/308 (12%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRL------------------------QTSKTKIGVIEVV 67
           AG + GV       PFD  KV L                          SK K  +++  
Sbjct: 230 AGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVKAA 289

Query: 68  QNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLH 127
             L R  G  AFY G     + V    +++FG  E  KR  A         Q    L   
Sbjct: 290 TTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEG----VQDTAGLSRF 345

Query: 128 QYYLCGLTGGVVNSFLAAPIEHVRIRLQ----TQTSQGNERQFKGPFDCIKKLAKA---K 180
             YL G  GGV+      PI+ ++ R+Q       S+G +       D  K+       +
Sbjct: 346 STYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYR 405

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFE-KGTPRNQIPAWKL--CSFGALSGTIL 237
            +  G++     A   LGT+ A  +  + ++    G P +Q+    +     GA SGT+ 
Sbjct: 406 GITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVG 465

Query: 238 WLTVYPVDVVKSVLQTD-SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPAN 296
              VYPV+++++ LQ   +  +P   N          ++ G    FKG VP + +  PA 
Sbjct: 466 ATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAV 525

Query: 297 AATFVSFE 304
           + +++ +E
Sbjct: 526 SISYLCYE 533

 Score = 63.2 bits (152), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 92/209 (44%), Gaps = 11/209 (5%)

Query: 9   QLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQT------SKTKIG 62
           +L+ +LE V       R      AG +GGV   L   P DT K R+Q       SK +  
Sbjct: 328 RLMAQLEGVQDTAGLSRF-STYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQL 386

Query: 63  VIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVD-PQKH 121
           +I   +++ +  G   FY+G+   ++G+    ++  G   ++K+++ A  A     P+  
Sbjct: 387 LISTAKDMYKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQ 446

Query: 122 VPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA-- 179
           V +      L G   G V +    P+  +R RLQ Q +  +  ++ G  D + K  +   
Sbjct: 447 VTMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREG 506

Query: 180 -KALMRGLLPTMIRAGHGLGTYFAAYEAL 207
            + L +GL+P + +    +   +  YE L
Sbjct: 507 YQGLFKGLVPNLAKVCPAVSISYLCYENL 535

 Score = 36.6 bits (83), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 19/95 (20%)

Query: 230 GALSGTILWLTVYPVDVVK-----------SVLQTDSI---ENP-----KYKNSIIKATR 270
           G +SG +      P D +K           + L++  I   +NP     K K+ ++KA  
Sbjct: 231 GGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVKAAT 290

Query: 271 ALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
            LY+Q GI AF+ G     ++  P +A  F SFE+
Sbjct: 291 TLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFEL 325

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 10/82 (12%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI------GVIEVVQNLLRNEGALAFYKGML 84
           F+GT+G  A      P +  + RLQ   T        G  +V+   ++ EG    +KG++
Sbjct: 460 FSGTVGATAVY----PVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLV 515

Query: 85  TPLLGVGICVSVQFGVNESMKR 106
             L  V   VS+ +   E++KR
Sbjct: 516 PNLAKVCPAVSISYLCYENLKR 537

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 125/299 (41%), Gaps = 31/299 (10%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGMLTP 86
            AG + G     V  PF+  K+ LQ    T+    G+   ++ +   EG    ++G    
Sbjct: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86

Query: 87  LLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAP 146
            + +    +VQF V E+ K+     N +    Q      L    LCG    VV ++   P
Sbjct: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCG-GCSVVATY---P 142

Query: 147 IEHVRIRLQTQTS------QGNERQFKGPFDCIKKLAKA-------KALMRGLLPTMIRA 193
           ++ ++ RL  QT+      +   +    P    + L++        + L RG+ PT +  
Sbjct: 143 LDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGV 202

Query: 194 GHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKL----CSFGALSGTILWLTVYPVDVVKS 249
              +   FA YE L  +EF   +   Q P+WK      + GA+SG +     YP D+++ 
Sbjct: 203 VPYVALNFAVYEQL--REFGVNSSDAQ-PSWKSNLYKLTIGAISGGVAQTITYPFDLLRR 259

Query: 250 VLQTDSIENPKYK---NSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
             Q  ++   +      S+  A   + +  G+  ++KG    + +  P+ A +++ +E+
Sbjct: 260 RFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 82/201 (40%), Gaps = 26/201 (12%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------------GVIEVVQNLLR 72
           + +F+G + G   V+   P D  K RL      +               G+ +++    R
Sbjct: 124 QRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYR 183

Query: 73  NEGAL-AFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYL 131
            EG L   Y+G+    LGV   V++ F V E ++ F      +  D Q      L++  +
Sbjct: 184 LEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREF----GVNSSDAQPSWKSNLYKLTI 239

Query: 132 CGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFK--GPFDCIKKLAKAKAL---MRGL 186
             ++GGV  + +  P + +R R Q     GNE  F+    +D +  + +A+ +    +GL
Sbjct: 240 GAISGGVAQT-ITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298

Query: 187 LPTMIRAGHGLGTYFAAYEAL 207
              + +        +  YE +
Sbjct: 299 AANLFKVVPSTAVSWLVYEVV 319

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 81/191 (42%), Gaps = 18/191 (9%)

Query: 130 YLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK---AKALMRGL 186
           +L G   G V+  + +P E V+I LQ Q+S  +    +G F  I+++      K L RG 
Sbjct: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN--RGIFSSIRQVYHEEGTKGLFRGN 83

Query: 187 LPTMIRAGHGLGTYFAAYEALVVKEFE--KGTPRNQIPAWKLCSFGALSGTILWLTVYPV 244
               IR        F  YEA   K F       + Q+   +    GAL G    +  YP+
Sbjct: 84  GLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPL 143

Query: 245 DVVKSVL--QT---DSIENPKYKN-----SIIKATRALYK-QHGIPAFFKGFVPTMIRAA 293
           D++K+ L  QT    S+   K K+      I +     Y+ + G+   ++G  PT +   
Sbjct: 144 DLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGVV 203

Query: 294 PANAATFVSFE 304
           P  A  F  +E
Sbjct: 204 PYVALNFAVYE 214

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 110/263 (41%), Gaps = 15/263 (5%)

Query: 53  RLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYN 112
           R   +K +  +++   +L R  G  AFY G    ++ V    +++FG  E  KR  A   
Sbjct: 226 RADPAKIRSPLVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLE 285

Query: 113 ADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDC 172
                  +   L     Y+ G  GG++  F   PI+ ++ R+Q        R        
Sbjct: 286 G----CGETGELSRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKT 341

Query: 173 IKKLAKA-------KALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEK-GTPRNQIPAW 224
            K + +        + L  G+L     A   LGT+ A     + +     G   N++   
Sbjct: 342 AKDMYREGGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMS 401

Query: 225 KLCSF--GALSGTILWLTVYPVDVVKSVLQTD-SIENPKYKNSIIKATRALYKQHGIPAF 281
            L     GA SGT+    VYP++++++ LQ   +  +P   +      R   ++ G+P  
Sbjct: 402 NLVVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGL 461

Query: 282 FKGFVPTMIRAAPANAATFVSFE 304
           +KG VPT+ +  PA A +++ +E
Sbjct: 462 YKGLVPTLAKVCPAVAISYLCYE 484

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%)

Query: 260 KYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
           K ++ ++KA  +LY+Q G+ AF+ G    +I+  P +A  F SFE+
Sbjct: 231 KIRSPLVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFEL 276

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 10/82 (12%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI------GVIEVVQNLLRNEGALAFYKGML 84
           F+GT+G      V  P +  + RLQ   T        G  +V +  ++ EG    YKG++
Sbjct: 411 FSGTVGAT----VVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLV 466

Query: 85  TPLLGVGICVSVQFGVNESMKR 106
             L  V   V++ +   E++KR
Sbjct: 467 PTLAKVCPAVAISYLCYENLKR 488

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 117/293 (39%), Gaps = 30/293 (10%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGM 83
           K   AG + G  +  +  PF+  K RLQ    +SK     + ++ N  + +G  A Y G 
Sbjct: 12  KSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQGVGAIYVG- 70

Query: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNADR--VDPQKHVPLPLHQYYLCGLTGGVVNS 141
                    C +   G        F  Y+  R  +  +K   L   +  L GL  G++ S
Sbjct: 71  ---------CPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPRGVLAGLGAGLLES 121

Query: 142 FLA-APIEHVRIRLQTQTS------QGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAG 194
            +A  P E ++  L           Q N R     +  + K    + L  G+LP  +R  
Sbjct: 122 VVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQA 181

Query: 195 HGLGTYFAAYEAL-VVKEFEKGTPRNQIPAWKLCSF--GALSGTILWLTVYPVDVVKSVL 251
                    Y  + V+ +   G P+++ P     +F  GA SG +      P+D VK+ +
Sbjct: 182 ANQAVRLGCYNKIKVLVQDYTGAPKDK-PLTSGLTFIVGAFSGVVTVYATMPIDTVKTRM 240

Query: 252 QTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           Q  S+   KY +S +     +YK+ G+  F+KG  P + R   +    F  +E
Sbjct: 241 Q--SLTASKY-SSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYE 290

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 83/201 (41%), Gaps = 33/201 (16%)

Query: 28  KDIFAGTMGGVAQVLVG-QPFDTTKVRLQTSKTKI---------GVIEVVQNLLRNEGAL 77
           + + AG   G+ + +V   PF+  K  L   K  +          +     +L+++EG  
Sbjct: 108 RGVLAGLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFR 167

Query: 78  AFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLT-- 135
             Y G+L         VS++   N++++     YN  +V  Q +   P  +    GLT  
Sbjct: 168 GLYGGVLP--------VSMRQAANQAVR--LGCYNKIKVLVQDYTGAPKDKPLTSGLTFI 217

Query: 136 ----GGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKAL---MRGLLP 188
                GVV  +   PI+ V+ R+Q+ T+     ++    +C   + K + L    +G  P
Sbjct: 218 VGAFSGVVTVYATMPIDTVKTRMQSLTAS----KYSSTLNCFTTIYKEEGLKTFWKGATP 273

Query: 189 TMIRAGHGLGTYFAAYEALVV 209
            + R     G  F  YE +++
Sbjct: 274 RLGRLILSGGIVFTIYENVLL 294

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 118/287 (41%), Gaps = 37/287 (12%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSKT-KIGVIEVVQNLLRNEGALAFYKGMLTPLLGVG 91
           G   G+   +V  P D  KVRLQ +   K  +  +++++L NEG +  Y G+   +L   
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQC 79

Query: 92  ICVSVQFGVNESMKRFFAAYNADRVDPQKHVP-----LPLHQYYLCGLTGGVVNSFLAAP 146
              +V+FG  + +K        + V P++ +      LP   +   G  GG+  +F  A 
Sbjct: 80  TYTTVRFGAYDLLK--------ENVIPREQLTNMAYLLPCSMF--SGAIGGLAGNF--AD 127

Query: 147 IEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK----AKALMRGLLPTMIRA----GHGLG 198
           + ++R++  +       R +K   D + K+ +     K L  G  P M+R        + 
Sbjct: 128 VVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVV 187

Query: 199 TYFAAYEALVVK-EFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIE 257
           TY      LV K +F+       + A        L+G +      P DV+K+ +   S +
Sbjct: 188 TYDVFKNYLVTKLDFDASKNYTHLTA------SLLAGLVATTVCSPADVMKTRIMNGSGD 241

Query: 258 NPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           +      +  A R    + G    F+G++P+  R  P     F + E
Sbjct: 242 HQPALKILADAVR----KEGPSFMFRGWLPSFTRLGPFTMLIFFAIE 284

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 76/183 (41%), Gaps = 15/183 (8%)

Query: 130 YLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPT 189
           +  G   G+  + +  P++  ++RLQ          F+   + I        L  GL   
Sbjct: 17  WWYGGAAGIFATMVTHPLDLAKVRLQA-APMPKPTLFR-MLESILANEGVVGLYSGLSAA 74

Query: 190 MIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIP--AWKL-CSFGALSGTILWLTVYPVDV 246
           ++R        F AY+ L     E   PR Q+   A+ L CS    SG I  L     DV
Sbjct: 75  VLRQCTYTTVRFGAYDLLK----ENVIPREQLTNMAYLLPCSM--FSGAIGGLAGNFADV 128

Query: 247 VKSVLQTDS-IENPK---YKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVS 302
           V   +Q DS +E  K   YKN+I    +    + G+   F G+ P M+R     A+  V+
Sbjct: 129 VNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVT 188

Query: 303 FEM 305
           +++
Sbjct: 189 YDV 191

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 122/290 (42%), Gaps = 24/290 (8%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGM 83
           K   AG + G  +  V  PF+  K RLQ     SK     + ++ N  + +G  + Y G 
Sbjct: 11  KSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIGSVYVGC 70

Query: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFL 143
              ++G      V+F   +++K           DP K   L   +  + GL  G++ S +
Sbjct: 71  PAFIVGNTAKAGVRFLGFDTIKNLLR-------DP-KTGELSGPRGVIAGLGAGLLESVV 122

Query: 144 A-APIEHVRIRL----QTQTSQ--GNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHG 196
           A  P E ++  L    Q+ T +   N +     +  + +      L RG+LP  +R    
Sbjct: 123 AVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAAN 182

Query: 197 LGTYFAAYEAL--VVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTD 254
                  Y  +  +V+++        + +      GA SG +   T  P+D VK+ +Q  
Sbjct: 183 QAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQ-- 240

Query: 255 SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           S+++ +Y +S I     ++K+ G+ AF+KG  P + R   +    F  +E
Sbjct: 241 SLDSKRY-SSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYE 289

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 82/200 (41%), Gaps = 33/200 (16%)

Query: 28  KDIFAGTMGGVAQVLVG-QPFDTTKVRLQTSKTKI---------GVIEVVQNLLRNEGAL 77
           + + AG   G+ + +V   PF+  K  L   K            G++     L+R +G  
Sbjct: 107 RGVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLS 166

Query: 78  AFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLT-- 135
             Y+G+L         VS++   N++++     YN  +V  Q +   P  +    GLT  
Sbjct: 167 GLYRGVLP--------VSMRQAANQAVR--LGCYNKIKVMVQDYTNAPKDKPLSSGLTFV 216

Query: 136 ----GGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLP 188
                G+V  +   PI+ V+ R+Q+  S    +++    +C   + K    KA  +G  P
Sbjct: 217 VGAFSGIVTVYTTMPIDTVKTRMQSLDS----KRYSSTINCFTTIFKEEGLKAFWKGATP 272

Query: 189 TMIRAGHGLGTYFAAYEALV 208
            + R     G  F  YE ++
Sbjct: 273 RLGRLFLSGGIVFTVYEKVL 292

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 124/311 (39%), Gaps = 39/311 (12%)

Query: 13  ELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQT--SKTKIGVIEVVQNL 70
           + E +P   P   +   + AG   G+A+  V  P D  K RLQ   + +  G   +   +
Sbjct: 8   DYEALPDHAP---LAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTM 64

Query: 71  LRN-------EGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVP 123
           LR        EG++  +KG+ + LLG G   +V F   E +K F        +D      
Sbjct: 65  LRQLSSISAQEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFL-------IDEATSTS 117

Query: 124 -LPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKAL 182
                +    G T  +    L  P + ++ R+Q  T+          +D  K++   +  
Sbjct: 118 KYHFFKTAFSGATATIAADALMNPFDVIKQRIQLNTN-------ISVWDTAKRIYSKEGF 170

Query: 183 --MRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKG-TPRNQIPAWKLCSFGALSGTILWL 239
                  PT +     +   FAA+   +     +   P      +  C  G +SG     
Sbjct: 171 QAFYSSYPTTL----AINIPFAAFNFGIYDTATRYFNPSGVYNPFIHCLCGGISGAACAG 226

Query: 240 TVYPVDVVKSVLQTD-----SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
              P+D +K+ LQ       S+E  K  ++  KATRA+Y+ +G   F+ G  P ++   P
Sbjct: 227 LTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMP 286

Query: 295 ANAATFVSFEM 305
           A A ++ ++E 
Sbjct: 287 ATAISWTAYEF 297

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 82/210 (39%), Gaps = 21/210 (10%)

Query: 5   FPTPQLLNE-LEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGV 63
           F T +++   L D    T      K  F+G    +A   +  PFD  K R+Q + T I V
Sbjct: 99  FATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAADALMNPFDVIKQRIQLN-TNISV 157

Query: 64  IEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRV-DPQKHV 122
            +  + +   EG  AFY    T L       +  FG+ ++  R+F   N   V +P  H 
Sbjct: 158 WDTAKRIYSKEGFQAFYSSYPTTLAINIPFAAFNFGIYDTATRYF---NPSGVYNPFIHC 214

Query: 123 PLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA--- 179
                   LCG   G   + L  P++ ++  LQ + S+    +     D  KK  +A   
Sbjct: 215 --------LCGGISGAACAGLTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQ 266

Query: 180 ----KALMRGLLPTMIRAGHGLGTYFAAYE 205
               +    G+ P ++         + AYE
Sbjct: 267 VYGWRGFWSGVKPRILANMPATAISWTAYE 296

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 85/200 (42%), Gaps = 21/200 (10%)

Query: 112 NADRVDPQ---KHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKG 168
           ++D +D +    H PL  HQ  + G   G+    +  P++ ++ RLQ   +         
Sbjct: 3   SSDVIDYEALPDHAPLA-HQL-MAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPI 60

Query: 169 PFDCIKKLAKAKA------LMRGLLPTMIRAGHGLGTYFAAYEALVVKEF--EKGTPRNQ 220
           P   +++L+   A      L +G+   ++ AG     YFA YE  +VK F  ++ T  ++
Sbjct: 61  PSTMLRQLSSISAQEGSMVLWKGVQSVLLGAGPAHAVYFATYE--MVKSFLIDEATSTSK 118

Query: 221 IPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPA 280
              +K    GA +       + P DV+K  +Q ++        S+    + +Y + G  A
Sbjct: 119 YHFFKTAFSGATATIAADALMNPFDVIKQRIQLNT------NISVWDTAKRIYSKEGFQA 172

Query: 281 FFKGFVPTMIRAAPANAATF 300
           F+  +  T+    P  A  F
Sbjct: 173 FYSSYPTTLAINIPFAAFNF 192

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/334 (22%), Positives = 134/334 (40%), Gaps = 66/334 (19%)

Query: 23  YGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSK--------TKIGVIEVVQNLLRNE 74
           +  +V+   AG + G     +  P D  K+  QTS         + IG++E  +++  N+
Sbjct: 30  FDYIVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWIND 89

Query: 75  GALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGL 134
           G   F++G    LL +    +V+F   E ++        + + P K       +  + G 
Sbjct: 90  GVRGFFQGHSATLLRIFPYAAVKFVAYEQIR--------NTLIPSKEFESHWRR-LVSGS 140

Query: 135 TGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA------------- 181
             G+ + F+  P++ VR+RL  +T     +  +     IKK+ K  A             
Sbjct: 141 LAGLCSVFITYPLDLVRVRLAYETEHKRVKLGR----IIKKIYKEPASATLIKNDYIPNW 196

Query: 182 ------LMRGLLPTMI----RAG-----HGL------GTYFAAYEALVVKEFE-----KG 215
                   RG +PT++     AG     H L        +FA Y  L + E +     + 
Sbjct: 197 FCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQK 256

Query: 216 TPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPK--YKN---SIIKATR 270
             R  +  W     G L+G       YP ++++  LQ  ++ +PK  Y +   SI +   
Sbjct: 257 KQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSAL-SPKTMYDHKFQSISEIAH 315

Query: 271 ALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
            ++K+ G+  FF G     I+  P  A +F  +E
Sbjct: 316 IIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYE 349

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 84/201 (41%), Gaps = 38/201 (18%)

Query: 133 GLTGGVVNSF---LAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK-------AKAL 182
           GL GG+  S    L AP++  RI++  QTS  +  ++ G    + + AK        +  
Sbjct: 37  GLAGGISGSCAKTLIAPLD--RIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGF 94

Query: 183 MRGLLPTMIRAGHGLGTYFAAYEALV-----VKEFEKGTPRNQIPAWKLCSFGALSGTIL 237
            +G   T++R        F AYE +       KEFE          W+    G+L+G   
Sbjct: 95  FQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFES--------HWRRLVSGSLAGLCS 146

Query: 238 WLTVYPVDVVKSVLQTDSIENPKYKNSIIK------ATRALYKQHGIPA-------FFKG 284
               YP+D+V+  L  ++         IIK      A+  L K   IP        F++G
Sbjct: 147 VFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRG 206

Query: 285 FVPTMIRAAPANAATFVSFEM 305
           +VPT++   P    +F + ++
Sbjct: 207 YVPTVLGMIPYAGVSFFAHDL 227

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 9/93 (9%)

Query: 25  RVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS----KTKI-----GVIEVVQNLLRNEG 75
           R   ++ +G + G+A      PF+  + RLQ S    KT        + E+   + +  G
Sbjct: 263 RTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERG 322

Query: 76  ALAFYKGMLTPLLGVGICVSVQFGVNESMKRFF 108
              F+ G+    + V   V+  F V E MK  F
Sbjct: 323 VRGFFVGLSIGYIKVTPMVACSFFVYERMKWNF 355

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 130/298 (43%), Gaps = 35/298 (11%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGMLTPL 87
           AG +GG     V  P +  K+ LQ    T+    G++  V+ + + EG    ++G     
Sbjct: 22  AGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINC 81

Query: 88  LGVGICVSVQFGVNESMK-RFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAP 146
           L +    +VQ+ V E  K R F       V    H  L   +  + G  GG  +  +  P
Sbjct: 82  LRIFPYSAVQYAVYEFCKTRVF------HVGQSGHEQLRSWERLVGGALGGGASVLVTYP 135

Query: 147 IEHVRIRLQTQTSQ---------GNERQFKGPFDCIKKLAKA----KALMRGLLPTMIRA 193
           ++ VR RL  QT+           + R+  G  + ++++ +     +   RG+ PT +  
Sbjct: 136 LDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGV 195

Query: 194 GHGLGTYFAAYE---ALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSV 250
              +   FA YE   AL+  +++ G+    + A KL + GA+SG I    VYP D+++  
Sbjct: 196 VPFVALNFALYERLKALIPHDYDAGS----VAAAKL-AIGAVSGGIAQTVVYPFDLLRRR 250

Query: 251 LQTDSIENPKYKNSIIKATRALY---KQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
            Q  ++   +          AL+   +Q G+  ++KG    +++  PA A  +  +E+
Sbjct: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 84/190 (44%), Gaps = 17/190 (8%)

Query: 130 YLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK---AKALMRGL 186
           ++ G  GG V+  + +P+E V+I LQ Q+S        G    +K++ K    K L RG 
Sbjct: 20  FVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYN--GGLVHAVKQVYKEEGVKGLFRGN 77

Query: 187 LPTMIRAGHGLGTYFAAYEALVVKEFEKG-TPRNQIPAWKLCSFGALSGTILWLTVYPVD 245
               +R        +A YE    + F  G +   Q+ +W+    GAL G    L  YP+D
Sbjct: 78  GINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLD 137

Query: 246 VVKSVLQTDSIENPKYKNS----------IIKATRALYKQH-GIPAFFKGFVPTMIRAAP 294
           +V++ L   +    K   S          I++  R ++++  G+  +++G  PT +   P
Sbjct: 138 LVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVP 197

Query: 295 ANAATFVSFE 304
             A  F  +E
Sbjct: 198 FVALNFALYE 207

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 77/188 (40%), Gaps = 31/188 (16%)

Query: 42  LVGQPFDTTKVRLQTSKTKI---------------GVIEVVQNLLRNEGAL-AFYKGMLT 85
           LV  P D  + RL      +               G++E+++ + R EG L  +Y+G+  
Sbjct: 131 LVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYP 190

Query: 86  PLLGVGICVSVQFGVNESMKRFF-AAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA 144
             LGV   V++ F + E +K      Y+A  V   K          +  ++GG+  + + 
Sbjct: 191 TSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLA--------IGAVSGGIAQT-VV 241

Query: 145 APIEHVRIRLQTQTSQGNERQFK--GPFDCIKKLAKAKAL---MRGLLPTMIRAGHGLGT 199
            P + +R R Q  T   +E  F+     D +  + + + L    +GL   +++    +  
Sbjct: 242 YPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301

Query: 200 YFAAYEAL 207
            +  YE +
Sbjct: 302 QWFVYELI 309

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 124/300 (41%), Gaps = 40/300 (13%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK------IGVIEVVQNLLRNEGALAFYK 81
           K + AG + G+    +  P DT K+RLQ +           V+EV +++++NEG  +F+K
Sbjct: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G +   L      S QF       R+   +  +           LH   + G   G+ +S
Sbjct: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE---------ARLHS-LVVGAFAGITSS 127

Query: 142 FLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYF 201
            ++ P + +R RL    +Q +          I KL       +G + +M          F
Sbjct: 128 IVSYPFDVLRTRL-VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMF 186

Query: 202 AAYEALVV--KEFEKGTPRNQIPAWKLCSF----GALSGTILWLTVYPVDVVKSVLQ--- 252
             YE + +   E EK T  ++   W+L +     G + G I  +  +P++ ++  +Q   
Sbjct: 187 GTYETIRIYCDENEKTTAAHK--KWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMN 244

Query: 253 TDSIENPKYKNSIIKATRA---------LYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303
           +  +E     +S+  + +          + KQ G+ + ++G +  + +  P    TFVSF
Sbjct: 245 SKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP---TTFVSF 301

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 85/183 (46%), Gaps = 22/183 (12%)

Query: 131 LCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDC-IKKLAKA-------KAL 182
           L G   G++   + AP++ ++IRLQ   + G +     PF   + ++A++       ++ 
Sbjct: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLK-----PFGSQVMEVARSMIKNEGIRSF 75

Query: 183 MRGLLP-TMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTV 241
            +G +P +++   +G    F++Y +L  +     TP            GA +G    +  
Sbjct: 76  WKGNIPGSLLYVTYG-SAQFSSY-SLFNRYL---TPFGLEARLHSLVVGAFAGITSSIVS 130

Query: 242 YPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFV 301
           YP DV+++ L  +   N  +  SI +  R ++K  G+P FFKG + +M       +  F 
Sbjct: 131 YPFDVLRTRLVAN---NQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFG 187

Query: 302 SFE 304
           ++E
Sbjct: 188 TYE 190

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 210 KEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPK-YKNSIIKA 268
           KE +       + AWK    GA+SG +      P+D +K  LQ       K + + +++ 
Sbjct: 3   KEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEV 62

Query: 269 TRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
            R++ K  GI +F+KG +P  +      +A F S+ +
Sbjct: 63  ARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSL 99

>Scas_589.10
          Length = 316

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/322 (22%), Positives = 122/322 (37%), Gaps = 51/322 (15%)

Query: 11  LNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ---------TSKTKI 61
           +  ++  P   P+   +    +G + G+++ ++  P D  K R Q         TS   +
Sbjct: 1   MARIDKDPVKLPF---IYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAV 57

Query: 62  -------GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNES-----MKRFFA 109
                   ++  +  +L+ EG    YKGM  PLL      +V+F  NE      MK+F  
Sbjct: 58  PKQPEHSSILSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKL 117

Query: 110 AYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGP 169
                 V              L G   G+  S +  P E V+IRLQ   S      ++ P
Sbjct: 118 KEVTSTVT------------LLAGTFAGITESLIVVPFELVKIRLQDAQS-----DYRSP 160

Query: 170 FDCIKKLAKAKALM---RGLLPTMIRAGHGLGTYFAAYEALVVKEF---EKGTPRNQIPA 223
             C + + + + L     G   T+ R      +YF       VK+F    K T + Q   
Sbjct: 161 IRCTRTIIENQGLFGIYAGFESTIWRNTIWNASYFGL--IFQVKKFIPRAKSTTKFQGIR 218

Query: 224 WKLCSFGALSGTILWLTVYPVDVVKSVLQ-TDSIENPKYKNSIIKATRALYKQHGIPAFF 282
                 GA++G +      P DVVK+ +Q +    +        ++   +Y+  GI   +
Sbjct: 219 NDFL-VGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIY 277

Query: 283 KGFVPTMIRAAPANAATFVSFE 304
           KG +P + R  P      V F 
Sbjct: 278 KGILPIICRYGPGGGLLLVVFN 299

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 78/188 (41%), Gaps = 22/188 (11%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI-GVIEVVQNLLRNEGALAFYKGMLTPLL 88
           + AGT  G+ + L+  PF+  K+RLQ +++     I   + ++ N+G    Y G  + + 
Sbjct: 126 LLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIW 185

Query: 89  GVGICVSVQFGVNESMKRFF------AAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSF 142
              I  +  FG+   +K+F         +   R D            +L G   G ++ F
Sbjct: 186 RNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRND------------FLVGAIAGCMSCF 233

Query: 143 LAAPIEHVRIRLQTQTSQGNERQFKGPFDC---IKKLAKAKALMRGLLPTMIRAGHGLGT 199
           L+ P + V+ R+Q      +   +   +     I +    K + +G+LP + R G G G 
Sbjct: 234 LSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGL 293

Query: 200 YFAAYEAL 207
               +  +
Sbjct: 294 LLVVFNGV 301

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 43/93 (46%), Gaps = 12/93 (12%)

Query: 21  TPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS-KTKIGVI-----EVVQNLLRNE 74
           T +  +  D   G + G     +  PFD  K R+Q S KT  G+      + V  + R E
Sbjct: 212 TKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTE 271

Query: 75  GALAFYKGMLTPLL-----GVGICVSVQFGVNE 102
           G    YKG+L P++     G G+ + V  GVNE
Sbjct: 272 GIKGIYKGIL-PIICRYGPGGGLLLVVFNGVNE 303

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/294 (21%), Positives = 118/294 (40%), Gaps = 25/294 (8%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPL 87
             + AG++ G+       P DT K++LQ +        V+ N+L+ EG   F+KG +   
Sbjct: 17  NSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGFWKGNVPGS 75

Query: 88  LGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPI 147
           +   I    QFG    +  F        + PQ +  L        G   G+ +S  + P 
Sbjct: 76  IMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCL-------VGSLAGMTSSLASYPF 128

Query: 148 EHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEAL 207
           + +R R     SQG   + +     I           G   +MI  G      F  YE++
Sbjct: 129 DVLRTRFAAN-SQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESI 187

Query: 208 VVKEFEKGTPRNQIPAWKLCS--FGALSGTILWLTVYPVDVVKSVLQTDSIENPK----- 260
            +   E+    ++   + L +   G +SG    L  +P+D V+  +Q  +  N +     
Sbjct: 188 KIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDRE 247

Query: 261 --------YKNS-IIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
                   YKN   +    ++ +Q G  + ++G   ++I++ P+ A +  S+E+
Sbjct: 248 FTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/268 (23%), Positives = 121/268 (45%), Gaps = 34/268 (12%)

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
           G +E ++ + + EG    ++G     LG+ + ++V   V      +F+ Y A R +    
Sbjct: 82  GTLEGLRKIAQLEGLPTLWRG-----LGITLVMAVPANVV-----YFSGYEALRDNSPLA 131

Query: 122 VPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQT-QTSQGNERQFKGPFDCIKKLAKA- 179
             LP+    +CG    ++ +   AP+E +R RLQ+   ++  ER      D ++++    
Sbjct: 132 SRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEV 191

Query: 180 -----KALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWK--LCSF--G 230
                +AL +GL  T+ R       Y+  YE    + + +    +    W   + SF  G
Sbjct: 192 SVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACG 251

Query: 231 ALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATR------------ALYKQHGI 278
           ++ G +  L  +P DV K+ +Q  +I +P+      KAT+            A+ K  GI
Sbjct: 252 SMGGAVAALLTHPFDVGKTRMQI-AIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGI 310

Query: 279 PAFFKGFVPTMIRAAPANAATFVSFEMT 306
            A + G +P +++ AP+ A    ++E++
Sbjct: 311 RALYTGLLPRVMKIAPSCAIMISTYELS 338

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 47/123 (38%), Gaps = 16/123 (13%)

Query: 4   EFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS------ 57
           EF   Q           + +   +     G+MGG    L+  PFD  K R+Q +      
Sbjct: 222 EFCKTQFWARHAATHNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQ 281

Query: 58  ------KTKI----GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRF 107
                  TK     G+   +  + ++EG  A Y G+L  ++ +    ++     E  K+F
Sbjct: 282 LTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKF 341

Query: 108 FAA 110
           F +
Sbjct: 342 FTS 344

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 84/207 (40%), Gaps = 43/207 (20%)

Query: 136 GGVVNSFLAAPIEHVRIRLQTQ------TSQGN-----------------------ERQF 166
           G +V S    P++ VR+RL  Q      T  G                          + 
Sbjct: 21  GSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGCREPAARL 80

Query: 167 KGPFDCIKKLAKAKA---LMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTP-RNQIP 222
           +G  + ++K+A+ +    L RGL  T++ A      YF+ YEAL        +P  +++P
Sbjct: 81  QGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEAL-----RDNSPLASRLP 135

Query: 223 AWKLCSFGALSGTILWLTVYPVDVVKSVLQT-----DSIENPKYKNSIIKATRALYKQHG 277
                  GA +  +   T+ P++++++ LQ+     D+         +++  R      G
Sbjct: 136 VANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMG 195

Query: 278 IPAFFKGFVPTMIRAAPANAATFVSFE 304
             A FKG   T+ R  P +A  + ++E
Sbjct: 196 YRALFKGLEITLWRDVPFSAIYWGTYE 222

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 62.8 bits (151), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 92/213 (43%), Gaps = 23/213 (10%)

Query: 9   QLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS------KTKIG 62
           QL+  LE V   +   +    I AG MGGV       P DT K R+Q +      K    
Sbjct: 299 QLMAHLEGVHHTSELSKFSTYI-AGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNEL 357

Query: 63  VIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNA-------DR 115
           +I   + + R+ G   FY+G+   ++G+    ++  G   ++K+++ A  A       D+
Sbjct: 358 LISTARQMYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQ 417

Query: 116 VDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKK 175
           V     + LP+      G   G V + +  PI  +R RLQ Q +  +   + G  D + K
Sbjct: 418 VTISNFIVLPM------GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWK 471

Query: 176 LAKA---KALMRGLLPTMIRAGHGLGTYFAAYE 205
             +    + L +GL+P + +    +   +  YE
Sbjct: 472 TVQREGYQGLFKGLVPNLAKVCPAVSISYLCYE 504

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 122/310 (39%), Gaps = 43/310 (13%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRL------------------------QTSKTKIGVIEVV 67
           AG   GV       PFD  KV L                          SK K  +I+  
Sbjct: 201 AGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIKAA 260

Query: 68  QNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVP-LPL 126
             L R  G  AFY G    ++ V    +++FG  E  K+  A      ++   H   L  
Sbjct: 261 TTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMA-----HLEGVHHTSELSK 315

Query: 127 HQYYLCGLTGGVVNSFLAAPIEHVRIRLQ----TQTSQGNERQFKGPFDCIKKLAKAKAL 182
              Y+ G  GGVV  F   PI+ ++ R+Q        +GNE          +     K  
Sbjct: 316 FSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRD-GGLKLF 374

Query: 183 MRGLLPTMI----RAGHGLGTYFAAYEALVVKEFE-KGTPRNQ--IPAWKLCSFGALSGT 235
            RG+   ++     A   LGT+ A  +  + ++ +  G P +Q  I  + +   GA SGT
Sbjct: 375 YRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGT 434

Query: 236 ILWLTVYPVDVVKSVLQTD-SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
           +    VYP++++++ LQ   +  +P              ++ G    FKG VP + +  P
Sbjct: 435 VGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCP 494

Query: 295 ANAATFVSFE 304
           A + +++ +E
Sbjct: 495 AVSISYLCYE 504

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 44/95 (46%), Gaps = 19/95 (20%)

Query: 230 GALSGTILWLTVYPVDVVKSVL--QTDS------------IENP-----KYKNSIIKATR 270
           G  SG I      P D +K  L  +TD             ++NP     K K+ +IKA  
Sbjct: 202 GGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIKAAT 261

Query: 271 ALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
            LY+Q GI AF+ G    +I+  P +A  F SFE+
Sbjct: 262 TLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFEL 296

 Score = 35.0 bits (79), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 35/180 (19%), Positives = 74/180 (41%), Gaps = 24/180 (13%)

Query: 129 YYLCGLTGGVVNSFLAAPIEHVRIRLQTQT-------SQGNERQFKGPFDCIKKLAK--- 178
           +++ G   GV++    AP + +++ L  +T       +  ++   K P   I K+     
Sbjct: 198 FFIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLI 257

Query: 179 --AKALMRGLLPTMIRAGHGLGTY---------FAAYE--ALVVKEFEKGTPRNQIPAWK 225
             A  L R         G+GL            F ++E    ++   E     +++  + 
Sbjct: 258 KAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFS 317

Query: 226 LCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKAT-RALYKQHGIPAFFKG 284
               G + G +   +VYP+D +K  +Q   ++     N ++ +T R +Y+  G+  F++G
Sbjct: 318 TYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRG 377

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 10/83 (12%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTS------KTKIGVIEVVQNLLRNEGALAFYKGML 84
           F+GT+G      V  P +  + RLQ         T  G  +V+   ++ EG    +KG++
Sbjct: 431 FSGTVGAT----VVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLV 486

Query: 85  TPLLGVGICVSVQFGVNESMKRF 107
             L  V   VS+ +   E+ KR 
Sbjct: 487 PNLAKVCPAVSISYLCYENFKRL 509

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 62.8 bits (151), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 127/310 (40%), Gaps = 43/310 (13%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVI-------------------------EV 66
           AG + GV       PFD  KV L  ++T +  I                         + 
Sbjct: 233 AGGISGVISRTCTAPFDRLKVFL-IARTDLSSILLNSKTDLLAKNPNADINKISSPLAKA 291

Query: 67  VQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPL 126
           V++L R  G  AFY G    ++ V    S++FG  E  K+        R D +    L  
Sbjct: 292 VKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCR-DTK---DLSK 347

Query: 127 HQYYLCGLTGGVVNSFLAAPIEHVRIRLQ----TQTSQGNERQFKGPFDCIKKLAKAKAL 182
              Y+ G   G+   F   PI+ ++ R+Q        +GN   F+   D  ++    +  
Sbjct: 348 FSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFRE-GGLRLF 406

Query: 183 MRGLLPTMI----RAGHGLGTYFAAYEALVVKEFEK-GTPRNQIPAWKLCSF--GALSGT 235
            RG+   ++     A   LGT+ A  +  + K+ +    P++Q+    L     GA SGT
Sbjct: 407 YRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGT 466

Query: 236 ILWLTVYPVDVVKSVLQTD-SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
           +    VYP++++++ LQ   +  +P   N          ++ G    FKG VPT+ +  P
Sbjct: 467 VGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCP 526

Query: 295 ANAATFVSFE 304
           A + +++ +E
Sbjct: 527 AVSISYLCYE 536

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 94/211 (44%), Gaps = 11/211 (5%)

Query: 7   TPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS--KTKIG-- 62
           T +++ +LE         +    I  G  G  AQ  V  P DT K R+Q +   TK+   
Sbjct: 329 TKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMAAQFSV-YPIDTLKFRVQCAPLDTKLKGN 387

Query: 63  --VIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVD-PQ 119
             + +  +++ R  G   FY+G+   ++G+    ++  G   ++K+++ A  A  ++ PQ
Sbjct: 388 NLLFQTAKDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQ 447

Query: 120 KHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA 179
             V L        G   G V + +  PI  +R RLQ Q +  +   + G  D + K  + 
Sbjct: 448 DQVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLER 507

Query: 180 ---KALMRGLLPTMIRAGHGLGTYFAAYEAL 207
              + L +GL+PT+ +    +   +  YE L
Sbjct: 508 EGYQGLFKGLVPTLAKVCPAVSISYLCYENL 538

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 46/96 (47%), Gaps = 19/96 (19%)

Query: 230 GALSGTILWLTVYPVDVVKSVL-------------QTDSI-ENP-----KYKNSIIKATR 270
           G +SG I      P D +K  L             +TD + +NP     K  + + KA +
Sbjct: 234 GGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVK 293

Query: 271 ALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMT 306
           +LY+Q GI AF+ G    +I+  P ++  F SFE+T
Sbjct: 294 SLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVT 329

 Score = 35.4 bits (80), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 41/199 (20%), Positives = 82/199 (41%), Gaps = 24/199 (12%)

Query: 129 YYLCGLTGGVVNSFLAAPIEHVRIRLQTQT-------SQGNERQFKGPFDCIKK----LA 177
           +++ G   GV++    AP + +++ L  +T       +   +   K P   I K    LA
Sbjct: 230 FFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLA 289

Query: 178 KA-KALMRGLLPTMIRAGHGLGTY---------FAAYEAL--VVKEFEKGTPRNQIPAWK 225
           KA K+L R         G+GL            F ++E    ++ + E       +  + 
Sbjct: 290 KAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFS 349

Query: 226 LCSFGALSGTILWLTVYPVDVVKSVLQTDSIENP-KYKNSIIKATRALYKQHGIPAFFKG 284
               G L+G     +VYP+D +K  +Q   ++   K  N + +  + ++++ G+  F++G
Sbjct: 350 TYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYRG 409

Query: 285 FVPTMIRAAPANAATFVSF 303
               ++   P  A    +F
Sbjct: 410 VTVGIVGIFPYAALDLGTF 428

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 10/83 (12%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI------GVIEVVQNLLRNEGALAFYKGML 84
           F+GT+G      V  P +  + RLQ   T        G  +V+   L  EG    +KG++
Sbjct: 463 FSGTVGAS----VVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLV 518

Query: 85  TPLLGVGICVSVQFGVNESMKRF 107
             L  V   VS+ +   E++K+F
Sbjct: 519 PTLAKVCPAVSISYLCYENLKKF 541

>Kwal_14.2210
          Length = 315

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 123/298 (41%), Gaps = 39/298 (13%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGMLTPL 87
           AG + G     V  PF+  K+ LQ    T     G+   V+ +   EG     +G     
Sbjct: 23  AGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGNGLNC 82

Query: 88  LGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAA-P 146
           + +    +VQF V E  K+ +   N D V       L  H+     L GG   S LA  P
Sbjct: 83  IRIFPYSAVQFLVYEFCKKQWFQQNPDTV------VLNWHRLVSGALCGGC--SVLATYP 134

Query: 147 IEHVRIRLQTQTSQGNERQFK---------GPFDCIKKLAKAKA----LMRGLLPTMIRA 193
           ++ VR RL  QT+                 G ++ ++K    +     L RG+ PT I  
Sbjct: 135 LDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGV 194

Query: 194 GHGLGTYFAAYEALVVKEFEKGTPRNQIPA----WKLCSFGALSGTILWLTVYPVDVVKS 249
              +   FA YE L  +E+    P +  PA    +KL S GA+SG +     YP D+++ 
Sbjct: 195 VPYVALNFAVYEQL--REY---IPASFDPASASLYKL-SIGAISGGVAQTITYPFDLLRR 248

Query: 250 VLQTDSIENPK---YKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
             Q  ++   +   +  S+  A   + +  G   ++KG    + +  P+ A ++V +E
Sbjct: 249 RFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYE 306

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 74/189 (39%), Gaps = 17/189 (8%)

Query: 130 YLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA---LMRGL 186
           +  G   G V+  + +P E V+I LQ Q+S        G F  +K++   +    L+RG 
Sbjct: 21  FCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNH--GLFRAVKQVYLEEGVPGLLRGN 78

Query: 187 LPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDV 246
               IR        F  YE    K++ +  P   +  W     GAL G    L  YP+D+
Sbjct: 79  GLNCIRIFPYSAVQFLVYE-FCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPLDL 137

Query: 247 VKSVLQTDSIENPKYKN----------SIIKATRALYKQH-GIPAFFKGFVPTMIRAAPA 295
           V++ L   +    +              + +  R  Y Q  GI   ++G  PT I   P 
Sbjct: 138 VRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPY 197

Query: 296 NAATFVSFE 304
            A  F  +E
Sbjct: 198 VALNFAVYE 206

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 61/153 (39%), Gaps = 24/153 (15%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------------GVIEVVQNLLRNE 74
           + +G + G   VL   P D  + RL      +               GV E+++     E
Sbjct: 118 LVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQE 177

Query: 75  GAL-AFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCG 133
           G +   Y+G+    +GV   V++ F V E ++ +  A      DP       L++  +  
Sbjct: 178 GGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPA----SFDPAS---ASLYKLSIGA 230

Query: 134 LTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQF 166
           ++GGV  + +  P + +R R Q      +E  F
Sbjct: 231 ISGGVAQT-ITYPFDLLRRRFQVLAMGQSELGF 262

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 9/80 (11%)

Query: 36  GGVAQVLVGQPFDTTKVRLQT---SKTKIG-----VIEVVQNLLRNEGALAFYKGMLTPL 87
           GGVAQ +   PFD  + R Q     ++++G     V + +  + R EG   +YKG+   L
Sbjct: 233 GGVAQTIT-YPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANL 291

Query: 88  LGVGICVSVQFGVNESMKRF 107
             V    +V + V E+++ +
Sbjct: 292 FKVVPSTAVSWVVYETVRDY 311

>Scas_489.4
          Length = 297

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/287 (22%), Positives = 115/287 (40%), Gaps = 24/287 (8%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGMLTP 86
            AG + G  +  +  PF+  K RLQ    TS      + ++ N  + +G  A Y G    
Sbjct: 15  IAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIYVGCPAF 74

Query: 87  LLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA-A 145
           ++G      ++F   +++K        D V  +   P    +  + GL  G++ S +A  
Sbjct: 75  IVGNTAKAGIRFLGFDTIKNML----RDPVTGELSGP----RGVVAGLGAGLLESVVAVT 126

Query: 146 PIEHVRIRLQTQTS------QGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGT 199
           P E ++  L           Q N R     +  + +      L RG+LP  +R       
Sbjct: 127 PFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAANQAV 186

Query: 200 YFAAYEAL--VVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIE 257
               Y  +  +V+++        + +      GA SG +   T  P+D VK+ +Q  S++
Sbjct: 187 RLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQ--SLD 244

Query: 258 NPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
             KY  S +     ++K+ G+  F+KG  P + R   +    F  +E
Sbjct: 245 ATKY-TSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYE 290

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 82/195 (42%), Gaps = 21/195 (10%)

Query: 28  KDIFAGTMGGVAQVLVG-QPFDTTKVRLQTSKTKI---------GVIEVVQNLLRNEGAL 77
           + + AG   G+ + +V   PF+  K  L   K  +         G++    +L+R++G +
Sbjct: 108 RGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIM 167

Query: 78  AFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGG 137
             Y+G+L   +      +V+ G    +K     Y     +  K  PL     ++ G   G
Sbjct: 168 GLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYT----NAPKDRPLSSGLTFIVGAFSG 223

Query: 138 VVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKAL---MRGLLPTMIRAG 194
           VV  +   PI+ V+ R+Q+     +  ++    +C  K+ K + L    +G  P + R  
Sbjct: 224 VVTVYTTMPIDTVKTRMQSL----DATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLI 279

Query: 195 HGLGTYFAAYEALVV 209
              G  F  YE ++V
Sbjct: 280 LSGGIVFTIYENVLV 294

 Score = 34.7 bits (78), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 78/183 (42%), Gaps = 17/183 (9%)

Query: 125 PLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQ--TQTSQGNERQFKGPFDCIKKLAKAK-- 180
           PLH + + G   G + + +  P E  + RLQ   +TS  +    + P   I   AK +  
Sbjct: 10  PLHSF-IAGALAGAIEASITYPFEFAKTRLQLIDKTSTAS----RNPLVLIYNTAKTQGT 64

Query: 181 -ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGA-LSGTILW 238
            A+  G    ++      G  F  ++ +     +  T     P   +   GA L  +++ 
Sbjct: 65  GAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGELSGPRGVVAGLGAGLLESVVA 124

Query: 239 LTVYPVDVVKSVLQTDSIE-NPKYKNS---IIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
           +T  P + +K+ L  D     PKY+N+   +++   +L +  GI   ++G +P  +R A 
Sbjct: 125 VT--PFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAA 182

Query: 295 ANA 297
             A
Sbjct: 183 NQA 185

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/324 (20%), Positives = 126/324 (38%), Gaps = 56/324 (17%)

Query: 26  VVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--------GVIEVVQNLLRNEGAL 77
           +VK   AG + G     +  P D  K+  QTS  +         G++   + ++ ++G  
Sbjct: 19  IVKSGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPR 78

Query: 78  AFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYY----LCG 133
            F++G    LL +    +++F   E ++                +P   H+ +    L G
Sbjct: 79  GFFQGHSATLLRIFPYAAIKFIAYEQIRSVV-------------IPTWRHESHWRRLLSG 125

Query: 134 LTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFK--------GPFDCIKK------LAKA 179
              G+ + F+  P++ VR+RL   T + + +  K         P + ++K       A  
Sbjct: 126 SLAGLCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHW 185

Query: 180 KALMRGLLPTMIRAGHGLGTYFAAYEAL-------VVKEFEKGTPRNQ--------IPAW 224
               RG  PT+I      G  F A++         +++ +   +P           +  W
Sbjct: 186 SNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTW 245

Query: 225 KLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKN--SIIKATRALYKQHGIPAFF 282
                G L+G       YP ++++  LQ  +I +P  ++   I +  + +Y + G   FF
Sbjct: 246 AQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFF 305

Query: 283 KGFVPTMIRAAPANAATFVSFEMT 306
            G     I+  P  A +F  +E T
Sbjct: 306 VGLSIGYIKVTPMVACSFFIYERT 329

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/289 (21%), Positives = 124/289 (42%), Gaps = 28/289 (9%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGMLTP 86
            AG++ G A+  +  PF+  K RLQ     SK     + ++    + +G  + Y G    
Sbjct: 17  LAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVGCPAF 76

Query: 87  LLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA-A 145
           ++G      ++F   +++K          +   + V        + GL  G++ S  A  
Sbjct: 77  IIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGV--------IAGLGAGLLESVAAVT 128

Query: 146 PIEHVRIRL----QTQTSQ--GNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGT 199
           P E ++  L    Q+ T +   N R     +  + +      L RG+LP  +R       
Sbjct: 129 PFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAV 188

Query: 200 YFAAYEAL--VVKEFEKGTPRNQIPAWKLCSF--GALSGTILWLTVYPVDVVKSVLQTDS 255
               Y  +  +++++   +P+++ P     +F  GA SG +   +  P+D VK+ +Q  S
Sbjct: 189 RLGCYNKIKTLIQDYTD-SPKDK-PLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQ--S 244

Query: 256 IENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           +++ KY +S +     ++K+ G+  F+KG  P + R   +    F  +E
Sbjct: 245 LDSTKY-SSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYE 292

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 79/196 (40%), Gaps = 23/196 (11%)

Query: 26  VVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------GVIEVVQNLLRNEGA 76
           V+  + AG +  VA V    PF+  K  L   K            GV+    +L+R++G 
Sbjct: 112 VIAGLGAGLLESVAAV---TPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGF 168

Query: 77  LAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTG 136
              Y+G+L   +      +V+ G    +K     Y     D  K  PL     +L G   
Sbjct: 169 SGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYT----DSPKDKPLSSGLTFLVGAFS 224

Query: 137 GVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKAL---MRGLLPTMIRA 193
           G+V  +   P++ V+ R+Q+  S     ++    +C   + K + L    +G  P + R 
Sbjct: 225 GIVTVYSTMPLDTVKTRMQSLDST----KYSSTMNCFATIFKEEGLKTFWKGATPRLGRL 280

Query: 194 GHGLGTYFAAYEALVV 209
               G  F  YE ++V
Sbjct: 281 VLSGGIVFTIYEKVLV 296

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 74/181 (40%), Gaps = 13/181 (7%)

Query: 125 PLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---A 181
           PLH + L G   G   + +  P E  + RLQ        +  + P   I K AK +   +
Sbjct: 12  PLHSF-LAGSLAGAAEACITYPFEFAKTRLQLIDKA--SKASRNPLVLIYKTAKTQGIGS 68

Query: 182 LMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWL-T 240
           +  G    +I      G  F  ++   +K+  + +   ++   +    G  +G +  +  
Sbjct: 69  IYVGCPAFIIGNTAKAGIRFLGFD--TIKDMLRDSETGELSGTRGVIAGLGAGLLESVAA 126

Query: 241 VYPVDVVKSVLQTDSIE-NPKYKNS---IIKATRALYKQHGIPAFFKGFVPTMIRAAPAN 296
           V P + +K+ L  D     PKY N+   +++   +L +  G    ++G +P  +R A   
Sbjct: 127 VTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQ 186

Query: 297 A 297
           A
Sbjct: 187 A 187

>Scas_645.9
          Length = 391

 Score = 59.7 bits (143), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 61/268 (22%), Positives = 111/268 (41%), Gaps = 36/268 (13%)

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
           G +E    + + EG    ++G+   LL + I  ++ +         F  Y   R +    
Sbjct: 131 GTLEAFNKIWKLEGITTLWRGISINLL-MAIPANIVY---------FTGYEYLRDNSPLA 180

Query: 122 VPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQ--------TQTSQGNERQFKGPFDCI 173
              P     +CG    ++ +   AP+E ++ +LQ        T +    +   K     +
Sbjct: 181 TSSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEM 240

Query: 174 KKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSF--GA 231
           +    + AL +GL  T+ R       Y+ +YE      +   +  +    + + SF  G+
Sbjct: 241 RISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGS 300

Query: 232 LSGTILWLTVYPVDV-------------VKSVLQTDSIENPKYKNSIIKATRALYKQHGI 278
           +SGTI  L  +P DV              KSV+++  IE  K   ++ K  R ++K  G 
Sbjct: 301 ISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTK---NMFKFLRNIWKLEGW 357

Query: 279 PAFFKGFVPTMIRAAPANAATFVSFEMT 306
            A + G VP M++ AP+ A    S+E++
Sbjct: 358 GALYTGLVPRMVKIAPSCAIMISSYELS 385

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 88/244 (36%), Gaps = 68/244 (27%)

Query: 124 LPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQ-------------------------- 157
           L LHQ  L   TG ++ S    P++ VRIRLQ Q                          
Sbjct: 34  LTLHQRMLSASTGSLLTSLTLTPMDVVRIRLQQQELLPDCSCETIAVKDFLPKAKTDLSS 93

Query: 158 --------TSQGNERQ-------------------FKG---PFDCIKKLAKAKALMRGLL 187
                    S GN+ +                   F G    F+ I KL     L RG+ 
Sbjct: 94  VQVSRAATISTGNKNKVFWDNPCFQELNCKNSSVRFNGTLEAFNKIWKLEGITTLWRGIS 153

Query: 188 PTMIRAGHGLGTYFAAYEALVVKEFEKGTP-RNQIPAWKLCSFGALSGTILWLTVYPVDV 246
             ++ A      YF  YE L        +P     P +     GA++  +   TV P+++
Sbjct: 154 INLLMAIPANIVYFTGYEYL-----RDNSPLATSSPTFNPLMCGAIARILAASTVAPLEL 208

Query: 247 VKSVLQ-----TDSIENPKYKNSIIKATRALYKQHGIP-AFFKGFVPTMIRAAPANAATF 300
           +K+ LQ     + S  +      ++K TR   +  G   A FKG   T+ R  P +A  +
Sbjct: 209 LKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYW 268

Query: 301 VSFE 304
            S+E
Sbjct: 269 GSYE 272

 Score = 35.4 bits (80), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 41/100 (41%), Gaps = 17/100 (17%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS----------------KTKIGVIEVVQNL 70
           +     G++ G    LV  PFD  K R Q S                +TK  + + ++N+
Sbjct: 293 INSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTK-NMFKFLRNI 351

Query: 71  LRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAA 110
            + EG  A Y G++  ++ +    ++     E  KR F A
Sbjct: 352 WKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFNA 391

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 120/259 (46%), Gaps = 28/259 (10%)

Query: 66  VVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFA-AYNADRVDPQKHVPL 124
           ++ N+ + EG  + +KG+   L+GV    S+ F    + K  +A A+N  +  P  H+  
Sbjct: 122 IIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPMIHL-- 179

Query: 125 PLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQ-TQTSQGNERQFKGPFDCIKKLAKAK--- 180
                 +   T G   +    PI  ++ R+Q  +  + + RQ+K  +DC+K + + +   
Sbjct: 180 ------MAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFT 233

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEAL--VVKE--FEK------GTPRNQIPAWKLCSFG 230
            L +GL  + + +  G+  +   YE +  ++KE   EK      GT        + C   
Sbjct: 234 GLYKGLSASYLGSVEGILQWL-LYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRS 292

Query: 231 ALSGT---ILWLTVYPVDVVKSVLQTDSIENPKYK-NSIIKATRALYKQHGIPAFFKGFV 286
             +G    +  +  YP +VV++ L+    EN K K   ++++ + + K+ G+ + + G  
Sbjct: 293 GSAGLAKFVASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLT 352

Query: 287 PTMIRAAPANAATFVSFEM 305
           P ++R  P +   F ++E+
Sbjct: 353 PHLMRTVPNSIIMFGTWEI 371

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 68/158 (43%), Gaps = 19/158 (12%)

Query: 65  EVVQNLLRNEGALAFYKGMLTPLLGV--GICVSVQFGVNESMKRFFAAYNADRVDPQ--- 119
           + +++++RNEG    YKG+    LG   GI   +Q+ + E MKR     + ++   Q   
Sbjct: 221 DCLKSVIRNEGFTGLYKGLSASYLGSVEGI---LQWLLYEQMKRLIKERSIEKFGYQAEG 277

Query: 120 -KHVPLPLHQYYLCGLTGGV-----VNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCI 173
            K     + ++  C  +G       V S    P E VR RL+    +  +R++ G     
Sbjct: 278 TKSTSEKVKEW--CQRSGSAGLAKFVASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSF 335

Query: 174 KKLAKAKALM---RGLLPTMIRAGHGLGTYFAAYEALV 208
           K + K + L     GL P ++R        F  +E ++
Sbjct: 336 KVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIVI 373

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 36/89 (40%), Gaps = 25/89 (28%)

Query: 243 PVDVVKSVLQTD---------------SIENPKYKNSIIKATRA----------LYKQHG 277
           P D+VK+ LQ+D                   PK  N +I+A             +YKQ G
Sbjct: 72  PFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYKQEG 131

Query: 278 IPAFFKGFVPTMIRAAPANAATFVSFEMT 306
             + FKG  P ++   PA +  F ++  T
Sbjct: 132 FRSLFKGLGPNLVGVIPARSINFFTYGTT 160

>Kwal_0.232
          Length = 274

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 98/271 (36%), Gaps = 17/271 (6%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTP 86
           +  + AG   G +  L   P DT K RLQ +               N G L  Y+G+ + 
Sbjct: 7   ITSLLAGAAAGTSTDLFFFPIDTLKTRLQAAG----------GFFANGGYLGVYRGLGSA 56

Query: 87  LLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAP 146
           ++      S+ F   + MK +      + +     V      +      G +    +  P
Sbjct: 57  VVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVA-ETATHMFSSSAGEIAACMVRVP 115

Query: 147 IEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEA 206
            E ++ R QT  S  + +  K            + L RG   T++R        F  YE 
Sbjct: 116 AEVIKQRTQTHKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQFPLYEF 175

Query: 207 LVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSII 266
           L  K++     R Q+  W+    G ++G I   T  P+DV+K+ L       P     ++
Sbjct: 176 LK-KQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVP-----VL 229

Query: 267 KATRALYKQHGIPAFFKGFVPTMIRAAPANA 297
              R +Y   G   FF G  P  +  +   A
Sbjct: 230 HLARQIYATEGWKVFFSGVGPRTVWISAGGA 260

 Score = 31.2 bits (69), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 33/79 (41%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGV 90
           F G + G        P D  K RL  S T + V+ + + +   EG   F+ G+    + +
Sbjct: 196 FCGCVAGGIAAATTTPLDVLKTRLMLSHTSVPVLHLARQIYATEGWKVFFSGVGPRTVWI 255

Query: 91  GICVSVQFGVNESMKRFFA 109
               ++  GV E++    +
Sbjct: 256 SAGGAIFLGVYETVHSILS 274

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 73/336 (21%), Positives = 124/336 (36%), Gaps = 76/336 (22%)

Query: 26  VVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSK--------TKIGVIEVVQNLLRNEGAL 77
           VV+   AG + G     +  P D  K+  QTS         + +G+ E  +++  N+G  
Sbjct: 18  VVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIR 77

Query: 78  AFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQY------YL 131
            F++G    LL +    +V+F   E ++                + +P  +Y        
Sbjct: 78  GFFQGHSVTLLRIFPYAAVKFVAYEQIRS---------------ILIPSREYESHWRRLA 122

Query: 132 CGLTGGVVNSFLAAPIEHVRIRLQTQT-------------------SQGNERQFKGPFDC 172
            G   G+ + F+  P++  R+RL   T                   S+G       P   
Sbjct: 123 SGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVP--- 179

Query: 173 IKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEAL------------VVK------EFEK 214
            K  A      RG +PT++      G  F A++ +             VK      E E+
Sbjct: 180 -KWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELER 238

Query: 215 GTPRNQIP--AWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKN----SIIKA 268
              R + P   W     G LSG +     YP+++++  LQ  ++   K  +    SI   
Sbjct: 239 KKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSI 298

Query: 269 TRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
            R +Y++ G   FF G     I+  P  A +F  +E
Sbjct: 299 ARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYE 334

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 80/192 (41%), Gaps = 33/192 (17%)

Query: 19  PPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ--TSKTKIGVIEVVQNLLR---N 73
           P   Y    + + +G++ G+  V +  P D T+VRL   T   ++ + ++V+ +     +
Sbjct: 110 PSREYESHWRRLASGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPAS 169

Query: 74  EGALA-------------FYKGMLTPLLGV----GICVSVQFGVNESMK-RFFAAYNADR 115
           EG  +             FY+G +  +LG+    G+       +++ MK    A Y   +
Sbjct: 170 EGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQ 229

Query: 116 VDPQKHV---------PLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQF 166
           +  Q+ +         PL      + G   G+++   A P+E +R RLQ  T     + +
Sbjct: 230 LSSQEELERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVST-LSPRKMY 288

Query: 167 KGPFDCIKKLAK 178
              F  I  +A+
Sbjct: 289 DHKFQSISSIAR 300

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 82/201 (40%), Gaps = 38/201 (18%)

Query: 133 GLTGGVVNSF---LAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA-------KAL 182
           GL GGV  S    L AP++  RI++  QTS  +  ++ G    + + AK        +  
Sbjct: 22  GLAGGVSGSCAKTLIAPLD--RIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGF 79

Query: 183 MRGLLPTMIRAGHGLGTYFAAYEALVV-----KEFEKGTPRNQIPAWKLCSFGALSGTIL 237
            +G   T++R        F AYE +       +E+E          W+  + G+L+G   
Sbjct: 80  FQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYES--------HWRRLASGSLAGLCS 131

Query: 238 WLTVYPVDVVKSVLQTDSIENPKYKNSIIK------ATRALYKQHGIPA-------FFKG 284
               YP+D+ +  L   +         I+K      A+  L     +P        F++G
Sbjct: 132 VFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRG 191

Query: 285 FVPTMIRAAPANAATFVSFEM 305
           +VPT++   P    +F + ++
Sbjct: 192 YVPTVLGMIPYAGVSFFAHDL 212

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 115/281 (40%), Gaps = 37/281 (13%)

Query: 35  MGGVAQVLV---GQPFDTTKVRLQTSKTKI----------GVIEVVQNLLRNEGALAFYK 81
           MGGV+  +      P +  K+ +Q     I          G+++  Q   R EG ++F++
Sbjct: 17  MGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIISFWR 76

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G    ++      ++ F   + +K  F          + +           G+ GG+   
Sbjct: 77  GNTANVIRYFPTQALNFAFKDQIKAMFGFKK-----EEGYAKWFAGNLASGGIAGGLSLM 131

Query: 142 FLAAPIEHVRIRLQTQ---TSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGH 195
           F+ + +++ R RL      + +G ERQF G  D  KK   +     L RG LP++I    
Sbjct: 132 FVYS-LDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVV 190

Query: 196 GLGTYFAAYEA----LVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVL 251
             G YF  Y++    L+    E     + +  W + + GA + +      YP+D V+  +
Sbjct: 191 YRGLYFGLYDSCKPLLLTGSLEGSFIASFLLGW-VVTTGASTAS------YPLDTVRRRM 243

Query: 252 QTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRA 292
              S +  KYK + +   + +    G+ + FKG    ++R 
Sbjct: 244 MMTSGQAVKYKGA-MDCLQKIVAAEGVSSLFKGCGANILRG 283

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 73/168 (43%), Gaps = 39/168 (23%)

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
           G+++V +  + ++G    Y+G L  ++G+ +   + FG+ +S K                
Sbjct: 160 GLVDVYKKTIASDGVAGLYRGFLPSVIGIVVYRGLYFGLYDSCK---------------- 203

Query: 122 VPLPLHQYYLCGLTGGVVNSFL------------AAPIEHVRIRLQTQTSQGNERQFKGP 169
            PL L       L G  + SFL            + P++ VR R+    + G   ++KG 
Sbjct: 204 -PLLLTG----SLEGSFIASFLLGWVVTTGASTASYPLDTVRRRM--MMTSGQAVKYKGA 256

Query: 170 FDCIKKLAKAK---ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEK 214
            DC++K+  A+   +L +G    ++R   G G   + Y+ L +  F K
Sbjct: 257 MDCLQKIVAAEGVSSLFKGCGANILRGVAGAGV-ISLYDQLQMILFGK 303

>Kwal_23.3529
          Length = 395

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 112/286 (39%), Gaps = 31/286 (10%)

Query: 43  VGQPFDTTKVRLQ---TSKTKIGVIEVVQNLLRNEG-ALAFYKGMLTPLLGVGICVSVQF 98
           V    DT K R Q    +     +I   Q +   EG     Y G    +LG     ++ F
Sbjct: 102 VMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIFF 161

Query: 99  GVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQ- 157
           G  E  KR        ++     V   L  +   GL+G +V+S +  P E ++ RLQ Q 
Sbjct: 162 GTYELTKR--------KLIDDWGVNETL-SHLTAGLSGDLVSSVVYVPSEVLKTRLQLQG 212

Query: 158 -------TSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVK 210
                   S  N R  +     I +L   + L  G   T+ R        FA YE     
Sbjct: 213 CYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQW 272

Query: 211 EF--EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQT--------DSIENPK 260
            F  E  TP   +        GA +G +  +   P+DV+K+ +QT        DS    +
Sbjct: 273 AFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVR 332

Query: 261 YKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMT 306
            +NS+IK   A+Y+  G   FF G  P  I  +  ++   + +++T
Sbjct: 333 IENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQVT 378

>Scas_716.29
          Length = 316

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/308 (21%), Positives = 125/308 (40%), Gaps = 46/308 (14%)

Query: 25  RVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ-----TSKTKIGVIEVVQNLLRNEGAL-A 78
           +V + + AG++ G+    V  P DT K+RLQ     T +   G++++++ ++ NEG L +
Sbjct: 21  KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRS 80

Query: 79  FYKG-----MLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCG 133
           F+KG     M+  L G         G   S   F+     +  D    +     Q  + G
Sbjct: 81  FWKGNVPGTMMYVLYG---------GAQFSSYSFYNNLFGETSDMNGQL-----QSLVVG 126

Query: 134 LTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRA 193
              G+ +SF++ P + +R R              G  + I  +       RG   +M   
Sbjct: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-IWNMEGIPGFFRGCTASMFTI 185

Query: 194 GHGLGTYFAAYEALVV--KEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVK--- 248
                  F  YE++ +   E+ K +       +   S  ++SG    +  YP+D ++   
Sbjct: 186 TLSASILFGTYESIKIYCDEYSKESDYTNYLRY---SASSISGVTSKMVTYPLDTIRRRI 242

Query: 249 ----SVLQTDSIENP-------KYKN-SIIKATRALYKQHGIPAFFKGFVPTMIRAAPAN 296
               SV    ++EN         YK  S I+    + +Q G+ + ++G   ++ +  P+ 
Sbjct: 243 QVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPST 302

Query: 297 AATFVSFE 304
             +  ++E
Sbjct: 303 VVSLWAYE 310

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 86/199 (43%), Gaps = 15/199 (7%)

Query: 111 YNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQ---TQTSQGNERQFK 167
           +N D +  +K   + + Q  + G   G++   + AP++ ++IRLQ   + T Q      K
Sbjct: 9   HNTDHL--RKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLK 66

Query: 168 GPFDCIKKLAKAKALMRGLLP-TMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKL 226
                I      ++  +G +P TM+   +G G  F++Y        E      Q+ +  +
Sbjct: 67  MMKGMILNEGGLRSFWKGNVPGTMMYVLYG-GAQFSSYSFYNNLFGETSDMNGQLQSLVV 125

Query: 227 CSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYK-NSIIKATRALYKQHGIPAFFKGF 285
              GAL+G       YP D    VL+T  I N     +S+    + ++   GIP FF+G 
Sbjct: 126 ---GALAGMTSSFVSYPTD----VLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGC 178

Query: 286 VPTMIRAAPANAATFVSFE 304
             +M     + +  F ++E
Sbjct: 179 TASMFTITLSASILFGTYE 197

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 40/98 (40%), Gaps = 22/98 (22%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKT---------KIGVIEVVQ------------NL 70
           A ++ GV   +V  P DT + R+Q   +         KI V E+ Q            N+
Sbjct: 220 ASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKI-VTEIYQSYKGASFIRMGLNI 278

Query: 71  LRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFF 108
           LR EG L+ Y+G+   L        V     E++ R +
Sbjct: 279 LRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316

>Scas_562.12
          Length = 300

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 109/280 (38%), Gaps = 24/280 (8%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIG-VIEVVQNLLRNEGALAFYKGMLT 85
           V  +      G+ ++ V  P DT   RL ++ TKIG   E+ + + R   +    K + T
Sbjct: 11  VARLLGSASAGILEIGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREHFSEPLGKRLFT 70

Query: 86  PLLGVGICVSVQ-------FGVNESMKRFFAAYNADRVDPQ--KHVPLPLHQYYLCGLTG 136
              G+G   S +       +G       F   +     D    +     +       L G
Sbjct: 71  LFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIG 130

Query: 137 GVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGP-FDCIKKLAKAKALMRGLLPTMIRAGH 195
             +   +  P++ ++I+ QT     N   FKG  F  I K      L RG   T  R   
Sbjct: 131 --IGEIVLLPLDVLKIKRQT-----NPEAFKGRGFVKILKDEGIFNLYRGWGWTAARNAP 183

Query: 196 GLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVY-PVDVVKSVLQTD 254
           G    F        KE+  G       +W      ++ G    L V  P+DV+K+ +Q  
Sbjct: 184 GSFALFGGNA--FAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNR 241

Query: 255 SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
           S +NP+   +I+K T   +K  GI AFFKG  P ++   P
Sbjct: 242 SFDNPETGLTIVKNT---FKNEGITAFFKGLTPKLLTTGP 278

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 4/80 (5%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQT---SKTKIGVIEVVQNLLRNEGALAFYKGML 84
           ++  +  +G    ++V  P D  K R+Q       + G + +V+N  +NEG  AF+KG+ 
Sbjct: 212 QNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETG-LTIVKNTFKNEGITAFFKGLT 270

Query: 85  TPLLGVGICVSVQFGVNESM 104
             LL  G  +   F + +S+
Sbjct: 271 PKLLTTGPKLVFSFALAQSL 290

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 81/193 (41%), Gaps = 22/193 (11%)

Query: 24  GRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGM 83
           G+ ++   AG++ G+ ++++  P D  K++ QT+         V+ +L++EG    Y+G 
Sbjct: 117 GKAMRSATAGSLIGIGEIVL-LPLDVLKIKRQTNPEAFKGRGFVK-ILKDEGIFNLYRGW 174

Query: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFL 143
                         FG N   K +        +  + +      Q ++  + G   +  +
Sbjct: 175 GWTAARNAPGSFALFGGNAFAKEYI-------LGLEDYSQASWSQNFISSIVGASCSLIV 227

Query: 144 AAPIEHVRIRLQTQTSQGNERQFKGP---FDCIKKLAKAK---ALMRGLLPTMIRAGHGL 197
           +AP++ ++ R+Q        R F  P      +K   K +   A  +GL P ++  G  L
Sbjct: 228 SAPLDVIKTRIQN-------RSFDNPETGLTIVKNTFKNEGITAFFKGLTPKLLTTGPKL 280

Query: 198 GTYFAAYEALVVK 210
              FA  ++L+ K
Sbjct: 281 VFSFALAQSLIPK 293

>Scas_669.6
          Length = 373

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 111/299 (37%), Gaps = 47/299 (15%)

Query: 45  QPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEG-ALAFYKGMLTPLLGVGICVSVQFG 99
              DT K R Q    T K K  +    + +   EG A   Y G    +LG     ++ FG
Sbjct: 70  HSLDTVKTRQQGAPMTPKYK-NMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFG 128

Query: 100 VNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQ-- 157
             E  KR     +    D   H+          GL G  V+SF+  P E ++ RLQ Q  
Sbjct: 129 TYEWCKRKMIG-DLGFNDTVSHLS--------AGLLGDFVSSFVYVPSEVLKTRLQLQGR 179

Query: 158 ------TSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKE 211
                  S  N R  +     I      KAL  G   T+ R        F  YE      
Sbjct: 180 VNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTA 239

Query: 212 FE---KGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIE-NPK------- 260
           F+   K   ++ +        GA++G +  +   P+DV+K+ LQT   + NP        
Sbjct: 240 FKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGA 299

Query: 261 -------------YKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMT 306
                          NSI ++ + +Y+  G+  FF G  P  +  +  ++   + ++MT
Sbjct: 300 ISAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLYQMT 358

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 117/284 (41%), Gaps = 39/284 (13%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLL-RNEGALAFYKGMLTPLL 88
           +      G+ ++ V  P DT   RL ++ TKIG    + +++ R   A    K + T   
Sbjct: 13  VLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSVIFREHAAEPLSKRVFTLFP 72

Query: 89  GVGICVS-------VQFG----VNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGG 137
           G+G   +        ++G     NE + R F A + D    +K     L       + G 
Sbjct: 73  GLGYAATYKILQRVYKYGGQPFANEFLNRNFKA-DFDNTFGEK-TGKALRSATAGSMIG- 129

Query: 138 VVNSFLAAPIEHVRIRLQTQTSQGNERQFKG-PFDCIKKLAKAKALMRGLLPTMIRAGHG 196
            +   +  P++ ++I+ QT     N   FKG  F  I K  +   L RG   T  R   G
Sbjct: 130 -IGEIVLLPLDVLKIKRQT-----NPEAFKGRGFVKILK-DEGLGLYRGWGWTAARNAPG 182

Query: 197 L-----GTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVY-PVDVVKSV 250
                 G  FA    L +K++ + T       W      ++ G    L +  P+DV+K+ 
Sbjct: 183 SFALFGGNAFAKEYILGLKDYSQAT-------WSQNFVSSIVGASASLIISAPLDVIKTR 235

Query: 251 LQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
           +Q  + ENP+   +I+K T    K  G  AFFKG  P ++   P
Sbjct: 236 IQNKNFENPESGFTIVKNT---LKNEGFSAFFKGLTPKLLTTGP 276

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEVVQNLLRNEGALAFYKGMLT 85
           ++  +  +G  A +++  P D  K R+Q    +       +V+N L+NEG  AF+KG+  
Sbjct: 210 QNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESGFTIVKNTLKNEGFSAFFKGLTP 269

Query: 86  PLLGVGICVSVQFGVNESM 104
            LL  G  +   F + +++
Sbjct: 270 KLLTTGPKLVFSFALAQTL 288

>Kwal_26.7967
          Length = 297

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 116/287 (40%), Gaps = 24/287 (8%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGMLTP 86
            AG++ G  +  +  PF+  K RLQ    +S      + ++    + +G  A Y G    
Sbjct: 14  LAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVGCPAF 73

Query: 87  LLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA-A 145
           ++G      V+F   +++K           DP     L   +  + GL  G++ S +A  
Sbjct: 74  IVGNTAKAGVRFLGFDAIKNILR-------DPTTG-ELSGPRGIVAGLGAGLLESVVAVT 125

Query: 146 PIEHVRIRL---QTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGHGLGT 199
           P E ++  L   +   S       +G       L   K    L RG+LP  +R       
Sbjct: 126 PFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQAV 185

Query: 200 YFAAYEAL--VVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIE 257
               Y  +  +++++        + +      GA SG +   T  P+D VK+ +Q  S++
Sbjct: 186 RLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQ--SLD 243

Query: 258 NPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           + KY +S I     ++++ G+  F+KG  P + R   +    F  +E
Sbjct: 244 SSKY-SSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYE 289

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 81/194 (41%), Gaps = 19/194 (9%)

Query: 28  KDIFAGTMGGVAQVLVG-QPFDTTKVRLQTSKTKIG--VIEVVQNLLRNEGALAFYKGML 84
           + I AG   G+ + +V   PF+  K  L   K           + +LRN  +L + KG  
Sbjct: 107 RGIVAGLGAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFS 166

Query: 85  TPLLGVGICVSVQFGVNESMKRFFAAYNA------DRVDPQKHVPLPLHQYYLCGLTGGV 138
               GV + VS++   N++++     YN       D  +  K  PL     ++ G   G+
Sbjct: 167 GLYRGV-LPVSMRQAANQAVR--LGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGI 223

Query: 139 VNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKAL---MRGLLPTMIRAGH 195
           V  +   PI+ V+ R+Q+  S     ++    +C   + + + L    +G  P + R   
Sbjct: 224 VTVYTTMPIDTVKTRMQSLDSS----KYSSTINCFATVFREEGLKTFWKGATPRLGRLIL 279

Query: 196 GLGTYFAAYEALVV 209
             G  F  YE ++V
Sbjct: 280 SGGIVFTIYEKVLV 293

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 76/187 (40%), Gaps = 13/187 (6%)

Query: 119 QKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK 178
           QK    PLH + L G   G V + +  P E  + RLQ           + P   I + AK
Sbjct: 3   QKKQVDPLHSF-LAGSLAGAVEASITYPFEFAKTRLQLVDKSSTAS--RNPLTLIYRTAK 59

Query: 179 AK---ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGA-LSG 234
            +   A+  G    ++      G  F  ++A+     +  T     P   +   GA L  
Sbjct: 60  VQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTGELSGPRGIVAGLGAGLLE 119

Query: 235 TILWLTVYPVDVVKSVLQTDSIE-NPKYKNS---IIKATRALYKQHGIPAFFKGFVPTMI 290
           +++ +T  P + +K+ L  D    +PKY N+   +++   +L    G    ++G +P  +
Sbjct: 120 SVVAVT--PFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSM 177

Query: 291 RAAPANA 297
           R A   A
Sbjct: 178 RQAANQA 184

>Kwal_27.12481
          Length = 304

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 111/281 (39%), Gaps = 37/281 (13%)

Query: 35  MGGVAQVL---VGQPFDTTKVRLQTSKTKI----------GVIEVVQNLLRNEGALAFYK 81
           MGGV+  +      P +  K+ +Q     I          G+ E  +    NEG  +F++
Sbjct: 16  MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRTAANEGIASFWR 75

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G    ++      ++ F   + +K  F          + +           G  GG+   
Sbjct: 76  GNTANVIRYFPTQALNFAFKDKIKAMFGFKK-----EEGYAKWFAGNLASGGAAGGLSLM 130

Query: 142 FLAAPIEHVRIRLQTQTS---QGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGH 195
           F+ + +++ R RL   +    +G ERQF G  D  KK   +     L RG LP+++    
Sbjct: 131 FVYS-LDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVV 189

Query: 196 GLGTYFAAYEA----LVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVL 251
             G YF  Y++    L+    E     + +  W + + GA + +      YP+D V+  +
Sbjct: 190 YRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAVTT-GASTAS------YPLDTVRRRM 242

Query: 252 QTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRA 292
              S +  KY N    A R +    GI + FKG    ++R 
Sbjct: 243 MMTSGQAVKY-NGAFDAFRKIVAAEGIKSLFKGCGANILRG 282

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 76/195 (38%), Gaps = 56/195 (28%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------GVIEVVQNLLRNEGALAFYKG 82
            G  GG++ + V    D  + RL                G+++V +  L ++G    Y+G
Sbjct: 121 GGAAGGLSLMFV-YSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRG 179

Query: 83  MLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSF 142
            L  ++G+ +   + FG  +S+K                 PL         LTG +  SF
Sbjct: 180 FLPSVVGIVVYRGLYFGGYDSLK-----------------PLL--------LTGSLEGSF 214

Query: 143 LAA----------------PIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KALM 183
           LA+                P++ VR R+   + Q    ++ G FD  +K+  A   K+L 
Sbjct: 215 LASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQ--AVKYNGAFDAFRKIVAAEGIKSLF 272

Query: 184 RGLLPTMIRAGHGLG 198
           +G    ++R   G G
Sbjct: 273 KGCGANILRGVAGAG 287

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 67/291 (23%), Positives = 121/291 (41%), Gaps = 28/291 (9%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGML 84
              AG++ G  +  +  PF+  K RLQ     SK     + ++ N  +N G  + Y G  
Sbjct: 93  SFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGCP 152

Query: 85  TPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA 144
             ++G      ++F   +++K          +  +K   L   +  + GL  G++ S +A
Sbjct: 153 AFIVGNTAKAGIRFLGFDTIKNL--------LRDKKTGELSGFRGVVAGLGAGLLESVVA 204

Query: 145 -APIEHVRIRLQTQTSQG---NERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGHGL 197
             P E ++  L           +   KG      KL   +    L RG+LP  +R     
Sbjct: 205 VTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQ 264

Query: 198 GTYFAAYEAL--VVKEFEKGTPRNQIPAWKLCSF--GALSGTILWLTVYPVDVVKSVLQT 253
                 Y  +  +V+++    P+++ P     +F  GA SG +   T  P+D VK+ +Q 
Sbjct: 265 AVRLGCYNKIKTLVQDYTN-VPKDK-PLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQ- 321

Query: 254 DSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
            S+   +Y +S I     ++K+ G+  F+KG  P + R   +    F  +E
Sbjct: 322 -SLNAGQY-SSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYE 370

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 76/194 (39%), Gaps = 21/194 (10%)

Query: 28  KDIFAGTMGGVAQVLVG-QPFDTTKVRLQTSKTKI---------GVIEVVQNLLRNEGAL 77
           + + AG   G+ + +V   PF+  K  L   K            G++     LL ++G  
Sbjct: 188 RGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFS 247

Query: 78  AFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGG 137
             Y+G+L   +      +V+ G    +K        D  +  K  PL     ++ G   G
Sbjct: 248 GLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQ----DYTNVPKDKPLSSGLTFIVGAFSG 303

Query: 138 VVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKAL---MRGLLPTMIRAG 194
           +V  +   PI+ V+ R+Q+     N  Q+    +C   + K + L    +G  P + R  
Sbjct: 304 IVTVYTTMPIDTVKTRMQSL----NAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLI 359

Query: 195 HGLGTYFAAYEALV 208
              G  F  YE ++
Sbjct: 360 LSGGIVFTIYEKVL 373

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 68/196 (34%), Gaps = 43/196 (21%)

Query: 125 PLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMR 184
           P H + L G   G + + +  P E  + RLQ                 + K +KA    R
Sbjct: 90  PFHSF-LAGSIAGAIEASITYPFEFAKTRLQL----------------VDKASKAS---R 129

Query: 185 GLLPTMIRAG--HGLGTYFAAYEALVVKEFEKG--------TPRNQIPAWKLCSFGALSG 234
             L  +   G  +G+ + +    A +V    K         T +N +   K        G
Sbjct: 130 NPLVLIYNTGKNYGISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFRG 189

Query: 235 TILWL---------TVYPVDVVKSVLQTD-SIENPKYKNS---IIKATRALYKQHGIPAF 281
            +  L          V P + +K+ L  D     PKY+N+   ++     L    G    
Sbjct: 190 VVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGL 249

Query: 282 FKGFVPTMIRAAPANA 297
           ++G +P  +R A   A
Sbjct: 250 YRGVLPVSMRQAANQA 265

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 114/294 (38%), Gaps = 39/294 (13%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQ---TSKTKI-GVIEVVQNLLRNEGALAFYKGMLT 85
           + AG++ G+    V  P DT K+R Q    S+ K  G++   + + R EG  A +KG + 
Sbjct: 28  VVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVP 87

Query: 86  PLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAA 145
                 +  S+QFG    +    AA +A  + PQ H           G   G+V+S L  
Sbjct: 88  ASAMYVLYGSLQFGTYAWLNT--AAASAG-LPPQAHS-------LAVGALAGLVSSLLTY 137

Query: 146 PIEHVRIRLQTQTSQ---GNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFA 202
           P++ +R RL    S       RQ +  +D            RG    +       G  F 
Sbjct: 138 PLDLLRTRLVANRSAHFFSLRRQARVIWDT----EGPAGFFRGGAWAIAATTLTTGLIFG 193

Query: 203 AYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQ-TDSIENPKY 261
            YE   +     G P      W   +    +G +    V+P+D V+  LQ  D+   P +
Sbjct: 194 IYETCTIAADTYGLP------WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFF 247

Query: 262 KN-----SIIKATRAL------YKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
                  S ++ TR L       +  GI + +KG    + ++ P    T   ++
Sbjct: 248 TRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301

>Scas_558.2
          Length = 289

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/284 (21%), Positives = 102/284 (35%), Gaps = 38/284 (13%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTP 86
           V  + +G   G +  LV  P DT K RLQ                +N G    Y+G    
Sbjct: 7   VMSLLSGAAAGTSTDLVFFPIDTLKTRLQAKG----------GFFQNGGYHGIYRG---- 52

Query: 87  LLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQ-------------YYLCG 133
            LG  +  S       S   FF  Y++ +V  + HV   ++              + +  
Sbjct: 53  -LGSAVVASA-----PSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIAS 106

Query: 134 LTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRA 193
             G +    +  P E ++ R Q  ++  + + F+       +    + L RG   T++R 
Sbjct: 107 SMGELAACLVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMRE 166

Query: 194 GHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQT 253
                  F  YE +  +          +  WK    G+++G I   T  P+D +K+ L  
Sbjct: 167 IPFTCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPLDFLKTRLML 226

Query: 254 DSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANA 297
           +    P     I    R +YK+ G   FF G  P  +  +   A
Sbjct: 227 NKDSIP-----IKSLIRNIYKEEGFKIFFSGIYPRTMWISAGGA 265

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 35/77 (45%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPL 87
           K    G++ G        P D  K RL  +K  I +  +++N+ + EG   F+ G+    
Sbjct: 198 KGAICGSIAGGIAAATTTPLDFLKTRLMLNKDSIPIKSLIRNIYKEEGFKIFFSGIYPRT 257

Query: 88  LGVGICVSVQFGVNESM 104
           + +    ++  GV E+M
Sbjct: 258 MWISAGGAIFLGVYETM 274

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 34/75 (45%), Gaps = 15/75 (20%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTM 289
           GA +GT   L  +P+D +K+ LQ               A    ++  G    ++G    +
Sbjct: 13  GAAAGTSTDLVFFPIDTLKTRLQ---------------AKGGFFQNGGYHGIYRGLGSAV 57

Query: 290 IRAAPANAATFVSFE 304
           + +AP+ +  FV+++
Sbjct: 58  VASAPSASLFFVTYD 72

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 114/281 (40%), Gaps = 36/281 (12%)

Query: 35  MGGVAQVL---VGQPFDTTKVRLQTSKTKI----------GVIEVVQNLLRNEGALAFYK 81
           MGGV+  +      P +  K+ +Q     +          G+++  +    +EG ++F++
Sbjct: 15  MGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGVISFWR 74

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G    ++      ++ F   + +K  F      R +   +           G  GG+   
Sbjct: 75  GNTANVIRYFPTQALNFAFKDKIKAMFGF----RKEVDGYAKWFAGNLASGGAAGGLSLL 130

Query: 142 FLAAPIEHVRIRLQTQT---SQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGH 195
           F+ + +++ R RL   +    +G ERQF G  D  KK   +     L RG LP+++    
Sbjct: 131 FVYS-LDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVV 189

Query: 196 GLGTYFAAYEA----LVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVL 251
             G YF  Y++    L+    E     + +  W + + GA + +      YP+D V+  +
Sbjct: 190 YRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAVTT-GASTAS------YPLDTVRRRM 242

Query: 252 QTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRA 292
              S +  KY +    A R +    G+ + FKG    ++R 
Sbjct: 243 MMTSGQAVKY-DGAFDAFRKIVAAEGVKSLFKGCGANILRG 282

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 80/195 (41%), Gaps = 25/195 (12%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------GVIEVVQNLLRNEGALAFYKG 82
            G  GG++ + V    D  + RL                G+++V +  L ++G    Y+G
Sbjct: 121 GGAAGGLSLLFV-YSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRG 179

Query: 83  MLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSF 142
            L  ++G+ +   + FG+ +S+K      N +               +L G       S 
Sbjct: 180 FLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLES---------SFIASFLLGWAVTTGAST 230

Query: 143 LAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHGLGT 199
            + P++ VR R+    + G   ++ G FD  +K+  A   K+L +G    ++R   G G 
Sbjct: 231 ASYPLDTVRRRM--MMTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGV 288

Query: 200 YFAAYEALVVKEFEK 214
             + Y+ L +  F K
Sbjct: 289 -ISLYDQLQLVLFGK 302

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 90/190 (47%), Gaps = 26/190 (13%)

Query: 129 YYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLP 188
           + + G  GG+ ++    P++ ++ R Q QT  G   Q       +K L     L RG LP
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQ-QTKGGTLWQ------TVKSLDTPWQLWRGTLP 59

Query: 189 TMIRAGHGLGTYFAAYEALVV-----KEFE--------KGTPRNQIPAWKLCSFGALS-G 234
           + IR   G   Y ++   +       K+F+        K +   Q+  ++    GA + G
Sbjct: 60  SAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARG 119

Query: 235 TILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
           T+ ++T+ P+ ++K V    ++ N K   SI +A +++  Q GI  FF+GF PT +R AP
Sbjct: 120 TVGYITM-PITIIK-VRYESTLYNYK---SIAEAAKSIAAQEGIRGFFRGFGPTCLRDAP 174

Query: 295 ANAATFVSFE 304
            +    + +E
Sbjct: 175 YSGLYVLLYE 184

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 60/283 (21%), Positives = 106/283 (37%), Gaps = 30/283 (10%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVI-EVVQNLLRNEGALAFYKGMLTPLL 88
           +  G  GG++  +  QP D  K R Q  +TK G + + V++L   +     ++G L   +
Sbjct: 8   LIGGFAGGLSSAVALQPLDLLKTRFQ--QTKGGTLWQTVKSL---DTPWQLWRGTLPSAI 62

Query: 89  GVGICVSVQFGVNESMKRFFAAY----NADRVDPQKHVPLPLHQYYLCGLTGGVVN---S 141
              +  ++       M+   A       AD V   K   LP    Y   +TG        
Sbjct: 63  RTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVG 122

Query: 142 FLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYF 201
           ++  PI  +++R   +++  N +        I      +   RG  PT +R     G Y 
Sbjct: 123 YITMPITIIKVRY--ESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYV 180

Query: 202 AAYEAL-------VVKEFEKGTPRNQIPAWKLCSFGA----LSGTILWLTVYPVDVVKSV 250
             YE L       + K   +     +  A+   +  +    LS ++      P D +K+ 
Sbjct: 181 LLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTR 240

Query: 251 LQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAA 293
           +Q   +E  K+K      T  + ++H I   F G    + R A
Sbjct: 241 MQ---LEPTKFKTFWSTLTTIVTQEHPIK-IFSGLSMRLTRKA 279

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/111 (20%), Positives = 43/111 (38%), Gaps = 3/111 (2%)

Query: 1   MSEEFPT--PQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSK 58
           +    PT  P+ L +L+     T Y     +  +  +       V  PFDT K R+Q   
Sbjct: 186 LKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLEP 245

Query: 59  TKIGVI-EVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFF 108
           TK       +  ++  E  +  + G+   L    +   + +G+ E + + F
Sbjct: 246 TKFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEELIKHF 296

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 100/229 (43%), Gaps = 31/229 (13%)

Query: 107 FFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQ----TQTSQGN 162
           +F+ Y   R         P      CG T  +V +   AP+E ++ RLQ    ++     
Sbjct: 134 YFSGYEMFRDHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTT 193

Query: 163 ERQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHGLGTYFAAYEALVVKEF-----EK 214
           +  FK      +   ++   K L +GL  T+ R       Y+ +YE    K F     E+
Sbjct: 194 QMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYE-FYKKNFWIDFSEQ 252

Query: 215 GTPRNQIPAWK--LCSF--GALSGTILWLTVYPVDVVKSVLQ-TDSIENPKYKNSIIK-- 267
               N  P W   + SF  G++SG+   L  +P DV K+ +Q T  IEN K +N+++   
Sbjct: 253 CLRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIEN-KQRNTLVSPK 311

Query: 268 ---ATRALYK-------QHGIPAFFKGFVPTMIRAAPANAATFVSFEMT 306
              + R ++K         G  A + G +P +++ AP+ A    ++E++
Sbjct: 312 KRVSARGMFKFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELS 360

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 87/235 (37%), Gaps = 62/235 (26%)

Query: 126 LHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQ-----TSQGNERQFKGP----------- 169
           + +  L    G  + SF   P++ VRIRLQ Q      S G   + KG            
Sbjct: 11  MKERMLSACAGSFLTSFFLTPMDVVRIRLQQQVMLPDCSCGAASELKGSVGTEVIYDHVV 70

Query: 170 ---------------------------------FDCIKKLAKAKALMRGLLPTMIRAGHG 196
                                            F  I ++     L RGL  T++ A   
Sbjct: 71  ANKNSPKIFWQDVCFQDIQCKNSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPA 130

Query: 197 LGTYFAAYEALVVKEFEKGTP-RNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQT-- 253
              YF+ YE      F   +P R+  P+      GA +  +   TV P++++K+ LQ+  
Sbjct: 131 NVVYFSGYEM-----FRDHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIP 185

Query: 254 ----DSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
               D+     +K+ ++K TR   +  G    FKG   T+ R  P +A  + S+E
Sbjct: 186 RSRKDTTTQMMFKD-LLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYE 239

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 43/100 (43%), Gaps = 17/100 (17%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS--------------KTKI---GVIEVVQN 69
           +     G++ G +  L+  PFD  K R+Q +              K ++   G+ + + N
Sbjct: 266 INSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYN 325

Query: 70  LLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFA 109
           + + EG  A Y G++  ++ +    ++     E  KR FA
Sbjct: 326 IKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRLFA 365

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 121/318 (38%), Gaps = 58/318 (18%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQTS---KTKIGVIEVVQNLLRNEGAL-AFYKGMLT 85
           + +G +GG          DT K R Q +   K    +I   + +   EG     Y G + 
Sbjct: 57  VVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMA 116

Query: 86  PLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAA 145
            +LG     ++ FG  E  KR     +    D   H+          G  G  ++SF+  
Sbjct: 117 AMLGSFPSAAIFFGTYEYTKRTMIE-DWQINDTITHLS--------AGFLGDFISSFVYV 167

Query: 146 PIEHVRIRLQTQTSQGNERQFKGPF-----------DCIKKLAKA---KALMRGLLPTMI 191
           P E ++ RLQ Q       +F  PF           + IK + K    ++L  G   T+ 
Sbjct: 168 PSEVLKTRLQLQG------RFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLA 221

Query: 192 RAGHGLGTYFAAYEALVVKEF--EKGTPRN---QIPAWKLCSFGALSGTILWLTVYPVDV 246
           R        FA YE      F  E+   R+    IP   L   GA +G +  +   P+DV
Sbjct: 222 RDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILT--GACAGGLAGIITTPMDV 279

Query: 247 VKSVLQTD---SIENPKYK---------------NSIIKATRALYKQHGIPAFFKGFVPT 288
           VK+ +QT    S  N  Y                NSI  + R +Y+  G+  FF G  P 
Sbjct: 280 VKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPR 339

Query: 289 MIRAAPANAATFVSFEMT 306
            +  +  ++   + ++MT
Sbjct: 340 FVWTSVQSSIMLLLYQMT 357

>Kwal_23.4354
          Length = 343

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 109/264 (41%), Gaps = 38/264 (14%)

Query: 60  KIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQ 119
           KI  IE VQ+L R                  G+ +++      +M  +F  Y + R   +
Sbjct: 93  KIAKIEGVQSLWR------------------GLSITLLMAAPANMV-YFIGYESLRDKSR 133

Query: 120 KHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQT-QTSQGNERQFKGPFDCIKK--- 175
                P     +CG    V+ +   AP+E  R RLQ+   S           D IK+   
Sbjct: 134 LQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRY 193

Query: 176 -LAKA--KALMRGLLPTMIRAGHGLGTYFAAYE---ALVVKEFEKGTPRNQIPAWK--LC 227
            ++K   KAL RGL  T+ R       Y+  YE   + V  + EK    +    W   + 
Sbjct: 194 EISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVN 253

Query: 228 SF--GALSGTILWLTVYPVDVVKSVLQ----TDSIENPKYKNSIIKATRALYKQHGIPAF 281
           SF  G+  G +  +  +P DV K+ +Q      ++E    KN + K    + K  G+ A 
Sbjct: 254 SFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKN-MFKYLNQMRKSEGLAAL 312

Query: 282 FKGFVPTMIRAAPANAATFVSFEM 305
           + G VP +I+ AP+ A    ++E+
Sbjct: 313 YTGLVPRVIKIAPSCAIMISTYEV 336

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/95 (21%), Positives = 40/95 (42%), Gaps = 8/95 (8%)

Query: 23  YGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS--------KTKIGVIEVVQNLLRNE 74
           +   V     G+ GG    ++  PFD  K R+Q +        K    + + +  + ++E
Sbjct: 248 WNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSE 307

Query: 75  GALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFA 109
           G  A Y G++  ++ +    ++     E  KR F+
Sbjct: 308 GLAALYTGLVPRVIKIAPSCAIMISTYEVCKRLFS 342

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/284 (20%), Positives = 116/284 (40%), Gaps = 36/284 (12%)

Query: 35  MGGVAQVLV---GQPFDTTKVRLQTSKTKI----------GVIEVVQNLLRNEGALAFYK 81
           MGGV+  +      P +  K+ +Q  +  +          G+++  +    +EG ++F++
Sbjct: 19  MGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSFWR 78

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G    +L      ++ F   + +K    +Y+ +R    K     L      G   G ++ 
Sbjct: 79  GNTANVLRYFPTQALNFAFKDKIKSLL-SYDRERDGYAKWFAGNL----FSGGAAGGLSL 133

Query: 142 FLAAPIEHVRIRLQTQ---TSQGNERQFKGPFDCIKKLAKAKALM---RGLLPTMIRAGH 195
                +++ R RL      +   ++RQF G  D  KK  K   L+   RG +P+++    
Sbjct: 134 LFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIV 193

Query: 196 GLGTYFAAYEA----LVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVL 251
             G YF  Y++    L+    E     + +  W + + GA + +      YP+D V+  +
Sbjct: 194 YRGLYFGLYDSFKPVLLTGALEGSFVASFLLGW-VITMGASTAS------YPLDTVRRRM 246

Query: 252 QTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPA 295
              S +  KY +  +   R + ++ G  + FKG    + R   A
Sbjct: 247 MMTSGQTIKY-DGALDCLRKIVQKEGAYSLFKGCGANIFRGVAA 289

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 88/222 (39%), Gaps = 56/222 (25%)

Query: 5   FPTPQLLNELED-VPPPTPYGR--------VVKDIFAGTMGGVAQVLVGQPFDTTKVRL- 54
           FPT  L    +D +     Y R           ++F+G   G   +L     D  + RL 
Sbjct: 88  FPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLSLLFVYSLDYARTRLA 147

Query: 55  -------QTSKTKI-GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKR 106
                   TS+ +  G+++V +  L+ +G L  Y+G +  +LG+ +   + FG+ +S K 
Sbjct: 148 ADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFK- 206

Query: 107 FFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFL------------AAPIEHVRIRL 154
                           P+ L       L G  V SFL            + P++ VR R+
Sbjct: 207 ----------------PVLLT----GALEGSFVASFLLGWVITMGASTASYPLDTVRRRM 246

Query: 155 QTQTSQGNERQFKGPFDCIKKLAK---AKALMRGLLPTMIRA 193
               + G   ++ G  DC++K+ +   A +L +G    + R 
Sbjct: 247 --MMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRG 286

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 115/299 (38%), Gaps = 41/299 (13%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQ--------TSKTKIGVIEVVQNLLRNEGALAFYKGM 83
           AG +     V V  PFD  K R+Q         +K     I+    + +NEG     KG+
Sbjct: 26  AGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQKGL 85

Query: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK--HVPLPLHQYYLCGLTGGVVNS 141
            +  L        + G  E ++          V+  K  H+ + +      G T GVV +
Sbjct: 86  ASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINV----AAGATSGVVGA 141

Query: 142 FLAAPIEHVRIRLQTQTSQ---GNERQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGH 195
           F+ +P+  V+ R+Q+ ++    G +  +   F+ +  + ++   K L RG+   M+R G 
Sbjct: 142 FIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGI 201

Query: 196 GLGTYFAAYEALVVKEF-EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVV------- 247
           G       Y   + K F  K    N      L S   ++G  + + + P DVV       
Sbjct: 202 GSAVQLPIYN--ICKNFLLKHDLMNDGTGLHLLS-STIAGFGVGVAMNPWDVVLTRVYNQ 258

Query: 248 KSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMT 306
           K  L +  I+        IK  R      G+ A +KGF   ++R  P         E T
Sbjct: 259 KGNLYSGPID------CFIKTVR----NEGLSALYKGFGAQILRIGPHTVLCLTFMEQT 307

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 70/178 (39%), Gaps = 24/178 (13%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGV---------IEVVQNLLRNEGALAF 79
           ++ AG   GV    +G P    K R+Q+    I +            +  + R+EG    
Sbjct: 129 NVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGL 188

Query: 80  YKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVV 139
           ++G+   +L  GI  +VQ  +    K F   ++        H    L    + G   GV 
Sbjct: 189 FRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLH----LLSSTIAGFGVGVA 244

Query: 140 NSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAG 194
            +    P + V  R+  Q  +GN   + GP DC  K  + +   AL +G    ++R G
Sbjct: 245 MN----PWDVVLTRVYNQ--KGN--LYSGPIDCFIKTVRNEGLSALYKGFGAQILRIG 294

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 100/269 (37%), Gaps = 16/269 (5%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLL 88
            + +G   G +  LV  P DT K RLQ                 N G    Y+G+ + ++
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQAKG----------GFFANGGYKGIYRGLGSAVV 56

Query: 89  GVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIE 148
                 S+ F   + MK     Y +          +    + L    G +    +  P E
Sbjct: 57  ASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAE 116

Query: 149 HVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALV 208
            V+ R Q  ++  + +  +       K    K L RG   T++R        F  YE L 
Sbjct: 117 VVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEYLK 176

Query: 209 VKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKA 268
            K + K   ++Q+  WK    G+++G I   T  P+D +K+ L  +     K   S+   
Sbjct: 177 -KTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLN-----KTTASLGSV 230

Query: 269 TRALYKQHGIPAFFKGFVPTMIRAAPANA 297
              +Y++ G   FF G  P  +  +   A
Sbjct: 231 IIRIYREEGPAVFFSGVGPRTMWISAGGA 259

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 24/56 (42%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGM 83
           K    G++ G        P D  K RL  +KT   +  V+  + R EG   F+ G+
Sbjct: 192 KGAICGSIAGGIAAATTTPLDFLKTRLMLNKTTASLGSVIIRIYREEGPAVFFSGV 247

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 32/75 (42%), Gaps = 15/75 (20%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTM 289
           GA +GT   L  +P+D +K+ LQ               A    +   G    ++G    +
Sbjct: 11  GAAAGTSTDLVFFPIDTIKTRLQ---------------AKGGFFANGGYKGIYRGLGSAV 55

Query: 290 IRAAPANAATFVSFE 304
           + +AP  +  F+S++
Sbjct: 56  VASAPGASLFFISYD 70

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 118/273 (43%), Gaps = 27/273 (9%)

Query: 46  PFDTTKVRLQTSKTKIGV----IEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVN 101
           PF+  K RLQ ++   G     + ++    R +GA A Y G    ++G      V+F   
Sbjct: 30  PFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVGNTCKAGVRFLGF 89

Query: 102 ESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA-APIEHVRIRLQTQTS- 159
           ++++R          D +  +  P  +  L GL  G++ S LA  P E V+  L      
Sbjct: 90  DALRRALQ-------DERGALSGP--RGMLAGLGAGLLESVLAVTPFEAVKTALIDDRQA 140

Query: 160 -----QGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEAL--VVKEF 212
                Q N R     +  + +    + L  GL+P  +R        F  Y  L   V+ +
Sbjct: 141 ARPRYQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQRY 200

Query: 213 EKGTPRNQ-IPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRA 271
             GTP +Q + + +    GALSG +      PVD VK+ +Q  +++  +Y  S +   RA
Sbjct: 201 -AGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQ--ALDAARY-GSTVGCFRA 256

Query: 272 LYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           + ++ G+ A ++G  P + R   +    F ++E
Sbjct: 257 VVREEGVRALWRGATPRLGRLVLSGGIVFTAYE 289

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 11/118 (9%)

Query: 95  SVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRL 154
           +V+FG    +K+    Y     D     PL   Q +L G   G+V  +   P++ V+ R+
Sbjct: 184 AVRFGCYTQLKQAVQRYAGTPADQ----PLGSGQTFLVGALSGIVTVYATMPVDTVKTRM 239

Query: 155 QTQTSQGNERQFKGPFDCIKKLAK---AKALMRGLLPTMIRAGHGLGTYFAAYEALVV 209
           Q      +  ++     C + + +    +AL RG  P + R     G  F AYE L+V
Sbjct: 240 QAL----DAARYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYEKLLV 293

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 7   TPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS------KTK 60
           T +L+ ++E+        ++   I  G  G  AQ  V  P DT K R+Q +      K +
Sbjct: 302 TKKLMTKVENCKDTKDLSKLSTFIAGGLAGVCAQFSV-YPIDTLKFRMQCAPLNAELKGR 360

Query: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120
             +I+  + +    G   FY+G+   +LG+    ++  G    +K+++ +  A +++ ++
Sbjct: 361 KLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKE 420

Query: 121 H-------VPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCI 173
                   V LP+      G   G   + +  PI  +R RLQ Q +  +  ++ G  D +
Sbjct: 421 EDVELSNLVVLPM------GAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVL 474

Query: 174 KKLAKAKA---LMRGLLPTMIRAGHGLGTYFAAYEAL 207
            K  + +    L +GL+PT+ +    +   +  YE L
Sbjct: 475 LKTIQREGYPGLFKGLVPTLAKVCPAVSISYLCYENL 511

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/309 (22%), Positives = 119/309 (38%), Gaps = 41/309 (13%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRL------------------------QTSKTKIGVIEVV 67
           AG + GV       PFD  KV L                        + +K +  +++ +
Sbjct: 206 AGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKAI 265

Query: 68  QNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHV-PLPL 126
            +L R  G  +FY G     L V    S++FG  E  K+        +V+  K    L  
Sbjct: 266 ISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMT-----KVENCKDTKDLSK 320

Query: 127 HQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA------- 179
              ++ G   GV   F   PI+ ++ R+Q        +  K      K++          
Sbjct: 321 LSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFY 380

Query: 180 KALMRGLLPTMIRAGHGLGTYFAA---YEALVVKEFEKGTPRNQIPAWKLCSFGALSGTI 236
           + +  G+L     A   LGT+      Y +   K+  K     ++    +   GA SGT 
Sbjct: 381 RGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTF 440

Query: 237 LWLTVYPVDVVKSVLQTD-SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPA 295
               VYP++++++ LQ   +  +P   +          ++ G P  FKG VPT+ +  PA
Sbjct: 441 GATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPA 500

Query: 296 NAATFVSFE 304
            + +++ +E
Sbjct: 501 VSISYLCYE 509

 Score = 35.4 bits (80), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 3/84 (3%)

Query: 225 KLCSF--GALSGTILWLTVYPVDVVKSVLQTDSIENP-KYKNSIIKATRALYKQHGIPAF 281
           KL +F  G L+G     +VYP+D +K  +Q   +    K +  +I+  + +Y + G+  F
Sbjct: 320 KLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLF 379

Query: 282 FKGFVPTMIRAAPANAATFVSFEM 305
           ++G    ++   P  A    +F M
Sbjct: 380 YRGVTVGVLGIFPYAALDLGTFSM 403

 Score = 35.0 bits (79), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 46/96 (47%), Gaps = 19/96 (19%)

Query: 230 GALSGTILWLTVYPVDVVKSVL--QTD-------SIE-----NP-----KYKNSIIKATR 270
           G +SG I      P D +K  L  +TD       S E     NP     K ++ ++KA  
Sbjct: 207 GGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKAII 266

Query: 271 ALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMT 306
           +LY+Q GI +F+ G     ++  P ++  F SFE+T
Sbjct: 267 SLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEIT 302

>Scas_718.24
          Length = 337

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 85/185 (45%), Gaps = 17/185 (9%)

Query: 118 PQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTS---QGN-ERQFKGPFDCI 173
           PQ +  +     +L G     V    A+PIE V++ +Q Q     QG  + ++KG  DC 
Sbjct: 38  PQSNFAID----FLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCF 93

Query: 174 KKLAKAKALM---RGLLPTMIRAGHGLGTYFAAYEAL-VVKEFEKGTPRNQIPAWKLCSF 229
           ++ A+ + ++   RG    +IR        FA  + + ++  F+K     +  A  L S 
Sbjct: 94  RRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEDGYGKWFAGNLASG 153

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYK----NSIIKATRALYKQHGIPAFFKGF 285
           GA  G  L L VY +D  ++ L  DS  + K      N +I   +   K  G+   ++GF
Sbjct: 154 GAAGGLSL-LFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGF 212

Query: 286 VPTMI 290
           +P+++
Sbjct: 213 LPSVV 217

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/281 (21%), Positives = 111/281 (39%), Gaps = 37/281 (13%)

Query: 35  MGGVAQVLV---GQPFDTTKVRLQ---------TSKTKI-GVIEVVQNLLRNEGALAFYK 81
           MGGV+  +      P +  K+ +Q         T  TK  G+++  +   + EG ++F++
Sbjct: 48  MGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGIISFWR 107

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G    ++      ++ F   + +K  F     D         L        G   G ++ 
Sbjct: 108 GNTANVIRYFPTQALNFAFKDKIKLMFGFKKEDGYGKWFAGNLA------SGGAAGGLSL 161

Query: 142 FLAAPIEHVRIRL---QTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGH 195
                ++  R RL      + +G  RQF G  D  KK  K+     L RG LP+++    
Sbjct: 162 LFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIV 221

Query: 196 GLGTYFAAYEA----LVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVL 251
             G YF  Y++    L+    E     + +  W + + GA + +      YP+D V+  +
Sbjct: 222 YRGLYFGLYDSIKPVLLTGSLEGSFLASFLLGWVVTT-GASTCS------YPLDTVRRKM 274

Query: 252 QTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRA 292
              S +  KYK +     + +    G+ + FKG    ++R 
Sbjct: 275 MMTSGQAVKYKGA-FDCFKKIVAAEGVASLFKGCGANILRG 314

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 89/211 (42%), Gaps = 57/211 (27%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQT---------SKTKIGVIEVVQNLLRNEGALAFYKG 82
            G  GG++ + V    D  + RL           S+   G+I+V +  L+++G    Y+G
Sbjct: 153 GGAAGGLSLLFV-YSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRG 211

Query: 83  MLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSF 142
            L  ++G+ +   + FG+ +S+K                 P+         LTG +  SF
Sbjct: 212 FLPSVVGIIVYRGLYFGLYDSIK-----------------PVL--------LTGSLEGSF 246

Query: 143 LAA----------------PIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALM 183
           LA+                P++ VR ++    + G   ++KG FDC KK+  A+   +L 
Sbjct: 247 LASFLLGWVVTTGASTCSYPLDTVRRKM--MMTSGQAVKYKGAFDCFKKIVAAEGVASLF 304

Query: 184 RGLLPTMIRAGHGLGTYFAAYEALVVKEFEK 214
           +G    ++R   G G   + Y+ L +  F K
Sbjct: 305 KGCGANILRGVAGAGV-ISMYDQLQMILFGK 334

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/302 (21%), Positives = 120/302 (39%), Gaps = 43/302 (14%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVR-----LQTSKTKIGVIEVVQNLLRNEGALAFYKGM 83
            + AG++ GV   +   P DT K+R     +Q  K K G+   V+ +++ EG  A +KG 
Sbjct: 21  SVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYK-GIASTVRTIMKEEGLRALWKGN 79

Query: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNAD--RVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           +       +  +VQFG   S   F   ++A   R   Q        Q    G   G+ +S
Sbjct: 80  IPATAMYVVYGAVQFG---SYSWFNNVWSAKFPRFSQQG-------QTLTVGALAGMTSS 129

Query: 142 FLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK--AKALMRGLLPTMIRAGHGLGT 199
            ++ P++ +R RL    +     +     +C +       +    G+   M         
Sbjct: 130 VVSYPLDLLRTRL---IANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAI 186

Query: 200 YFAAYEA--LVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIE 257
            F  YE   +V +  EK      + A    S G ++G +    V+P+D ++  +Q  + +
Sbjct: 187 MFLTYETVNIVCENHEKEFWSRPVSA----SSGIIAGFVSKTMVFPIDTLRRRMQVMNSK 242

Query: 258 NP-------------KYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
                          +YK+S     + L +Q G+ A ++G    + ++ P  A +   +E
Sbjct: 243 RTVHFTKFPAVYHEYRYKSSTAIIYKIL-RQEGVSALYRGLTMGLCKSVPTTAISLFVYE 301

Query: 305 MT 306
            T
Sbjct: 302 RT 303

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 110/286 (38%), Gaps = 36/286 (12%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI-GVIEVVQNLLRNEGALAFYKGMLT 85
           V  +      G+ ++ V  P DT   RL ++ TKI    ++   + R+  A AF K + T
Sbjct: 11  VARLLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAFGKRVFT 70

Query: 86  PLLGVGICVSVQ-------FG--------VNESMKRFFAAYNADRVDPQKHVPLPLHQYY 130
              G+G     +       +G        +N+  K+ F +   D+          L    
Sbjct: 71  LFPGLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGK------ALRSAT 124

Query: 131 LCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGP-FDCIKKLAKAKALMRGLLPT 189
              L G  +   +  P++ ++I+ QT     N   FKG  F  I K      L RG   T
Sbjct: 125 AGSLIG--IGEIVLLPLDVLKIKRQT-----NPEAFKGRGFLKILKDEGIFNLYRGWGWT 177

Query: 190 MIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVY-PVDVVK 248
             R   G    F        KE+  G        W      ++ G    L V  P+DV+K
Sbjct: 178 AARNAPGSFALFGGNA--FAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIK 235

Query: 249 SVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
           + +Q  + +NP+    I+K T    K  G  AFFKG  P ++   P
Sbjct: 236 TRIQNRNFDNPESGFKIVKNT---LKNEGFTAFFKGLTPKLLTTGP 278

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSK--TKIGVIEVVQNLLRNEGALAFYKGMLT 85
           ++  +  +G  A ++V  P D  K R+Q           ++V+N L+NEG  AF+KG+  
Sbjct: 212 QNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKNEGFTAFFKGLTP 271

Query: 86  PLLGVGICVSVQFGVNESM 104
            LL  G  +   F + +S+
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>Kwal_27.11626
          Length = 299

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 115/287 (40%), Gaps = 39/287 (13%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLL-RNEGALAFYKGMLT 85
           +  +      G+ ++ V  P DT   RL ++ TKI     + +++ R     A  K + T
Sbjct: 10  IARVLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVIFREHAGEALGKRLFT 69

Query: 86  PLLGVGICVSVQ-------FG----VNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGL 134
              G+G   S +       +G     NE + + F A + D    +K     L       L
Sbjct: 70  LFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKA-DFDNAFGEK-TGKALRSATAGSL 127

Query: 135 TGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLA-KAKALMRGLLPTMIRA 193
            G  +   +  P++ ++I+ QT     N   FKG    IK L  +   L RG   T  R 
Sbjct: 128 IG--IGEIVLLPLDVLKIKRQT-----NPESFKGR-GFIKILKDEGFGLYRGWGWTAARN 179

Query: 194 GHGL-----GTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVY-PVDVV 247
             G      G  FA    L +K++   T       W      ++ G    L V  P+DV+
Sbjct: 180 APGSFALFGGNAFAKEYILGLKDYSSAT-------WSQNFVSSIVGASASLIVSAPLDVI 232

Query: 248 KSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
           K+ +Q    +NP+    I++ T    K  GI AFFKG  P ++   P
Sbjct: 233 KTRIQNRHFDNPESGFRIVQNT---LKNEGITAFFKGLTPKLLTTGP 276

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 6/93 (6%)

Query: 14  LEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS--KTKIGVIEVVQNLL 71
           L+D    T     V  I    +G  A ++V  P D  K R+Q            +VQN L
Sbjct: 200 LKDYSSATWSQNFVSSI----VGASASLIVSAPLDVIKTRIQNRHFDNPESGFRIVQNTL 255

Query: 72  RNEGALAFYKGMLTPLLGVGICVSVQFGVNESM 104
           +NEG  AF+KG+   LL  G  +   F + +S+
Sbjct: 256 KNEGITAFFKGLTPKLLTTGPKLVFSFALAQSL 288

>Scas_667.4
          Length = 308

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 108/281 (38%), Gaps = 37/281 (13%)

Query: 35  MGGVAQVLV---GQPFDTTKVRLQTSKTKI----------GVIEVVQNLLRNEGALAFYK 81
           MGGV+  +      P +  K+ +Q     I          G+IE  Q   + EG +AF++
Sbjct: 19  MGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTAKTEGIIAFWR 78

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G    ++      ++ F   + +K  F          ++            G   G ++ 
Sbjct: 79  GNTANVIRYFPTQALNFAFKDKIKAMFG------FKKEEGYGKWFAGNLASGGAAGGLSL 132

Query: 142 FLAAPIEHVRIRLQTQ---TSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGH 195
                +++ R RL      + +G  RQ+KG  D  K+         L RG LP+++    
Sbjct: 133 LFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFLPSVVGIIV 192

Query: 196 GLGTYFAAYEAL----VVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVL 251
             G YF  Y++L    +    E     + +  W + + GA + +      YP+D V+  +
Sbjct: 193 YRGLYFGLYDSLKPAVLTGSLEGSFLASFLLGW-IVTTGASTAS------YPLDTVRRRM 245

Query: 252 QTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRA 292
              S +  KY +      R +    G+ + FKG    ++R 
Sbjct: 246 MMTSGQAVKY-DGAFDCFRKVVAAEGVSSLFKGCGANILRG 285

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 85/211 (40%), Gaps = 57/211 (27%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQT---------SKTKIGVIEVVQNLLRNEGALAFYKG 82
            G  GG++ + V    D  + RL           S+   G+I+V +  L  +G    Y+G
Sbjct: 124 GGAAGGLSLLFV-YSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRG 182

Query: 83  MLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSF 142
            L  ++G+ +   + FG+ +S+K                 P          LTG +  SF
Sbjct: 183 FLPSVVGIIVYRGLYFGLYDSLK-----------------PAV--------LTGSLEGSF 217

Query: 143 LAA----------------PIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALM 183
           LA+                P++ VR R+    + G   ++ G FDC +K+  A+   +L 
Sbjct: 218 LASFLLGWIVTTGASTASYPLDTVRRRM--MMTSGQAVKYDGAFDCFRKVVAAEGVSSLF 275

Query: 184 RGLLPTMIRAGHGLGTYFAAYEALVVKEFEK 214
           +G    ++R   G G   + Y+ L +  F K
Sbjct: 276 KGCGANILRGVAGAGV-ISMYDQLQMIMFGK 305

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 13/173 (7%)

Query: 130 YLCGLTGGVVNSFLAAPIEHVRIRLQTQTS---QGN-ERQFKGPFDCIKKLAKAKALM-- 183
           +L G     V    A+PIE V++ +Q Q     QG  +R++ G  DC K+ A  + ++  
Sbjct: 27  FLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISF 86

Query: 184 -RGLLPTMIRAGHGLGTYFAAYEAL-VVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTV 241
            RG    +IR        FA  + +  +  F+K     +  A  L S GA +G +  L V
Sbjct: 87  WRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGA-AGALSLLFV 145

Query: 242 YPVDVVKSVLQTDSIENPKYK----NSIIKATRALYKQHGIPAFFKGFVPTMI 290
           Y +D  ++ L  DS  + K      N +I   +   K  G+   ++GF+P+++
Sbjct: 146 YSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVV 198

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/281 (19%), Positives = 108/281 (38%), Gaps = 37/281 (13%)

Query: 35  MGGVAQVLV---GQPFDTTKVRLQTSKTKI----------GVIEVVQNLLRNEGALAFYK 81
           MGGV+  +      P +  K+ +Q     +          G+++  +     EG ++F++
Sbjct: 29  MGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFWR 88

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G    ++      ++ F   + +K  F          ++            G   G ++ 
Sbjct: 89  GNTANVIRYFPTQALNFAFKDKIKAMFG------FKKEEGYAKWFAGNLASGGAAGALSL 142

Query: 142 FLAAPIEHVRIRLQTQ---TSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGH 195
                +++ R RL      + +G  RQF G  D  KK  K+     L RG LP+++    
Sbjct: 143 LFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVV 202

Query: 196 GLGTYFAAYEA----LVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVL 251
             G YF  Y++    L+    E     + +  W + + GA + +      YP+D V+  +
Sbjct: 203 YRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTT-GASTCS------YPLDTVRRRM 255

Query: 252 QTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRA 292
              S +  KY +      R +    G+ + FKG    ++R 
Sbjct: 256 MMTSGQAVKY-DGAFDCLRKIVAAEGVGSLFKGCGANILRG 295

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 76/172 (44%), Gaps = 47/172 (27%)

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
           G+I+V +  L+++G    Y+G L  ++G+ +   + FG+ +S+K                
Sbjct: 172 GLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLK---------------- 215

Query: 122 VPLPLHQYYLCGLTGGVVNSFLAA----------------PIEHVRIRLQTQTSQGNERQ 165
            PL         LTG +  SFLA+                P++ VR R+    + G   +
Sbjct: 216 -PLL--------LTGSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRRM--MMTSGQAVK 264

Query: 166 FKGPFDCIKKLAKAK---ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEK 214
           + G FDC++K+  A+   +L +G    ++R   G G   + Y+ L +  F K
Sbjct: 265 YDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGV-ISMYDQLQMILFGK 315

>Scas_717.20
          Length = 356

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/319 (20%), Positives = 121/319 (37%), Gaps = 57/319 (17%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSK--------TKIGVIEVVQNLLRNEGALAFYKGML 84
           G  G  A+ L+  P D  K+  QTS         + +G+ E  +++  N+G   F++G  
Sbjct: 40  GISGSCAKTLIA-PLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGHS 98

Query: 85  TPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA 144
             L+ +    +V+F   E ++        + + P K       +  + G   G+ + F  
Sbjct: 99  VTLMRIFPYAAVKFVAYEQIR--------NTLIPSKEYESHWRRL-MSGSLAGLCSVFTT 149

Query: 145 APIEHVRIRLQTQTSQGN-------ERQFKGPFDCIKK--------LAKAKALMRGLLPT 189
            P++ +R+RL   T           +  +K P     +         A      RG  PT
Sbjct: 150 YPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTPT 209

Query: 190 MIRAGHGLGTYFAAYE-----------------ALVVKEFEKGTPRNQ---IPAWKLCSF 229
           ++      G  F A++                 AL   E E+   ++Q   +  W     
Sbjct: 210 VLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTWAELLS 269

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKN----SIIKATRALYKQHGIPAFFKGF 285
           G L+G       YP ++++  LQ  ++   +  +    SI +  + +YK+ G   FF G 
Sbjct: 270 GGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFFVGL 329

Query: 286 VPTMIRAAPANAATFVSFE 304
               I+  P  A +F  +E
Sbjct: 330 SIGYIKVTPMVACSFFVYE 348

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSII---KATRALYKQHGIPAFFKGFV 286
           G +SG+     + P+D +K + QT +    KY  S++   +A + ++   GI  FF+G  
Sbjct: 39  GGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGHS 98

Query: 287 PTMIRAAPANAATFVSFE 304
            T++R  P  A  FV++E
Sbjct: 99  VTLMRIFPYAAVKFVAYE 116

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 86/204 (42%), Gaps = 44/204 (21%)

Query: 133 GLTGGVVNSF---LAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA-------KAL 182
           GL GG+  S    L AP++  RI++  QTS  +  ++ G    +K+ AK        +  
Sbjct: 36  GLAGGISGSCAKTLIAPLD--RIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGF 93

Query: 183 MRGLLPTMIRAGHGLGTYFAAYEALV-----VKEFEKGTPRNQIPAWKLCSFGALSGTIL 237
            +G   T++R        F AYE +       KE+E          W+    G+L+G   
Sbjct: 94  FQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYES--------HWRRLMSGSLAGLCS 145

Query: 238 WLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHG---------IP-------AF 281
             T YP+D+++  L   +      + S++   + +YK+           IP        F
Sbjct: 146 VFTTYPLDLIRVRL---AYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNF 202

Query: 282 FKGFVPTMIRAAPANAATFVSFEM 305
           ++G+ PT++   P    +F + ++
Sbjct: 203 YRGYTPTVLGMIPYAGVSFFAHDL 226

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 76/199 (38%), Gaps = 33/199 (16%)

Query: 19  PPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ--TSKTKIGVIEVVQNLLRNEGA 76
           P   Y    + + +G++ G+  V    P D  +VRL   T   +I ++ +V+ + +   +
Sbjct: 124 PSKEYESHWRRLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPAS 183

Query: 77  LA----------------FYKGMLTPLLGVGICVSVQFGVNESMKR-----FFAAYNADR 115
                             FY+G    +LG+     V F  ++ +         A Y+   
Sbjct: 184 TTLEAKGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLA 243

Query: 116 VDPQ-------KHVPLPLHQY--YLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQF 166
           +          KH  LPL  +   L G   G+ +   A P E +R RLQ  T   ++  +
Sbjct: 244 LSESEQEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQ-MY 302

Query: 167 KGPFDCIKKLAKAKALMRG 185
              F  I ++AK     RG
Sbjct: 303 DHRFQSISEIAKIIYKERG 321

 Score = 34.7 bits (78), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 9/90 (10%)

Query: 25  RVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------GVIEVVQNLLRNEG 75
           R   ++ +G + G+A      PF+  + RLQ S   +          + E+ + + +  G
Sbjct: 262 RTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERG 321

Query: 76  ALAFYKGMLTPLLGVGICVSVQFGVNESMK 105
              F+ G+    + V   V+  F V E MK
Sbjct: 322 WRGFFVGLSIGYIKVTPMVACSFFVYERMK 351

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 112/269 (41%), Gaps = 35/269 (13%)

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
           G +E  + + + EG    ++G+   LL + I  +V +         F  Y   R     +
Sbjct: 112 GTLEAFEKIAKFEGVTTLWRGISITLL-MAIPANVVY---------FTGYEYVRDRSPLN 161

Query: 122 VPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTS----QGNERQFKGPFDCIKK-- 175
              P     +CG     + +   AP+E ++ +LQ+  S     G+   ++  F+ IK   
Sbjct: 162 GLYPTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEI 221

Query: 176 --LAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVK-------EFEKGTPRNQIPAWKL 226
                A+ + +GL  T+ R       Y+A+YE    K        F+K +  N       
Sbjct: 222 AMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSS-NWFHFTNS 280

Query: 227 CSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIK--ATRALY-------KQHG 277
              G +SG++  +  +P DV K+  Q   + + K  NS +K  ++  ++       K  G
Sbjct: 281 FLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEG 340

Query: 278 IPAFFKGFVPTMIRAAPANAATFVSFEMT 306
           I A + G  P + + AP+ A    S+E+T
Sbjct: 341 IGALYTGLAPRVAKIAPSCAIMISSYELT 369

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 117/284 (41%), Gaps = 38/284 (13%)

Query: 37  GVAQVLVGQPFDTTKVRLQTSKTKI-GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVS 95
           G+ ++ V  P DT   RL ++ TKI    E+ + + R+  +    K + T   G+G   S
Sbjct: 21  GIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFTLFPGLGYAAS 80

Query: 96  VQ-------FG----VNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA 144
            +       +G     NE + + +   + D +  +K     +       L G  +   + 
Sbjct: 81  YKVLQRVYKYGGQPFANEFLNKHYKK-DFDNLFGEK-TGKAMRSAAAGSLIG--IGEIVL 136

Query: 145 APIEHVRIRLQTQTSQGNERQFKGP-FDCIKKLAKAKALMRGLLPTMIRAGHGL-----G 198
            P++ ++I+ QT     N   FKG  F  I +      L RG   T  R   G      G
Sbjct: 137 LPLDVLKIKRQT-----NPESFKGRGFIKILRDEGLFNLYRGWGWTAARNAPGSFALFGG 191

Query: 199 TYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVY-PVDVVKSVLQTDSIE 257
             FA    L +K++ + T       W      ++ G    L V  P+DV+K+ +Q  + +
Sbjct: 192 NAFAKEYILGLKDYSQAT-------WSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFD 244

Query: 258 NPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFV 301
           NP+    I+K T    K  G+ AFFKG  P ++   P    +F 
Sbjct: 245 NPESGLRIVKNT---LKNEGVTAFFKGLTPKLLTTGPKLVFSFA 285

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSK--TKIGVIEVVQNLLRNEGALAFYKGMLT 85
           ++  +  +G  + ++V  P D  K R+Q          + +V+N L+NEG  AF+KG+  
Sbjct: 212 QNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTAFFKGLTP 271

Query: 86  PLLGVGICVSVQFGVNESM 104
            LL  G  +   F + +S+
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 79/188 (42%), Gaps = 16/188 (8%)

Query: 24  GRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---GVIEVVQNLLRNEGALAFY 80
           G+ ++   AG++ G+ ++++  P D  K++ QT+       G I++    LR+EG    Y
Sbjct: 117 GKAMRSAAAGSLIGIGEIVL-LPLDVLKIKRQTNPESFKGRGFIKI----LRDEGLFNLY 171

Query: 81  KGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVN 140
           +G               FG N   K +           + +      Q ++  + G   +
Sbjct: 172 RGWGWTAARNAPGSFALFGGNAFAKEYILGL-------KDYSQATWSQNFISSIVGACSS 224

Query: 141 SFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTY 200
             ++AP++ ++ R+Q +     E   +   + +K      A  +GL P ++  G  L   
Sbjct: 225 LIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKN-EGVTAFFKGLTPKLLTTGPKLVFS 283

Query: 201 FAAYEALV 208
           FA  ++L+
Sbjct: 284 FALAQSLI 291

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/290 (20%), Positives = 109/290 (37%), Gaps = 55/290 (18%)

Query: 35  MGGVAQVLV---GQPFDTTKVRLQTSKTKI----------GVIEVVQNLLRNEGALAFYK 81
           MGGV+  +      P +  K+ +Q     I          G+++  +   + EG ++F++
Sbjct: 18  MGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWR 77

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G    ++      ++ F   + +K  F          ++            G   G ++ 
Sbjct: 78  GNTANVIRYFPTQALNFAFKDKIKLMFG------FKKEEGYGKWFAGNLASGGAAGALSL 131

Query: 142 FLAAPIEHVRIRLQTQ---TSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGH 195
                ++  R RL      + +G  RQF G  D  KK  K+     L RG +P+++    
Sbjct: 132 LFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVV 191

Query: 196 GLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTIL------WLTV-------Y 242
             G YF  +++L         P        L   G+L G+ L      W+         Y
Sbjct: 192 YRGLYFGMFDSL--------KP--------LVLTGSLDGSFLASFLLGWVVTTGASTCSY 235

Query: 243 PVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRA 292
           P+D V+  +   S +  KY N  I   + +    G+ + FKG    ++R+
Sbjct: 236 PLDTVRRRMMMTSGQAVKY-NGAIDCLKKIVASEGVGSLFKGCGANILRS 284

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 99/246 (40%), Gaps = 64/246 (26%)

Query: 5   FPTPQLLNELED-------VPPPTPYGR-VVKDIFAGTMGGVAQVLVGQPFDTTKVRL-- 54
           FPT  L    +D             YG+    ++ +G   G   +L     D  + RL  
Sbjct: 87  FPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLASGGAAGALSLLFVYSLDFARTRLAA 146

Query: 55  --QTSKTK-----IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRF 107
             ++SK        G+ +V +  L+++G    Y+G +  ++G+ +   + FG+ +S+K  
Sbjct: 147 DAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLK-- 204

Query: 108 FAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAA----------------PIEHVR 151
                          PL         LTG +  SFLA+                P++ VR
Sbjct: 205 ---------------PLV--------LTGSLDGSFLASFLLGWVVTTGASTCSYPLDTVR 241

Query: 152 IRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGHGLGTYFAAYEALV 208
            R+    + G   ++ G  DC+KK+  ++   +L +G    ++R+  G G   + Y+ L 
Sbjct: 242 RRM--MMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGV-ISMYDQLQ 298

Query: 209 VKEFEK 214
           +  F K
Sbjct: 299 MILFGK 304

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 78/175 (44%), Gaps = 23/175 (13%)

Query: 129 YYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLP 188
           + + G  GG+ +     P++ ++ RLQ       + Q       ++++   + L RG LP
Sbjct: 11  HLVSGFFGGLASVCALQPLDLLKTRLQ-------QAQASSLRSVLREVRTTRELWRGTLP 63

Query: 189 TMIRAGHGLGTYFAAY---EALVVKEFEKGTPRNQIPAWKLCSF-----GALSGTILWLT 240
           + +R   G   Y +      + + +  E  T  + +P  +L S+     GALS   + L 
Sbjct: 64  SALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLP--RLQSYQNLLTGALSRAAVGLV 121

Query: 241 VYPVDVVKSVLQTDSIENPKYK-NSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
             P+ V+K        E+  Y  N + +ATR +++  G   FFKG   T +R AP
Sbjct: 122 TMPITVIKV-----RYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAP 171

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 42/99 (42%), Gaps = 1/99 (1%)

Query: 10  LLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQN 69
           LL   E      P   +V  + A     +A  L   PFDT K R+Q     +G ++ +++
Sbjct: 195 LLGADESGKLTAPASAMVNGVSAFLSASLATTLTA-PFDTIKTRMQLQSHPVGFVQTLRH 253

Query: 70  LLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFF 108
           ++  E A   + G+   L    +   + +G+ E + +  
Sbjct: 254 IVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELLKLL 292

 Score = 31.2 bits (69), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 74/189 (39%), Gaps = 20/189 (10%)

Query: 24  GRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRN-EGALAFYKG 82
           G V   + +G  GG+A V   QP D  K RLQ ++        ++++LR        ++G
Sbjct: 6   GGVPAHLVSGFFGGLASVCALQPLDLLKTRLQQAQA-----SSLRSVLREVRTTRELWRG 60

Query: 83  MLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS- 141
            L   L   I  ++   +    +   A  +  R    +   LP  Q Y   LTG +  + 
Sbjct: 61  TLPSALRTSIGSALYLSLLNYSRSALARGSEART---RSSLLPRLQSYQNLLTGALSRAA 117

Query: 142 --FLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK---AKALMRGLLPTMIRAGHG 196
              +  PI  +++R ++         + G  +  + + +   A+   +G   T +R    
Sbjct: 118 VGLVTMPITVIKVRYESTLY-----AYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPY 172

Query: 197 LGTYFAAYE 205
            G Y   YE
Sbjct: 173 AGLYVLLYE 181

>Kwal_26.7972
          Length = 358

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 67/318 (21%), Positives = 113/318 (35%), Gaps = 65/318 (20%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSK--------TKIGVIEVVQNLLRNEGALAFYKGML 84
           G  G  A+ L+  P D  K+  QTS         + +G+I    ++  ++G   FY+G  
Sbjct: 35  GIAGSCAKTLIA-PLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQGHS 93

Query: 85  TPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLC-GLTGGVVNSFL 143
             L+ +    +++F   E ++ F          P K      H   L  G   G+ + F+
Sbjct: 94  ATLIRIFPYAAIKFIAYEQIRHFMI--------PSKE--YETHARRLASGSMAGLCSVFM 143

Query: 144 AAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA-------------------LMR 184
             P++ +R+RL   T +   +        IK++   +A                     R
Sbjct: 144 TYPLDLIRVRLAYVTDRSRIKMLP----VIKQIYTERASESLTSKSYVPRWFAHWCNFYR 199

Query: 185 GLLPTMIRAGHGLGTYFAA---------------YEALVVKEFE-----KGTPRNQIPAW 224
           G  PT++      G  F A               Y  L + + E     K      +  W
Sbjct: 200 GFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTW 259

Query: 225 KLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKN--SIIKATRALYKQHGIPAFF 282
                G L+G       YP ++++  LQ   +      N  +I    R +YK+ G   FF
Sbjct: 260 AELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFF 319

Query: 283 KGFVPTMIRAAPANAATF 300
            G     I+  P  A +F
Sbjct: 320 VGLSIGYIKVTPMVACSF 337

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNS---IIKATRALYKQHGIPAFFKGFV 286
           G ++G+     + P+D +K + QT +    KY  S   +I+A   +    GI  F++G  
Sbjct: 34  GGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQGHS 93

Query: 287 PTMIRAAPANAATFVSFE 304
            T+IR  P  A  F+++E
Sbjct: 94  ATLIRIFPYAAIKFIAYE 111

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 86/202 (42%), Gaps = 28/202 (13%)

Query: 127 HQYYLCGLTGGVVNSF---LAAPIEHVRIRLQTQTSQGNERQFKGP-FDCIKKLAKAKA- 181
           H     GL GG+  S    L AP++  RI++  QTS  +  ++ G     I+  A   A 
Sbjct: 25  HYILRSGLAGGIAGSCAKTLIAPLD--RIKILFQTSNPHYLKYSGSTMGLIRAGAHINAH 82

Query: 182 -----LMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTI 236
                  +G   T+IR        F AYE   ++ F   +   +  A +L S G+++G  
Sbjct: 83  DGIRGFYQGHSATLIRIFPYAAIKFIAYEQ--IRHFMIPSKEYETHARRLAS-GSMAGLC 139

Query: 237 LWLTVYPVDVVKSVLQTDSIENPKYKNSIIK------ATRALYKQHGIPA-------FFK 283
                YP+D+++  L   +  +      +IK      A+ +L  +  +P        F++
Sbjct: 140 SVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYR 199

Query: 284 GFVPTMIRAAPANAATFVSFEM 305
           GF PT++   P    +F + ++
Sbjct: 200 GFTPTVLGMIPYAGVSFFAHDL 221

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/148 (19%), Positives = 59/148 (39%), Gaps = 18/148 (12%)

Query: 19  PPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ--TSKTKIGVIEVVQNLLRNEGA 76
           P   Y    + + +G+M G+  V +  P D  +VRL   T +++I ++ V++ +     +
Sbjct: 119 PSKEYETHARRLASGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERAS 178

Query: 77  LAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCG--L 134
            +       P      C             F+  +    +    +  +    + LCG  L
Sbjct: 179 ESLTSKSYVPRWFAHWC------------NFYRGFTPTVLGMIPYAGVSFFAHDLCGDIL 226

Query: 135 TGGVVNSFLAAPI--EHVRIRLQTQTSQ 160
             G ++ +   PI  E + IR + Q+S+
Sbjct: 227 RSGALSPYSVLPISDEELTIRSKKQSSR 254

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 60/280 (21%), Positives = 109/280 (38%), Gaps = 37/280 (13%)

Query: 35  MGGVAQVL---VGQPFDTTKVRLQTSKTKI----------GVIEVVQNLLRNEGALAFYK 81
           MGGV+  +      P +  K+ +Q     I          G++E  +    +EG  +F++
Sbjct: 16  MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGVASFWR 75

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G    ++      ++ F   + +K  F          ++            G   G ++ 
Sbjct: 76  GNTANVIRYFPTQALNFAFKDKIKAMFG------FKKEEGYAKWFAGNLASGGLAGGLSL 129

Query: 142 FLAAPIEHVRIRLQTQT---SQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGH 195
                +++ R RL   +    +G ERQF G  D  KK   +     L RG LP+++    
Sbjct: 130 LFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVV 189

Query: 196 GLGTYFAAYEA----LVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVL 251
             G YF  Y++    L+    E     + +  W + + GA + +      YP+D V+  +
Sbjct: 190 YRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAVTT-GASTAS------YPLDTVRRRM 242

Query: 252 QTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIR 291
              S +  KY +    A R +    GI + FKG    ++R
Sbjct: 243 MMTSGQAVKY-DGAFDAFRKIVAAEGIKSLFKGCGANILR 281

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 74/172 (43%), Gaps = 47/172 (27%)

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
           G+++V +  L ++G    Y+G L  ++G+ +   + FG+ +S+K                
Sbjct: 159 GLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSLK---------------- 202

Query: 122 VPLPLHQYYLCGLTGGVVNSFLAA----------------PIEHVRIRLQTQTSQGNERQ 165
            PL         LTG + NSFLA+                P++ VR R+    + G   +
Sbjct: 203 -PLL--------LTGSLENSFLASFLLGWAVTTGASTASYPLDTVRRRM--MMTSGQAVK 251

Query: 166 FKGPFDCIKKLAKA---KALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEK 214
           + G FD  +K+  A   K+L +G    ++R   G G   + Y+ L V  F K
Sbjct: 252 YDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGV-ISMYDQLQVILFGK 302

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 115/298 (38%), Gaps = 39/298 (13%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQN--------LLRNEGALAFYKGM 83
           AG +     V V  P +  K+R+Q     +   + +          + RNEG     KG+
Sbjct: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83

Query: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNA--DRV---DPQKHVPLPLHQYYLCGLTGGV 138
           +   +        Q  +N S   F+    A  ++    D + H    +      G   G+
Sbjct: 84  VAAYI-------YQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGI 136

Query: 139 VNSFLAAPIEHVRIRLQTQTSQ---GNERQFKGPFDCIKKL---AKAKALMRGLLPTMIR 192
           + + + +P+  V+ RLQ+ ++    G +  + G ++ +K +      K L RG+   ++R
Sbjct: 137 IGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILR 196

Query: 193 AGHGLGTYFAAYEALVVKEFEKGTPRNQI----PAWKLCSFGALSGTILWLTVYPVDVVK 248
            G G       Y     K F     RN I    P+  L +   +SG  + + + P DV+ 
Sbjct: 197 TGAGSSVQLPIYNT--AKNF---LLRNDIMEDGPSLHLTA-STISGLGVAVVMNPWDVIL 250

Query: 249 SVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMT 306
           + +     +   YK  I    + + K  GI A +KGF   + R  P         E T
Sbjct: 251 TRIYNQ--KGDLYKGPIDCLVKTV-KIEGITALYKGFEAQVFRIGPHTILCLTFLEQT 305

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 71/178 (39%), Gaps = 24/178 (13%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------GVIEVVQNLLRNEGALAF 79
           ++FAG   G+   ++G P    K RLQ+    I         GV   ++ +   EG    
Sbjct: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186

Query: 80  YKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVV 139
           ++G+   +L  G   SVQ  +  + K F    +     P  H    L    + GL   VV
Sbjct: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLH----LTASTISGLGVAVV 242

Query: 140 NSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAG 194
            +    P + +  R+  Q        +KGP DC+ K  K +   AL +G    + R G
Sbjct: 243 MN----PWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITALYKGFEAQVFRIG 292

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 80/174 (45%), Gaps = 20/174 (11%)

Query: 129 YYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLP 188
           + + G +GG+V++ +  P + ++ RLQ       + +    +  +K +     L RG LP
Sbjct: 10  HLIGGFSGGLVSAIILQPFDLLKTRLQ-------QDKTSTLWKTLKSIETPSQLWRGALP 62

Query: 189 TMIRAGHGLGTYFAAYEAL---VVKEFEKGTPRN----QIPAWKLCSFGALSGTILWLTV 241
           + IR   G   Y     ++   + K    G+  +    Q+  ++    GA++  +  L  
Sbjct: 63  SCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLIT 122

Query: 242 YPVDVVKSVLQTDSIENPKYKNSIIK-ATRALYKQHGIPAFFKGFVPTMIRAAP 294
            P+ V+K        E+  Y+ + ++ AT  +++  G+  FF+GF  T +R AP
Sbjct: 123 MPITVIKV-----RYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAP 171

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/186 (18%), Positives = 71/186 (38%), Gaps = 7/186 (3%)

Query: 25  RVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGML 84
           R    +  G  GG+   ++ QPFD  K RLQ  KT      + + L   E     ++G L
Sbjct: 6   RATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTS----TLWKTLKSIETPSQLWRGAL 61

Query: 85  TPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVP-LPLHQYYLCGLTGGVVNSFL 143
              +   +  ++   +  S+++  +           ++P L +++    G     +   +
Sbjct: 62  PSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLI 121

Query: 144 AAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAA 203
             PI  +++R ++   Q    ++      I +    +   RG   T +R     G Y   
Sbjct: 122 TMPITVIKVRYESTLYQYTSLRYAT--SHIFRTEGLRGFFRGFGATALRDAPYAGLYMLF 179

Query: 204 YEALVV 209
           Y+ + V
Sbjct: 180 YDRMKV 185

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 76/176 (43%), Gaps = 21/176 (11%)

Query: 128 QYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLL 187
            + + G  GG+ ++ +  P + ++ RLQ    Q  +    G    +K++   K L RG L
Sbjct: 9   SHLIGGFVGGLTSAIVLQPFDLLKTRLQ----QNKDTTLWG---TLKEIRSPKQLWRGAL 61

Query: 188 PTMIRAGHGLGTYFAAYEALVVKEFEKGTPRN---------QIPAWKLCSFGALSGTILW 238
           P+ +R   G   Y +           KG  +          Q+  ++  + GA +  ++ 
Sbjct: 62  PSSLRTSIGSALYLSTLNVFRT-AMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVG 120

Query: 239 LTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
               P+ ++K   ++       YK S+ +ATR +Y   GI  FF G   T++R AP
Sbjct: 121 FITMPITIIKVRYESTMYS---YK-SLGEATRHIYSTEGIRGFFNGCGATVMRDAP 172

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 38/93 (40%), Gaps = 1/93 (1%)

Query: 21  TPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI-GVIEVVQNLLRNEGALAF 79
           T Y   V +  +  M       +  PFDT K R+Q   TK  G  + +  ++  E     
Sbjct: 206 TTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQLDPTKFSGFYKTLVLIVSKEKFKNL 265

Query: 80  YKGMLTPLLGVGICVSVQFGVNESMKRFFAAYN 112
           + G+   L        + +G+ E + + F AY+
Sbjct: 266 FDGLTLRLTRKAFSAGIAWGIYEELIKRFMAYS 298

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 60/137 (43%), Gaps = 12/137 (8%)

Query: 25  RVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSK--TKIGVIEVVQNLLRNEGALAFYKG 82
           +    +  G +GG+   +V QPFD  K RLQ +K  T  G ++ +++          ++G
Sbjct: 6   KTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEIRS------PKQLWRG 59

Query: 83  MLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDP-QKHVP-LPLHQYYLCG-LTGGVV 139
            L   L   I  ++        +   A      ++P    +P L +++    G  T GVV
Sbjct: 60  ALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVV 119

Query: 140 NSFLAAPIEHVRIRLQT 156
             F+  PI  +++R ++
Sbjct: 120 G-FITMPITIIKVRYES 135

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 116/285 (40%), Gaps = 41/285 (14%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLL-RNEGALAFYKGMLTPLL 88
           +      G+ ++ V  P DT   RL ++ TKI     + +++ R+  +    + +L+   
Sbjct: 14  VLGSASAGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSVIFRDFASEPLGRRLLSLFP 73

Query: 89  GVGICVSVQ-------FG----VNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGG 137
           G+G   + +       +G     NE + + F   + D+   +K     L       L G 
Sbjct: 74  GLGYAAAYKILQRVYKYGGQPFANEFLNKNFKG-DFDQAFGEK-TGKALRSATAGSLIG- 130

Query: 138 VVNSFLAAPIEHVRIRLQTQTSQGNERQFKGP--FDCIKKLAKAKALMRGLLPTMIRAGH 195
            +   +  P++ ++I+ QT     N   FKG      IK   +   L RG   T  R   
Sbjct: 131 -IGEIVLLPLDVLKIKRQT-----NPESFKGRGFLKIIKD--EGFGLYRGWGWTAARNAP 182

Query: 196 GL-----GTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVY-PVDVVKS 249
           G      G  FA    L +K++ + T       W      ++ G    L V  P+DV+K+
Sbjct: 183 GSFALFGGNAFAKEYILGLKDYGQAT-------WSQNFVSSIVGASASLIVSAPLDVIKT 235

Query: 250 VLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
            +Q  + +NP+    IIK T    K  G  AFFKG  P ++   P
Sbjct: 236 RIQNRNFDNPESGFKIIKNT---LKNEGFTAFFKGLTPKLLTTGP 277

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 4/86 (4%)

Query: 23  YGRVV--KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSK--TKIGVIEVVQNLLRNEGALA 78
           YG+    ++  +  +G  A ++V  P D  K R+Q           ++++N L+NEG  A
Sbjct: 204 YGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIIKNTLKNEGFTA 263

Query: 79  FYKGMLTPLLGVGICVSVQFGVNESM 104
           F+KG+   LL  G  +   F + +++
Sbjct: 264 FFKGLTPKLLTTGPKLVFSFALAQTL 289

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 80/191 (41%), Gaps = 23/191 (12%)

Query: 24  GRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---GVIEVVQNLLRNEGALAFY 80
           G+ ++   AG++ G+ ++++  P D  K++ QT+       G ++++    ++EG    Y
Sbjct: 117 GKALRSATAGSLIGIGEIVL-LPLDVLKIKRQTNPESFKGRGFLKII----KDEG-FGLY 170

Query: 81  KGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVN 140
           +G               FG N   K +           + +      Q ++  + G   +
Sbjct: 171 RGWGWTAARNAPGSFALFGGNAFAKEYILGL-------KDYGQATWSQNFVSSIVGASAS 223

Query: 141 SFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGHGL 197
             ++AP++ ++ R+Q +     E  FK     IK   K +   A  +GL P ++  G  L
Sbjct: 224 LIVSAPLDVIKTRIQNRNFDNPESGFK----IIKNTLKNEGFTAFFKGLTPKLLTTGPKL 279

Query: 198 GTYFAAYEALV 208
              FA  + L+
Sbjct: 280 VFSFALAQTLI 290

>Kwal_47.19228
          Length = 281

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 68/152 (44%), Gaps = 6/152 (3%)

Query: 149 HVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALV 208
           H R +      +   RQF      I +    +  ++G +PT+IR        F  Y +L 
Sbjct: 114 HPRQKWALYYDEHPSRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSL- 172

Query: 209 VKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKA 268
            +      P N+  A+ L   G +S   +     P+DV+K+ +Q+    +  YKNS+  A
Sbjct: 173 KQMISPNKPLNEYYAFAL---GFISSCAVVAVTQPIDVIKTRMQSKYTWS-NYKNSLNCA 228

Query: 269 TRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
            R ++ + G   F+KG+ P +++   +   +F
Sbjct: 229 YR-IFVEEGFTKFWKGWAPRLMKVGLSGGVSF 259

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 66/149 (44%), Gaps = 24/149 (16%)

Query: 64  IEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVP 123
           +  VQ + R+ G   F +G +  ++      +V+F    S+K+         + P K   
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQM--------ISPNK--- 180

Query: 124 LPLHQYYLCGLTGGVVNSF----LAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA 179
            PL++YY   L  G ++S     +  PI+ ++ R+Q++ +  N   +K   +C  ++   
Sbjct: 181 -PLNEYYAFAL--GFISSCAVVAVTQPIDVIKTRMQSKYTWSN---YKNSLNCAYRIFVE 234

Query: 180 KA---LMRGLLPTMIRAGHGLGTYFAAYE 205
           +      +G  P +++ G   G  F  Y+
Sbjct: 235 EGFTKFWKGWAPRLMKVGLSGGVSFGVYQ 263

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 3/86 (3%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSKTKIGV---IEVVQNLLRNEGALAFYKGMLTPLLG 89
           G +   A V V QP D  K R+Q+  T       +     +   EG   F+KG    L+ 
Sbjct: 191 GFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMK 250

Query: 90  VGICVSVQFGVNESMKRFFAAYNADR 115
           VG+   V FGV + +     A N  +
Sbjct: 251 VGLSGGVSFGVYQYVDNLMKAVNGQQ 276

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 21/38 (55%)

Query: 266 IKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303
           +   + +Y+  GI  F +G +PT+IR    +A  F ++
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTY 169

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 115/275 (41%), Gaps = 35/275 (12%)

Query: 37  GVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLL-RNEGALAFYKGMLTPLLGVGICVS 95
           G+ ++ V  P DT   RL ++ TKI   + + +++ R   +  F + + T   G+G   +
Sbjct: 20  GILEIGVFHPVDTISKRLMSNHTKITNAQQLNDVVFREHASKPFGQRLFTLFPGLGYAAT 79

Query: 96  VQ-------FG----VNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA 144
            +       +G     NE + + F A + D    +K     L       L G  +   + 
Sbjct: 80  YKIFQRVYKYGGQPFANEFLNKHFKA-DFDGAFGEK-TGKALRSATAGSLIG--IGEIVL 135

Query: 145 APIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGL-----GT 199
            P++ ++I+ QT     N   F+G         +   L RG   T  R   G      G 
Sbjct: 136 LPLDVLKIKRQT-----NPESFRGRGFLRILRDEGMGLYRGWGWTAARNAPGSFALFGGN 190

Query: 200 YFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENP 259
            FA    L +K++ + T      +     FGA +  I+     P+DV+K+ +Q+ + E+ 
Sbjct: 191 AFAKEYILGLKDYSQATWGQNFVS---SIFGASASLIV---SAPLDVIKTRIQSRNFESA 244

Query: 260 KYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
           +   +I+K T    K  G  AFFKG  P ++   P
Sbjct: 245 ESGFTIVKNT---LKNEGATAFFKGLTPKLLTTGP 276

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 6/93 (6%)

Query: 14  LEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS--KTKIGVIEVVQNLL 71
           L+D    T     V  IF    G  A ++V  P D  K R+Q+   ++      +V+N L
Sbjct: 200 LKDYSQATWGQNFVSSIF----GASASLIVSAPLDVIKTRIQSRNFESAESGFTIVKNTL 255

Query: 72  RNEGALAFYKGMLTPLLGVGICVSVQFGVNESM 104
           +NEGA AF+KG+   LL  G  +   F + +++
Sbjct: 256 KNEGATAFFKGLTPKLLTTGPKLVFSFAIAQTL 288

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 76/185 (41%), Gaps = 24/185 (12%)

Query: 20  PTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQ---------NL 70
           P     V  ++ AG   G+   +VG P    K R+Q+    I + E             +
Sbjct: 123 PHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATI 182

Query: 71  LRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYY 130
            + EG L  ++G+   +L  G   SVQ  +  + K F    +  +    +   L L    
Sbjct: 183 FKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMK----EGTALHLLSST 238

Query: 131 LCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLL 187
           + GL  G+V +    P + V  R+  Q  +GN   +KGP DC+ K  K +   AL +G  
Sbjct: 239 VTGLGVGIVMN----PWDVVLTRVYNQ--KGNT--YKGPIDCMFKTIKIEGIGALYKGFG 290

Query: 188 PTMIR 192
             + R
Sbjct: 291 AQLFR 295

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 69/165 (41%), Gaps = 13/165 (7%)

Query: 146 PIEHVRIRLQTQ--TSQGNERQFKGPFDCIKKLAK---AKALMRGLLPTMIRA----GHG 196
           P E V+ R+Q Q   S  N+R ++ PF  +  + K    K L RGL+   +      G  
Sbjct: 43  PFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSR 102

Query: 197 LGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDS- 255
           LG Y      L    F +  P          + GA SG I  +   P+ +VK+ +Q+ S 
Sbjct: 103 LGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSN 162

Query: 256 ---IENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANA 297
              I    +  S+      ++K+ G+   F+G    ++R    ++
Sbjct: 163 AIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAGSS 207

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 67/305 (21%), Positives = 118/305 (38%), Gaps = 43/305 (14%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGV----IEVVQNLLRNEGALA 78
           V    AG +     V V  PF+  K R+Q     S T   +     + +  + +NEG   
Sbjct: 24  VGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKG 83

Query: 79  FYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNA-------DRVDPQKHVPLPLHQYYL 131
             +G+++  +        Q G+N S   F+               DP K   + ++    
Sbjct: 84  LQRGLVSAYV-------YQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVN--VT 134

Query: 132 CGLTGGVVNSFLAAPIEHVRIRLQTQTSQ---GNERQFKGPFDCIKKLAKAK---ALMRG 185
            G T G++ + + +P+  V+ R+Q+ ++    G +  +    + +  + K +    L RG
Sbjct: 135 AGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRG 194

Query: 186 LLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQI----PAWKLCSFGALSGTILWLTV 241
           +   ++R G G       Y     K F     +N I     A  L S   ++G  + + +
Sbjct: 195 VDAAILRTGAGSSVQLPIYNT--TKNF---LLQNDIMKEGTALHLLS-STVTGLGVGIVM 248

Query: 242 YPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFV 301
            P DVV + +     +   YK  I    + + K  GI A +KGF   + R AP       
Sbjct: 249 NPWDVVLTRVYNQ--KGNTYKGPIDCMFKTI-KIEGIGALYKGFGAQLFRIAPHTILCLT 305

Query: 302 SFEMT 306
             E T
Sbjct: 306 FMEQT 310

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 99/266 (37%), Gaps = 17/266 (6%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVG 91
           +G   G +  L   P DT K RLQ                 N G    Y+G+ + ++   
Sbjct: 12  SGAAAGTSTDLAFFPIDTLKTRLQAKG----------GFFANGGYKGVYRGLGSAVIASA 61

Query: 92  ICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVR 151
              S+ F   +SMK +     +  V     +   L   +   + G V    +  P E ++
Sbjct: 62  PSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSI-GEVSACLVRVPAEVIK 120

Query: 152 IRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKE 211
            R QT  +  + + F             + L RG   T++R        F  YE L  K 
Sbjct: 121 QRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQFPLYEFLK-KT 179

Query: 212 FEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRA 271
           + K   ++ +  W+    G+++G I   T  P+DV+K+ L       P     + +  + 
Sbjct: 180 WAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKSIP-----VAQLAKN 234

Query: 272 LYKQHGIPAFFKGFVPTMIRAAPANA 297
           +Y + G   FF G  P  +  +   A
Sbjct: 235 IYAEEGFKVFFSGVGPRTMWISAGGA 260

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 15/75 (20%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTM 289
           GA +GT   L  +P+D +K+ LQ               A    +   G    ++G    +
Sbjct: 13  GAAAGTSTDLAFFPIDTLKTRLQ---------------AKGGFFANGGYKGVYRGLGSAV 57

Query: 290 IRAAPANAATFVSFE 304
           I +AP+ +  FVS++
Sbjct: 58  IASAPSASLFFVSYD 72

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 29/65 (44%)

Query: 46  PFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMK 105
           P D  K RL  S   I V ++ +N+   EG   F+ G+    + +    ++  GV E++ 
Sbjct: 211 PLDVLKTRLMLSHKSIPVAQLAKNIYAEEGFKVFFSGVGPRTMWISAGGAIFLGVYETVH 270

Query: 106 RFFAA 110
              + 
Sbjct: 271 SILSG 275

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 59/271 (21%), Positives = 98/271 (36%), Gaps = 22/271 (8%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLL 88
            + +G   G +  LV  P DT K RLQ                RN G    Y+G+ + ++
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKG----------GFFRNGGYRGVYRGLGSAVV 57

Query: 89  GVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIE 148
                 S+ F   ++ K     +    +       +  H +      G +    +  P E
Sbjct: 58  ASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMF--SSSMGEIAACMVRVPAE 115

Query: 149 HVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALV 208
            V+ R QT  S  +    +            + L RG   T++R        F  YE + 
Sbjct: 116 VVKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYEYM- 174

Query: 209 VKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKA 268
            K + +    +++  WK    G+++G I   T  P+D +K+ L          K SI   
Sbjct: 175 KKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLML-------CKKSIPLG 227

Query: 269 T--RALYKQHGIPAFFKGFVPTMIRAAPANA 297
           T    +YK+ G   FF G  P  +  +   A
Sbjct: 228 TLVSTIYKEEGFKVFFSGVGPRTMWISAGGA 258

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/101 (19%), Positives = 41/101 (40%), Gaps = 4/101 (3%)

Query: 9   QLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQ 68
           ++  EL++     P+    K    G++ G        P D  K RL   K  I +  +V 
Sbjct: 176 KVWAELDESDRVEPW----KGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKSIPLGTLVS 231

Query: 69  NLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFA 109
            + + EG   F+ G+    + +    ++  G+ E++    +
Sbjct: 232 TIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETVHSLLS 272

 Score = 28.5 bits (62), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/75 (21%), Positives = 33/75 (44%), Gaps = 15/75 (20%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTM 289
           GA +GT   L  +P+D +K+ LQ               A    ++  G    ++G    +
Sbjct: 12  GAAAGTSTDLVFFPIDTLKTRLQ---------------AKGGFFRNGGYRGVYRGLGSAV 56

Query: 290 IRAAPANAATFVSFE 304
           + +AP  +  F++++
Sbjct: 57  VASAPGASLFFITYD 71

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 57/263 (21%), Positives = 104/263 (39%), Gaps = 28/263 (10%)

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
           G +E    +   EG  + ++G+   LL           +  +M  +F+ Y   R      
Sbjct: 104 GTLEAFTKIASVEGITSLWRGISLTLL---------MAIPANMV-YFSGYEYIRDVSPIA 153

Query: 122 VPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQ--------TQTSQGNERQFKGPFDCI 173
              P      CG    V  +   AP+E V+ +LQ        T+T    +         +
Sbjct: 154 STYPTLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEM 213

Query: 174 KKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGT-----PRNQIPAWKLCS 228
           K +  ++AL +GL  T+ R       Y+++YE    + +   T       N +      +
Sbjct: 214 KMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFA 273

Query: 229 FGALSGTILWLTVYPVDVVKSVLQTDSIEN--PKYKN---SIIKATRALYKQHGIPAFFK 283
            G +SG I  +  +P DV K+  Q   + N  PK  N   ++ K    +++  G+ A + 
Sbjct: 274 SGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYT 333

Query: 284 GFVPTMIRAAPANAATFVSFEMT 306
           G    +I+  P+ A    S+E++
Sbjct: 334 GLAARVIKIRPSCAIMISSYEIS 356

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/92 (19%), Positives = 35/92 (38%), Gaps = 10/92 (10%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTS----------KTKIGVIEVVQNLLRNEGA 76
           +    +G + G+   +   PFD  K R Q S               + + ++ + R EG 
Sbjct: 269 INSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGL 328

Query: 77  LAFYKGMLTPLLGVGICVSVQFGVNESMKRFF 108
            A Y G+   ++ +    ++     E  K+ F
Sbjct: 329 AALYTGLAARVIKIRPSCAIMISSYEISKKVF 360

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 72/162 (44%), Gaps = 9/162 (5%)

Query: 146 PIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYE 205
           PI+ V+ R+Q + +  N +   G F  I     A AL+ G  PT++         F  YE
Sbjct: 37  PIDVVKTRIQLEPTVYN-KGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYE 95

Query: 206 ALVVKEFEKGTPRNQIPAWKLCSF---GALSGTILWLTVYPVDVVKSVLQTDSIENPKYK 262
            +  K F      +    +K   +    A++  +  + + P++  +  L    +  P++ 
Sbjct: 96  -VFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRL----VSQPQFA 150

Query: 263 NSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           N ++     + K+ GI +F+ GF P + +  P N A F+ FE
Sbjct: 151 NGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFE 192

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 59/153 (38%), Gaps = 16/153 (10%)

Query: 46  PFDTTKVRLQTSKT--KIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNES 103
           P D  K R+Q   T    G++   + ++  EGA A   G    LLG  I  + +FG  E 
Sbjct: 37  PIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYEV 96

Query: 104 MKRFFA---AYN-ADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTS 159
            K+FF     Y+ A R     ++       +L  +           P+E  RIRL +Q  
Sbjct: 97  FKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIA--------LCPLEATRIRLVSQPQ 148

Query: 160 QGNERQFKGPFDCIKKLAKAKALMRGLLPTMIR 192
             N     G F  I K     +   G  P + +
Sbjct: 149 FAN--GLVGGFSRILKEEGIGSFYSGFTPILFK 179

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 2/79 (2%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIG--VIEVVQNLLRNEGALAFYKGMLTP 86
           ++ +G   G+A  +V QP DT   ++  +K   G   + ++  L +  G    + G+ T 
Sbjct: 217 NLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTR 276

Query: 87  LLGVGICVSVQFGVNESMK 105
           L+ VG   S+QFG+  S+K
Sbjct: 277 LVMVGTLTSLQFGIYGSLK 295

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 240 TVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAAT 299
           ++ P+DVVK+ +Q   +E   Y   ++ + + +    G  A   GF PT++  +   A  
Sbjct: 34  SMVPIDVVKTRIQ---LEPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFK 90

Query: 300 FVSFEM 305
           F  +E+
Sbjct: 91  FGGYEV 96

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/271 (20%), Positives = 102/271 (37%), Gaps = 18/271 (6%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTP 86
           +  + +G   G +  +V  P DT K RLQ                 N G    Y+G+ + 
Sbjct: 6   LASLVSGAAAGTSTDVVFFPIDTLKTRLQAKG----------GFFHNGGYRGIYRGLGSA 55

Query: 87  LLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAP 146
           ++      S+ F   +SMK+            ++   +  H   L    G +    +  P
Sbjct: 56  VVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHM--LSSSLGEMSACLVRVP 113

Query: 147 IEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEA 206
            E ++ R QT  +  + +  +            + L RG   T++R        F  YE 
Sbjct: 114 AEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLYEY 173

Query: 207 LVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSII 266
           L  K++       ++ AW+    G+L+G I      P+DV+K+ +       P     ++
Sbjct: 174 LK-KKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVP-----ML 227

Query: 267 KATRALYKQHGIPAFFKGFVPTMIRAAPANA 297
              R L+++ G   FF+G  P  +  +   A
Sbjct: 228 HLARTLFREEGARVFFRGIGPRTMWISAGGA 258

 Score = 35.0 bits (79), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 32/63 (50%)

Query: 46  PFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMK 105
           P D  K R+   + ++ ++ + + L R EGA  F++G+    + +    ++  GV E++ 
Sbjct: 209 PLDVLKTRMMLHERRVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAVH 268

Query: 106 RFF 108
             F
Sbjct: 269 SLF 271

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/278 (20%), Positives = 114/278 (41%), Gaps = 28/278 (10%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIG-VIEVVQNLLRNEGALAFYKGMLTPLLG 89
            AG++GG A + V  P  T    LQT + +    +E ++ +    G + ++ G+ + + G
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKENEARPKLETIKEIYNKNGIIGYFLGLESAVYG 75

Query: 90  VGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEH 149
           +     V +   E     + A  A  +  +++  L   +  L     G + +  + PI  
Sbjct: 76  MATTNFVYYYFYE-----WCAKTARTLTTKQY--LSTWESILASTIAGSMTAVASNPIWV 128

Query: 150 VRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVV 209
              R+    ++ N    +   D +K       L+ GL P ++   + +  Y   YE L  
Sbjct: 129 ANTRM--TVAKSNHSTLRTVIDIVKTDGPL-TLLNGLKPALVLVSNPIIQY-TVYEQL-- 182

Query: 210 KEFEKGTPRNQI--PAWK--LCSFGALSGTILWLTVYPVDVVKS---VLQTDSIENPKYK 262
           K       R ++  P+W   L + G L+ T    T YP   +K+   ++Q D    PK++
Sbjct: 183 KNLVLRLQRKKVLSPSWAFLLGAIGKLAAT---GTTYPYITLKTRMHLMQND----PKHQ 235

Query: 263 NSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
            S+      + K+ G+   + G    ++++    A  F
Sbjct: 236 KSMWSLIVEIVKKDGVSGLYNGVAVKLVQSIMTAAFLF 273

>Kwal_33.15597
          Length = 305

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 81/182 (44%), Gaps = 13/182 (7%)

Query: 128 QYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLL 187
           ++ L G  G         PI+ V+ R+Q + +  N+      F  I     A AL+ G  
Sbjct: 15  KFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMIS-SFKQIISSEGAGALLTGFG 73

Query: 188 PTMIRAGHGL-GTY-FAAYEALVVKEFEKGTPRNQIPAWKLCSF---GALSGTILWLTVY 242
           PT++  G+ L G++ F  YE +  K F      +Q   +K   +    A++     + + 
Sbjct: 74  PTLL--GYSLQGSFKFGGYE-VFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALC 130

Query: 243 PVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVS 302
           P++  +  L    +  P + N ++     + K+ G+ +F+ GF P + +  P N A F+ 
Sbjct: 131 PLEATRIRL----VSQPTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLV 186

Query: 303 FE 304
           FE
Sbjct: 187 FE 188

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 56/149 (37%), Gaps = 8/149 (5%)

Query: 46  PFDTTKVRLQTSKT--KIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNES 103
           P D  K R+Q   T    G+I   + ++ +EGA A   G    LLG  +  S +FG  E 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYEV 92

Query: 104 MKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNE 163
            K+ F     D +   + V      Y                P+E  RIRL +Q +  N 
Sbjct: 93  FKKLF----IDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFAN- 147

Query: 164 RQFKGPFDCIKKLAKAKALMRGLLPTMIR 192
               G F  I K     +   G  P + +
Sbjct: 148 -GLVGGFSRILKEEGLSSFYNGFTPILFK 175

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIG--VIEVVQNLLRNEGALAFYKGMLTP 86
           ++ +G   G+A  +V QP DT   ++  +K   G   I ++  L +  G +  + G+ T 
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAPGQSTIGLLGQLAKELGFVGSFAGLPTR 272

Query: 87  LLGVGICVSVQFGVNESMKR 106
           L+ VG   S+QFG+  S+K+
Sbjct: 273 LVMVGTLTSLQFGIYGSLKK 292

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 9/91 (9%)

Query: 221 IPAWKLCSFG--ALSGTILWLTVY----PVDVVKSVLQTDSIENPKYKNSIIKATRALYK 274
           IP + +  +   AL+G I   T +    P+DVVK+ +Q   +E   Y   +I + + +  
Sbjct: 5   IPQYTISDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQ---LEPTVYNKGMISSFKQIIS 61

Query: 275 QHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
             G  A   GF PT++  +   +  F  +E+
Sbjct: 62  SEGAGALLTGFGPTLLGYSLQGSFKFGGYEV 92

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 71/175 (40%), Gaps = 18/175 (10%)

Query: 130 YLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA---LMRGL 186
           ++ G   G V+  + +P E V+I LQ Q+S        G  + + ++ K +    L RG 
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNH--GIINAVGQVYKEEGVAGLFRGN 72

Query: 187 LPTMIRAGHGLGTYFAAYEALVVKEFE-KGT-PRNQIPAWKLCSFGALSGTILWLTVYPV 244
               +R        F  YE      F   GT  + Q+  W+  S GAL G +  L  YP+
Sbjct: 73  GLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPL 132

Query: 245 DVVKSVLQTDSIENPKYKNSIIKA-----------TRALYKQHGIPAFFKGFVPT 288
           D+V++ L   +    K   S  K             +   ++ GI   ++G  PT
Sbjct: 133 DLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIYPT 187

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTM 289
           G ++G +    V P + VK +LQ  S     Y + II A   +YK+ G+   F+G     
Sbjct: 18  GGVAGAVSRTVVSPFERVKILLQVQS-STSAYNHGIINAVGQVYKEEGVAGLFRGNGLNC 76

Query: 290 IRAAPANAATFVSFE 304
           +R  P +A  FV +E
Sbjct: 77  VRIFPYSAVQFVVYE 91

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 71/157 (45%), Gaps = 23/157 (14%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGMLT 85
           I  G  G V++ +V  PF+  K+ LQ    TS    G+I  V  + + EG    ++G   
Sbjct: 16  IAGGVAGAVSRTVV-SPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGL 74

Query: 86  PLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAA 145
             + +    +VQF V E  K+    ++ D    ++ + L   +     L GG+  S LA 
Sbjct: 75  NCVRIFPYSAVQFVVYEWCKKHI--FHVDGTVGKEQL-LNWQRLSAGALCGGM--SVLAT 129

Query: 146 -PIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA 181
            P++ VR RL  QT+             + KL+K+KA
Sbjct: 130 YPLDLVRTRLSIQTAN------------LAKLSKSKA 154

>Scas_673.17
          Length = 314

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 77/180 (42%), Gaps = 9/180 (5%)

Query: 128 QYYLCGLTG-GVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGL 186
           ++ L G  G G  +S L  P++ V+ R+Q + +  N +   G F  I     A AL+ G 
Sbjct: 22  KFALAGAIGCGTTHSSLV-PVDVVKTRIQLEPTVYN-KGMVGSFKKIIADEGAGALLTGF 79

Query: 187 LPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFG--ALSGTILWLTVYPV 244
            PT++         F  YE       +     N +        G  A++  +  + + P+
Sbjct: 80  GPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPL 139

Query: 245 DVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           +  +  L    +  P + N ++     + K+ G+ +F+ GF P + +  P N A F+ FE
Sbjct: 140 EATRIRL----VSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFE 195

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 61/153 (39%), Gaps = 16/153 (10%)

Query: 46  PFDTTKVRLQTSKT--KIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNES 103
           P D  K R+Q   T    G++   + ++ +EGA A   G    LLG  +  + +FG  E 
Sbjct: 40  PVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEV 99

Query: 104 MKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA----APIEHVRIRLQTQTS 159
            K+     + D +  +  V      Y    +    V  FLA     P+E  RIRL +Q +
Sbjct: 100 FKKL----SIDTIGYENAVHYKNSVY----MGSAAVAEFLADIALCPLEATRIRLVSQPT 151

Query: 160 QGNERQFKGPFDCIKKLAKAKALMRGLLPTMIR 192
             N     G F  I K     +   G  P + +
Sbjct: 152 FAN--GLVGGFSRILKEEGVGSFYSGFTPILFK 182

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIG--VIEVVQNLLRNEGALAFYKGMLTP 86
           ++ +G   G A   V QP DT   ++  +K   G   I ++  L +  G +  + G+ T 
Sbjct: 220 NLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGVIGSFAGLPTR 279

Query: 87  LLGVGICVSVQFGVNESMKR 106
           L+ VG   S+QF +  S+K 
Sbjct: 280 LIMVGTLTSLQFAIYGSLKN 299

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 9/96 (9%)

Query: 216 TPRNQIPAWKLCSFG--ALSGTILWLTVY----PVDVVKSVLQTDSIENPKYKNSIIKAT 269
           T  ++IP +    +   AL+G I   T +    PVDVVK+ +Q   +E   Y   ++ + 
Sbjct: 7   TDAHKIPDYAASDYFKFALAGAIGCGTTHSSLVPVDVVKTRIQ---LEPTVYNKGMVGSF 63

Query: 270 RALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
           + +    G  A   GF PT++  +   A  F  +E+
Sbjct: 64  KKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEV 99

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 64/134 (47%), Gaps = 9/134 (6%)

Query: 170 FDCIKKLAKAKAL---MRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKL 226
           F  +K++   + L   ++G  PT+ R        F  Y +L  +      P N+  A+ L
Sbjct: 271 FSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLK-QLISPNKPLNEYYAFVL 329

Query: 227 CSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFV 286
              G +S   +     P+DV+K+ +Q+       YKNS+  A R ++ + GIP F+KG+ 
Sbjct: 330 ---GFISSCAVVAVTQPIDVIKTRMQSKYAW-ANYKNSLNCAYR-IFVEEGIPKFWKGWA 384

Query: 287 PTMIRAAPANAATF 300
           P +++   +   +F
Sbjct: 385 PRLMKVGLSGGVSF 398

 Score = 34.7 bits (78), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 3/71 (4%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSKTKIGV---IEVVQNLLRNEGALAFYKGMLTPLLG 89
           G +   A V V QP D  K R+Q+          +     +   EG   F+KG    L+ 
Sbjct: 330 GFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFWKGWAPRLMK 389

Query: 90  VGICVSVQFGV 100
           VG+   V FGV
Sbjct: 390 VGLSGGVSFGV 400

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/274 (23%), Positives = 102/274 (37%), Gaps = 38/274 (13%)

Query: 43  VGQPFDTTKVRLQTSKTKI---GVIEVVQNLLRNEGAL-AFYKGMLTPLLGVGICVSVQF 98
           V    DT K R Q +  ++    +I   + L   EG     Y G    +LG     +V F
Sbjct: 70  VMHSLDTVKTRQQGAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFF 129

Query: 99  GVNESMKRFFAAYNADRVDPQKHVPLPLHQYY---LCGLTGGVVNSFLAAPIEHVRIRLQ 155
           G  E +KR            Q      +H+ Y     G  G + +S +  P E ++ RLQ
Sbjct: 130 GTYEWVKR------------QMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQ 177

Query: 156 TQTSQGNER-----QFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGHGLGTYFAAYEAL 207
            Q    N        ++G  D ++ + + +   AL  G   T+ R        FA YE  
Sbjct: 178 LQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERF 237

Query: 208 VVKEF--EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQT---------DSI 256
               F  E+      +        GA +G +  +   P+DVVK+ +QT         D+ 
Sbjct: 238 RKWAFLLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDAS 297

Query: 257 ENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMI 290
              +   SI ++   + +  G+   F G  P  I
Sbjct: 298 APARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFI 331

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 76/181 (41%), Gaps = 11/181 (6%)

Query: 128 QYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLL 187
           ++ L G  G  +      PI+ V+ R+Q + +  N+      F  I     A AL+ G  
Sbjct: 15  KFALAGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVS-SFKQIISSEGAGALLTGFG 73

Query: 188 PTMIRAGHGL-GTY-FAAYEALVVKEFEKGTPRNQIPAWKLCSFG--ALSGTILWLTVYP 243
           PT++  G+ L G++ F  YE       +     N +        G  A++     + + P
Sbjct: 74  PTLL--GYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCP 131

Query: 244 VDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303
           ++  +  L    +  P + N +      + K+ G+ +F+ GF P + +  P N A F  F
Sbjct: 132 LEATRIRL----VSQPTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKFFVF 187

Query: 304 E 304
           E
Sbjct: 188 E 188

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 54/149 (36%), Gaps = 8/149 (5%)

Query: 46  PFDTTKVRLQTSKT--KIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNES 103
           P D  K R+Q   T    G++   + ++ +EGA A   G    LLG  +  S +FG  E 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYEL 92

Query: 104 MKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNE 163
            K+       D +     V      Y                P+E  RIRL +Q +  N 
Sbjct: 93  FKKL----AIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFAN- 147

Query: 164 RQFKGPFDCIKKLAKAKALMRGLLPTMIR 192
               G F  I K     +   G  P + +
Sbjct: 148 -GLFGGFSRILKEEGVGSFYNGFTPILFK 175

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 37/76 (48%), Gaps = 3/76 (3%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTM 289
           GA+   I   ++ P+DVVK+ +Q   +E   Y   ++ + + +    G  A   GF PT+
Sbjct: 20  GAIGCGITHSSMVPIDVVKTRIQ---LEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTL 76

Query: 290 IRAAPANAATFVSFEM 305
           +  +   +  F  +E+
Sbjct: 77  LGYSLQGSFKFGGYEL 92

 Score = 32.3 bits (72), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 42  LVGQPFDTTKVRLQTSKTKIG--VIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFG 99
           +V QP DT   ++  +K   G   I ++  L +  G +  + G+ T L+ VG   S+QFG
Sbjct: 226 VVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFG 285

Query: 100 VNESMKR 106
           +  ++K+
Sbjct: 286 IYGTLKK 292

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 77/165 (46%), Gaps = 15/165 (9%)

Query: 146 PIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGL-GTY-FAA 203
           PI+ V+ R+Q + +  N +   G F  I     A AL+ G  PT++  G+ + G + F  
Sbjct: 33  PIDVVKTRIQLEPTVYN-KGMVGSFRKIIAEEGAGALLTGFGPTLL--GYSIQGAFKFGG 89

Query: 204 YEALVVKEFEKGTPRNQIPA-WKLCSF---GALSGTILWLTVYPVDVVKSVLQTDSIENP 259
           YE  V K+F   T      A +K   +    A +  +  + + P++  +  L    +  P
Sbjct: 90  YE--VFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRL----VSQP 143

Query: 260 KYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
            + N ++     + K+ G+ +F+ GF P + +  P N A F+ FE
Sbjct: 144 TFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFE 188

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 102/282 (36%), Gaps = 24/282 (8%)

Query: 19  PPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKT--KIGVIEVVQNLLRNEGA 76
           P   Y    K   AG +G  +      P D  K R+Q   T    G++   + ++  EGA
Sbjct: 6   PQYSYSDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGA 65

Query: 77  LAFYKGMLTPLLGVGICVSVQFGVNESMKRFFA---AYN-ADRVDPQKHVPLPLHQYYLC 132
            A   G    LLG  I  + +FG  E  K+FF     Y+ A R     ++       +L 
Sbjct: 66  GALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLA 125

Query: 133 GLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIR 192
            +           P+E  RIRL +Q +  N     G F  I K     +   G  P + +
Sbjct: 126 DIA--------LCPLEATRIRLVSQPTFAN--GLVGGFSRILKEEGVGSFYSGFTPILFK 175

Query: 193 AGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTV----YPVDVVK 248
                   F  +E      F    P++ +    L +   LSG    L       P D + 
Sbjct: 176 QIPYNIAKFLVFERASELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLL 235

Query: 249 SVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMI 290
           S +   S + P    S +     L KQ G    F G +PT +
Sbjct: 236 SKVNKTS-KAP--GQSTVGLLFQLAKQLGFVGSFAG-LPTRL 273

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 9/93 (9%)

Query: 219 NQIPAWKLCSFG--ALSGTI----LWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRAL 272
           NQ+P +    +   AL+G I       ++ P+DVVK+ +Q   +E   Y   ++ + R +
Sbjct: 3   NQLPQYSYSDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQ---LEPTVYNKGMVGSFRKI 59

Query: 273 YKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
             + G  A   GF PT++  +   A  F  +E+
Sbjct: 60  IAEEGAGALLTGFGPTLLGYSIQGAFKFGGYEV 92

>Scas_328.1
          Length = 227

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 60/142 (42%), Gaps = 15/142 (10%)

Query: 161 GNERQFKGPFDCIKKLAKAKA---LMRGLLPTMIRAGHGLGTYFAAYEA----LVVKEFE 213
           G  R+F G  D  KK         L RG LP+++      G YF  Y++    L+   FE
Sbjct: 74  GAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSFE 133

Query: 214 KGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALY 273
                + +  W +     +S +    T YP+D V+  +   S +  KYK + I   + + 
Sbjct: 134 NAFLPSFLLGWAV----TISAST---TSYPLDTVRRRMMMTSGQAVKYKGA-IDCFQQIV 185

Query: 274 KQHGIPAFFKGFVPTMIRAAPA 295
            Q G+ + FKG    + R   A
Sbjct: 186 SQEGVYSLFKGCGANIFRGVAA 207

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 63/135 (46%), Gaps = 14/135 (10%)

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
           G+++V +  L  +G L  Y+G L  ++G+ +   + FG+ +S+K      + +      +
Sbjct: 81  GILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSFE------N 134

Query: 122 VPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK- 180
             LP    +L G    +  S  + P++ VR R+    + G   ++KG  DC +++   + 
Sbjct: 135 AFLP---SFLLGWAVTISASTTSYPLDTVRRRM--MMTSGQAVKYKGAIDCFQQIVSQEG 189

Query: 181 --ALMRGLLPTMIRA 193
             +L +G    + R 
Sbjct: 190 VYSLFKGCGANIFRG 204

>Scas_721.129
          Length = 323

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 76/180 (42%), Gaps = 24/180 (13%)

Query: 25  RVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ--TSKTKIG-------VIEVVQNLLRNEG 75
           +V  ++ AG   G+   ++G P    K R+Q  +   KIG       V   +  + R EG
Sbjct: 126 KVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEG 185

Query: 76  ALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLT 135
               ++G+   +L  G   SVQ  +  + K F    +  +  P  H    L    + GL 
Sbjct: 186 FKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLH----LTASTISGLG 241

Query: 136 GGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIR 192
             VV +    P + +  R+  Q  +GN   +KGP DC  K  + +   AL +G    ++R
Sbjct: 242 VAVVMN----PWDVILTRIYNQ--KGN--LYKGPVDCFVKTVRTEGISALYKGFQAQILR 293

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 9/84 (10%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEVVQNLLRNEGALAFYKGMLTPLLG 89
           A T+ G+   +V  P+D    R+   K  +  G ++     +R EG  A YKG    +L 
Sbjct: 234 ASTISGLGVAVVMNPWDVILTRIYNQKGNLYKGPVDCFVKTVRTEGISALYKGFQAQILR 293

Query: 90  VG----ICVSVQFGVNESMKRFFA 109
           +     IC++    + ++MK  ++
Sbjct: 294 IAPHTIICLTF---MEQTMKLVYS 314

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 80/182 (43%), Gaps = 13/182 (7%)

Query: 128 QYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLL 187
           ++ L G  G         PI+ V+ R+Q + +  N+      F  I     A AL+ G  
Sbjct: 15  KFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMIS-SFKQIISSEGAGALLTGFG 73

Query: 188 PTMIRAGHGL-GTY-FAAYEALVVKEFEKGTPRNQIPAWKLCSF---GALSGTILWLTVY 242
           PT++  G+ L G++ F  YE +  K F      +Q   +K   +    A++     + + 
Sbjct: 74  PTLL--GYSLQGSFKFGGYE-VFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALC 130

Query: 243 PVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVS 302
           P++  +  L    +  P + N ++     + K+ G  +F+ GF P + +  P N A F+ 
Sbjct: 131 PLEATRIRL----VSQPTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFLV 186

Query: 303 FE 304
           FE
Sbjct: 187 FE 188

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 57/149 (38%), Gaps = 8/149 (5%)

Query: 46  PFDTTKVRLQTSKT--KIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNES 103
           P D  K R+Q   T    G+I   + ++ +EGA A   G    LLG  +  S +FG  E 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYEV 92

Query: 104 MKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNE 163
            K+ F     D +   + V      Y                P+E  RIRL +Q +  N 
Sbjct: 93  FKKLF----IDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFAN- 147

Query: 164 RQFKGPFDCIKKLAKAKALMRGLLPTMIR 192
               G F  I K   A +   G  P + +
Sbjct: 148 -GLVGGFSRILKEEGAGSFYNGFTPILFK 175

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 2/95 (2%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIG--VIEVVQNLLRNEGALAFYKGMLTP 86
           ++ +G   G+A  +V QP DT   ++  +K   G   I ++  L +  G +  + G+ T 
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFAGLPTR 272

Query: 87  LLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
           L+ VG   S+QFG+  S+K+      A  +    H
Sbjct: 273 LVMVGTLTSLQFGIYGSLKKTLGCAPAIEIGGGGH 307

 Score = 34.3 bits (77), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 9/91 (9%)

Query: 221 IPAWKLCSFG--ALSGTILWLTVY----PVDVVKSVLQTDSIENPKYKNSIIKATRALYK 274
           IP + L  +   AL+G I   T +    P+DVVK+ +Q   +E   Y   +I + + +  
Sbjct: 5   IPDYSLSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQ---LEPTVYNKGMISSFKQIIS 61

Query: 275 QHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
             G  A   GF PT++  +   +  F  +E+
Sbjct: 62  SEGAGALLTGFGPTLLGYSLQGSFKFGGYEV 92

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 69/324 (21%), Positives = 117/324 (36%), Gaps = 63/324 (19%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSKTKI--------GVIEVVQNLLRNEGALAFYKGML 84
           G  G  A+ L+  P D  K+  QTS            G++    ++   +     ++G  
Sbjct: 61  GVAGSCAKTLIA-PLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQGHS 119

Query: 85  TPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLC-GLTGGVVNSFL 143
             LL +    +V+F   E ++        + + P K      H   LC G   G+ + F 
Sbjct: 120 ATLLRIFPYAAVKFIAYEQIR--------NVIIPSKE--YETHFRRLCSGSLAGLCSVFC 169

Query: 144 AAPIEHVRIRLQTQTSQGNERQF---------------KGPFDCIKKLAKAKALMRGLLP 188
             P++ +R+RL   T     R +                      K  A+     RG +P
Sbjct: 170 TYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIP 229

Query: 189 TMIRAGHGLGTYF---------------AAYEALVVKEFEKG-------TPRN--QIP-- 222
           T+I      G  F               A Y  L V + +         T R   +IP  
Sbjct: 230 TVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLN 289

Query: 223 AWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENP-KYK-NSIIKATRALYKQHGIPA 280
            W     G L+G       YP ++++  LQ  ++ NP ++K  S+ +  + ++ + G   
Sbjct: 290 TWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRG 349

Query: 281 FFKGFVPTMIRAAPANAATFVSFE 304
           FF G     I+  P  A +F  +E
Sbjct: 350 FFVGLSIGYIKVTPMVACSFFVYE 373

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 87/201 (43%), Gaps = 38/201 (18%)

Query: 133 GLTGGVVNSF---LAAPIEHVRIRLQTQTSQGNERQFKGPFD-------CIKKLAKAKAL 182
           GL GGV  S    L AP++  RI++  QTS  +  ++ G F         I    + + +
Sbjct: 57  GLAGGVAGSCAKTLIAPLD--RIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGV 114

Query: 183 MRGLLPTMIRAGHGLGTYFAAYEALV-----VKEFEKGTPRNQIPAWKLCSFGALSGTIL 237
            +G   T++R        F AYE +       KE+E    R       LCS G+L+G   
Sbjct: 115 FQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRR-------LCS-GSLAGLCS 166

Query: 238 WLTVYPVDVVKSVLQTDSIENPKYKNSIIK------ATRALYKQHGIPA-------FFKG 284
               YP+D+++  L   +  +      ++K      A+ AL  +  +P        F++G
Sbjct: 167 VFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRG 226

Query: 285 FVPTMIRAAPANAATFVSFEM 305
           ++PT+I   P    +F + ++
Sbjct: 227 YIPTVIGMIPYAGVSFFAHDL 247

 Score = 34.7 bits (78), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 64/177 (36%), Gaps = 38/177 (21%)

Query: 17  VPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ--TSKTKIGVIEVVQNLLRNE 74
           + P   Y    + + +G++ G+  V    P D  +VRL   T   K+ V  +V+ +    
Sbjct: 143 IIPSKEYETHFRRLCSGSLAGLCSVFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEP 202

Query: 75  GALA----------------FYKGMLTPLLGVGICVSVQFGVNESMKRFF-----AAYNA 113
            + A                FY+G +  ++G+     V F  ++           A Y+ 
Sbjct: 203 ASEALSSKAYVPKWFAQWCNFYRGYIPTVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSV 262

Query: 114 DRVDP---------------QKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQ 155
            RVD                 K +PL      L G   G+ +   A P E +R RLQ
Sbjct: 263 LRVDDLDADDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQ 319

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 52/255 (20%), Positives = 101/255 (39%), Gaps = 28/255 (10%)

Query: 46  PFDTTKVRLQTS-KTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESM 104
           P D  K RLQ + K     ++  + ++ NEG    Y G     +G  +  + ++G  E  
Sbjct: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97

Query: 105 KRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNER 164
           K  ++++    + P   V      Y +   T   +   +  P E ++++ QT        
Sbjct: 98  KHLYSSW----LSPGVTV------YLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNN 147

Query: 165 QFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEF-------EKGTP 217
              G      +    KA  +G++P   R        F ++E +V K +       E+   
Sbjct: 148 VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNA 207

Query: 218 RNQIPAWKLCSF--GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQ 275
             QI      SF  G L+G +     +P DV+ S + ++   N     S+  A++ +Y++
Sbjct: 208 LQQISV----SFVGGYLAGILCAAVSHPADVMVSKINSERKAN----ESMSVASKRIYQK 259

Query: 276 HGIPAFFKGFVPTMI 290
            G    + G +  ++
Sbjct: 260 IGFTGLWNGLMVRIV 274

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 4/63 (6%)

Query: 243 PVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHG-IPAFFKGFVPTMIRAAPANAATFV 301
           P + +K   QT     P + N+++   + +Y + G + AF+KG VP   R  P     F 
Sbjct: 129 PFEAIKVKQQTTM---PPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFT 185

Query: 302 SFE 304
           SFE
Sbjct: 186 SFE 188

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 70/176 (39%), Gaps = 24/176 (13%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------GVIEVVQNLLRNEGALAF 79
           ++F+G   G+   ++G P    K RLQ+    I         GV   +  + + EG    
Sbjct: 131 NVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGL 190

Query: 80  YKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVV 139
           ++G+   +L  G   SVQ  +  + K      +  +  P  H    L    + GL   VV
Sbjct: 191 FRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALH----LTASTISGLGVAVV 246

Query: 140 NSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIR 192
            +    P + +  R+  Q        +KGP DC+ K  + +   AL +G    + R
Sbjct: 247 MN----PWDVILTRIYNQKGD----LYKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 75/328 (22%), Positives = 132/328 (40%), Gaps = 70/328 (21%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGV--IEVVQNLLRNEGALAFYKGML 84
           V  I AG++ G+    +  PF+  K  LQ  +  +     EV+   +R      ++ G  
Sbjct: 10  VTLITAGSVSGLFSATITYPFEFLKTGLQLHRNVVAAKPFEVLGYQVR-----TYFAG-- 62

Query: 85  TPLLGVGICVSVQFGVNESMKRFFAAYN--ADRVDP---QKHVPLPLHQYYLCGLTGGVV 139
                   C +V  GV       F A++  ++ + P    K  PL   Q  + G   G +
Sbjct: 63  --------CSAVNIGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQLLMAGALTGTM 114

Query: 140 NSFLAAPIEHVRI-----------RLQTQTS--QG---NE--RQF--------------- 166
            S    P E+V++           RL T TS  QG   NE  + F               
Sbjct: 115 ESLCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFP 174

Query: 167 -KGPFDCIKKLAK------AKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRN 219
            K P + +   A+       +A  +G +PT++R        F  +  L  K+F     +N
Sbjct: 175 EKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTML--KQFAPKEYQN 232

Query: 220 QIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQT-DSIENPKYKNSIIKATRALYKQHGI 278
               +     G +S   +     P+DV+K+ +Q  DS+    Y+NSI  A R ++ + G 
Sbjct: 233 N--EYFATLLGLISSCAVVGATQPLDVIKTRMQAKDSV--LLYRNSINCAYR-IFVEEGF 287

Query: 279 PAFFKGFVPTMIRAAPANAATFVSFEMT 306
              +KG++P +++   + + +F  ++ T
Sbjct: 288 AMLWKGWLPRLMKVGLSGSVSFGIYQYT 315

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 36/86 (41%), Gaps = 3/86 (3%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSKTKI---GVIEVVQNLLRNEGALAFYKGMLTPLLG 89
           G +   A V   QP D  K R+Q   + +     I     +   EG    +KG L  L+ 
Sbjct: 241 GLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIFVEEGFAMLWKGWLPRLMK 300

Query: 90  VGICVSVQFGVNESMKRFFAAYNADR 115
           VG+  SV FG+ +  +   A    +R
Sbjct: 301 VGLSGSVSFGIYQYTENMIALMRQER 326

>Kwal_27.11419
          Length = 298

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 77/179 (43%), Gaps = 22/179 (12%)

Query: 127 HQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGL 186
             +++ G  GG+ ++ +  P + ++ RLQ   S           D ++ +     L +G 
Sbjct: 8   RSHFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSN-------LLDVVRSIETPGQLWKGT 60

Query: 187 LPTMIRAGHG----LGTYFAAYEALVVKEFEKGTPRN-------QIPAWKLCSFGALSGT 235
           LP+ +R   G    L T      A+  K  +    +N       Q+  ++    GA++  
Sbjct: 61  LPSALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRA 120

Query: 236 ILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294
            + +   P+ V+K   ++ ++ N K   S+ +A   +Y+  GI   F G   T++R AP
Sbjct: 121 AVGVATMPITVLKVRFES-TMYNYK---SLGEAATHIYRSEGIRGLFSGCGATVMRDAP 175

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 63/293 (21%), Positives = 112/293 (38%), Gaps = 38/293 (12%)

Query: 22  PYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYK 81
           P GR       G +GG+   ++ QPFD  K RLQ +K+   +++VV+++   E     +K
Sbjct: 5   PRGR--SHFIGGFVGGLTSAVILQPFDLLKTRLQQNKSS-NLLDVVRSI---ETPGQLWK 58

Query: 82  GMLTPLL----GVGICVS----VQFGVNESMKRFFAAYN-ADRVDPQKHVPLPLHQYYLC 132
           G L   L    G  + +S    V+  + +   +  A  N +    PQ    L +++  + 
Sbjct: 59  GTLPSALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQ----LSMYENLIS 114

Query: 133 GLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIR 192
           G            PI  +++R   +++  N +        I +    + L  G   T++R
Sbjct: 115 GAITRAAVGVATMPITVLKVRF--ESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMR 172

Query: 193 AGHGLGTYFAAYE-----------ALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTV 241
                G Y   YE             +V+  E G    +     + S  A S   L  T+
Sbjct: 173 DAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTST-IINSIAAFSSASLATTI 231

Query: 242 -YPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAA 293
             P D +K+ +Q     NP      I+  +++ +       F G    + R A
Sbjct: 232 TSPFDTIKTRMQL----NPSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKA 280

 Score = 31.2 bits (69), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 41/84 (48%), Gaps = 2/84 (2%)

Query: 26  VVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK-IGVIEVVQNLLRNEGALAFYKGML 84
           ++  I A +   +A  +   PFDT K R+Q + ++  G I+  ++++R E     + G+ 
Sbjct: 215 IINSIAAFSSASLATTIT-SPFDTIKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLS 273

Query: 85  TPLLGVGICVSVQFGVNESMKRFF 108
             L    +   + +G+ E + + F
Sbjct: 274 LRLSRKALSAGIAWGIYEELVKKF 297

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 73/181 (40%), Gaps = 11/181 (6%)

Query: 128 QYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLL 187
           ++ L G  G         PI+ V+ R+Q +  +       G F  I     A AL+ G  
Sbjct: 17  KFALAGAIGCGATHSAMVPIDVVKTRIQLEPLK-YSSGMVGSFRKIVGEEGAAALLTGFG 75

Query: 188 PTMIRAGHGLGTYFAAYE----ALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYP 243
           PT++         F  YE    A V     +   + + P +      A++     + + P
Sbjct: 76  PTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIY--IGSAAIAEFFADIALCP 133

Query: 244 VDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303
           ++  +  L    +  P + N ++     + K+ GI +F+ GF P + +  P N A FV F
Sbjct: 134 LEATRIRL----VSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVVF 189

Query: 304 E 304
           E
Sbjct: 190 E 190

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 9/92 (9%)

Query: 220 QIPAWKLCSFG--ALSGTI----LWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALY 273
           Q+P + L  +   AL+G I        + P+DVVK+ +Q   +E  KY + ++ + R + 
Sbjct: 6   QVPNYSLSDYAKFALAGAIGCGATHSAMVPIDVVKTRIQ---LEPLKYSSGMVGSFRKIV 62

Query: 274 KQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305
            + G  A   GF PT++  +   A  F  +E+
Sbjct: 63  GEEGAAALLTGFGPTLLGYSMQGAFKFGGYEV 94

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 63/171 (36%), Gaps = 16/171 (9%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTS--KTKIGVIEVVQNLLRNEGALAFYKGMLT 85
           K   AG +G  A      P D  K R+Q    K   G++   + ++  EGA A   G   
Sbjct: 17  KFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGFGP 76

Query: 86  PLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA- 144
            LLG  +  + +FG  E  K+ F          Q   P+ +            +  F A 
Sbjct: 77  TLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGS--------AAIAEFFAD 128

Query: 145 ---APIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIR 192
               P+E  RIRL +Q +  N     G F  I K     +   G  P + +
Sbjct: 129 IALCPLEATRIRLVSQPTFAN--GLVGGFARILKEEGIGSFYNGFTPILFK 177

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 42  LVGQPFDTTKVRLQTSKTKIG--VIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFG 99
           ++ QP DT   ++  +K   G     ++  L +  G +  + G+ T L+ VG   S+QFG
Sbjct: 228 VISQPADTLLSKVNKTKKAPGQSTFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFG 287

Query: 100 VNESMKR 106
           +   +K+
Sbjct: 288 IYGKLKQ 294

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 69/157 (43%), Gaps = 6/157 (3%)

Query: 144 AAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAA 203
           A P++    R      +     F G    I +    +  ++G +PT+ R        F  
Sbjct: 173 ARPVQTAHERWLLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTT 232

Query: 204 YEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKN 263
           Y  +V    +  +P   +  ++  + GALS   +     P+DV+K+ +Q+ +     YK+
Sbjct: 233 YAWIV----QSLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWF-TYKS 287

Query: 264 SIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
           S+  A R ++ + G    +KG+VP + + + +   +F
Sbjct: 288 SLNCAYR-IFVEEGFRYMWKGWVPRLFKVSLSGGISF 323

 Score = 34.7 bits (78), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 36/87 (41%), Gaps = 3/87 (3%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSK---TKIGVIEVVQNLLRNEGALAFYKGMLTPLL 88
           AG +   A V + QP D  K R+Q+     T    +     +   EG    +KG +  L 
Sbjct: 254 AGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLF 313

Query: 89  GVGICVSVQFGVNESMKRFFAAYNADR 115
            V +   + FGV + ++     +  +R
Sbjct: 314 KVSLSGGISFGVYQYVENLVLLWEHER 340

>Scas_613.24
          Length = 177

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 72/171 (42%), Gaps = 23/171 (13%)

Query: 129 YYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGP--FDCIKKLAKAKALMRGL 186
           + + G  GG+ ++    P++ ++ R+Q         Q KG   +  IK +       RG 
Sbjct: 11  HLVSGFIGGLSSAVTLQPLDLLKTRIQ---------QHKGATLWSAIKDIKDPIQFWRGT 61

Query: 187 LPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRN--------QIPAWKLCSFGALSGTILW 238
           LP+ +R   G   Y +    +  +                 Q+  ++    GA++  ++ 
Sbjct: 62  LPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVG 121

Query: 239 LTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTM 289
               P+ ++K   ++       YK S+ +A + +YK  GI  FFKGF PT+
Sbjct: 122 YITMPITILKVRYESTYYS---YK-SMNEAIKDIYKMEGISGFFKGFGPTV 168

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 99/269 (36%), Gaps = 33/269 (12%)

Query: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVG 91
           AG +GG+         DT K R Q +      +   +++L+    +   +G    L G G
Sbjct: 59  AGGVGGIIGDSAMHSLDTVKTRQQGAPN----VHKYKHMLQAYRTMFIEEGFRRGLYG-G 113

Query: 92  ICVSVQFGVNESMKRFFAAYN-ADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHV 150
            C ++  G   S   FF+ Y    R     +       +   G  G   +SF+  P E +
Sbjct: 114 YCAAM-LGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLTAGFLGDFFSSFVYVPSEVL 172

Query: 151 RIRLQTQ--------TSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFA 202
           + RLQ Q         S  N +  +     I +     AL  G   T+ R        FA
Sbjct: 173 KTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFSALQFA 232

Query: 203 AYEALVVKEF---EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQT------ 253
            YE      F    K   ++ +        GA +G +  +   P+DVVK+ +QT      
Sbjct: 233 FYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVKTRVQTQLPSQI 292

Query: 254 DSIENPKYKN---------SIIKATRALY 273
           D   + K KN         SI K+ R +Y
Sbjct: 293 DISTDTKIKNVSKPVTLTNSIFKSLRTVY 321

>Kwal_26.7653
          Length = 325

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 75/185 (40%), Gaps = 24/185 (12%)

Query: 20  PTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------GVIEVVQNL 70
           P     V  ++ +G   G+   ++G P    K R+Q+    I          +   + ++
Sbjct: 124 PHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSI 183

Query: 71  LRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYY 130
            R EG    Y+G+   +L  G   SVQ  +  + K F   ++  +    +   L L    
Sbjct: 184 YRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMK----EGTGLHLVAST 239

Query: 131 LCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLL 187
           + G   GVV +    P + +  R+  Q  +GN   +KGP DC  K  + +   AL +G  
Sbjct: 240 VSGFGVGVVMN----PWDVILTRVYNQ--KGN--LYKGPLDCFVKTVRIEGIGALYKGFE 291

Query: 188 PTMIR 192
             + R
Sbjct: 292 AQIFR 296

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 101/271 (37%), Gaps = 35/271 (12%)

Query: 45  QPFDTTKVRLQTSKTKI---GVIEVVQNLLRNEGAL-AFYKGMLTPLLGVGICVSVQFGV 100
              DT K R Q + + +    +I   + ++  EG     Y G    +LG     ++ F  
Sbjct: 74  HSLDTVKTRQQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFAT 133

Query: 101 NESMKR-FFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTS 159
            E  KR     +  +              +   G  G  ++SF+  P E ++ RLQ Q  
Sbjct: 134 YEYTKRKMIGEWGINET----------FSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGR 183

Query: 160 QGNE-----RQFKGPFDCIKKLAKAKA---LMRGLLPTMIRAGHGLGTYFAAYEALVVKE 211
             N        +K   D +  + + +    L  G   T+ R     G  FA YE      
Sbjct: 184 YNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLA 243

Query: 212 F--EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQT-------DSIENPKYK 262
           F  E  T    +        GA +G +  +   P+DVVK+ +QT       +S +N K +
Sbjct: 244 FAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQ 303

Query: 263 ---NSIIKATRALYKQHGIPAFFKGFVPTMI 290
              NSI K    +YK  G+   F G  P  I
Sbjct: 304 TLTNSITKGMMTVYKTEGLAGLFSGVGPRFI 334

>Scas_715.45
          Length = 305

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 243 PVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVS 302
           P + +K   QT     P + N++I+  + +Y + G+  F+KG  P   R  P     F S
Sbjct: 135 PFEAIKVKQQTTM---PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191

Query: 303 FE 304
           FE
Sbjct: 192 FE 193

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 16/80 (20%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQT--------DSIENPKYKNSIIKATRALYKQHGIPAF 281
           GA++ ++   TVYP+D+ K+++QT        DS E  KYKN +I     ++K+ G    
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKN-VIDCIIKIFKKRGFLGL 68

Query: 282 FKGFVPTMIRAAPANAATFV 301
           ++G    +       AA FV
Sbjct: 69  YQGLATNV-------AANFV 81

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVI-EVVQNLLRNEGALAFYKGMLTP 86
           ++   G    +    V QP    K+ LQ   +K     EV+Q++ +NEG L+ +KG++ P
Sbjct: 223 ENFLLGMFSKMISTFVTQPLIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGVI-P 281

Query: 87  LLGVGICV 94
            +  G+ V
Sbjct: 282 QVSKGVIV 289

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 51/256 (19%), Positives = 95/256 (37%), Gaps = 30/256 (11%)

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFF------AAYNADR 115
              + +  + + EG    Y+G+ T         SV  G  ++   FF        Y   +
Sbjct: 77  STFDAIYKIYKQEGIRGLYQGLTT---------SVMAGFFQTFSYFFWYSFVRKCYFRVK 127

Query: 116 VDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKK 175
           +  +K+      +  L G+     +     PI  +  R QT+     +  F      I K
Sbjct: 128 LINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLTVAKEIYK 187

Query: 176 LAKA-KALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGT---------PRNQIPAWK 225
             ++ K   +GL  +++   +   TY  +YE L    F   T           +Q+  ++
Sbjct: 188 EQRSIKGFWKGLKVSLMLTINPSITY-TSYEKLKDALFTTDTMNLKKELVDSSSQLSPYQ 246

Query: 226 LCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGF 285
             + G LS  I  +   P+ + K+ LQ     N    +S  +    LYK  G+ +++KG 
Sbjct: 247 NFTLGVLSKMISAIITMPLIISKAWLQ----RNGSNFSSFQQVLYYLYKNEGLRSWWKGL 302

Query: 286 VPTMIRAAPANAATFV 301
            P + +        F+
Sbjct: 303 SPQLAKGVLVQGLLFM 318

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/134 (20%), Positives = 58/134 (43%), Gaps = 9/134 (6%)

Query: 170 FDCIKKLAKAKAL---MRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKL 226
           F  ++++ + +      +G +PT+ R        F  Y  L     +  +P   +  +  
Sbjct: 194 FTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLK----QMISPNKPLSEYYA 249

Query: 227 CSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFV 286
              G  S   +     P+DVVK+ +Q+    +  Y+NS+    R  + + G+ + +KG+V
Sbjct: 250 FGIGVFSSCAVVALTQPIDVVKTRMQSKYTWS-LYRNSLNCVYRT-FIEEGLTSLWKGWV 307

Query: 287 PTMIRAAPANAATF 300
           P + +   +   +F
Sbjct: 308 PRLFKVGLSGGVSF 321

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 35/86 (40%), Gaps = 3/86 (3%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSKTKI---GVIEVVQNLLRNEGALAFYKGMLTPLLG 89
           G     A V + QP D  K R+Q+  T       +  V      EG  + +KG +  L  
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFK 312

Query: 90  VGICVSVQFGVNESMKRFFAAYNADR 115
           VG+   V FGV + +     +   +R
Sbjct: 313 VGLSGGVSFGVYQYVDNLMLSMQYER 338

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 10/56 (17%)

Query: 258 NPKYK----------NSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303
           NP+Y+           +I    R + +  G   FF+G +PT+ R    +A  F ++
Sbjct: 176 NPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTY 231

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 34.3 bits (77), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query: 227 CSFGALSGTILWLTVYPVDVVKSVLQTDSIENP----KYKNSIIKATRALYKQHGIPAFF 282
            + GA+SG +    VYP D+++   Q  ++       +YK S+  A   + K  G   ++
Sbjct: 14  LAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYK-SVSDALITIGKTEGPKGYY 72

Query: 283 KGFVPTMIRAAPANAATFVSFEM 305
           KG    + +  P+ A +++ +E+
Sbjct: 73  KGLTANLFKVIPSTAVSWLVYEV 95

>Kwal_55.21106
          Length = 328

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 106/264 (40%), Gaps = 25/264 (9%)

Query: 51  KVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESM-KRFFA 109
           K R+Q  + K  +  +++ + + +G L  Y+G+ T ++  G   S  +    S+ ++ F 
Sbjct: 52  KSRVQEIRYKHSLDALIK-IFKTKGVLGLYQGLWTSIIA-GFLQSFSYFFWYSIVRKSFF 109

Query: 110 AYNADRVDPQK-HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKG 168
            Y   R    K   P  L    L G+    V+    +PI  +  R QT TS G++  F+ 
Sbjct: 110 RYKLLRGRLGKFSTPEEL----LLGIVAAAVSQIFTSPIGVISTRQQTSTS-GSKGGFRE 164

Query: 169 PFDCI-KKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEAL--VVKEFEKGTPRN------ 219
               I  +        RG   ++I   +   T FA+YE L  +    ++    N      
Sbjct: 165 VLHQIYSEQNNITGFWRGFKVSLILTVNPSIT-FASYEKLQDIFITSKRAVDENGQLLET 223

Query: 220 --QIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHG 277
             Q+   +    G  S  I  L   P+ V K+ LQ        ++  ++     LYKQ G
Sbjct: 224 SGQLSPRQNFLLGVFSKVISTLITQPLIVSKAYLQRTGSNFQSFQQVLL----YLYKQEG 279

Query: 278 IPAFFKGFVPTMIRAAPANAATFV 301
           + + +KG  P + +        F+
Sbjct: 280 LISLWKGLAPQLSKGILVQGLLFM 303

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 40/79 (50%), Gaps = 18/79 (22%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIE---------NPKYKNSIIKATR---------A 271
           GA++ ++  + VYP+D+VK+++QT + E          P+ K S ++  R          
Sbjct: 10  GAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALIK 69

Query: 272 LYKQHGIPAFFKGFVPTMI 290
           ++K  G+   ++G   ++I
Sbjct: 70  IFKTKGVLGLYQGLWTSII 88

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIE-VVQNLLRNEGALAFYKGMLTP 86
           ++   G    V   L+ QP   +K  LQ + +     + V+  L + EG ++ +KG L P
Sbjct: 231 QNFLLGVFSKVISTLITQPLIVSKAYLQRTGSNFQSFQQVLLYLYKQEGLISLWKG-LAP 289

Query: 87  LLGVGICV 94
            L  GI V
Sbjct: 290 QLSKGILV 297

>Scas_687.15*
          Length = 328

 Score = 35.0 bits (79), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 3/73 (4%)

Query: 33  GTMGGVAQVLVGQPFDTTKVRLQTSKTKI---GVIEVVQNLLRNEGALAFYKGMLTPLLG 89
           G     A V + QP D  K R+Q+          +     +   EG ++ +KG L  L  
Sbjct: 240 GLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMVSLWKGWLPRLFK 299

Query: 90  VGICVSVQFGVNE 102
           VG+   + FGV +
Sbjct: 300 VGLSGGISFGVYQ 312

>Kwal_55.21338
          Length = 323

 Score = 35.0 bits (79), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 39/88 (44%), Gaps = 1/88 (1%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPL 87
           + +  G++ G        P      R+   K+  G +  + +++++EG    +KG L P 
Sbjct: 120 ESMLVGSIAGSLNATAANPLWVANTRMTVQKSDRGTLSTIFDIVKDEGISGLFKG-LNPA 178

Query: 88  LGVGICVSVQFGVNESMKRFFAAYNADR 115
           L + I   +Q+ V E +K +  +    R
Sbjct: 179 LILVINPIIQYTVYEQLKNWILSSRQTR 206

 Score = 28.5 bits (62), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 2/63 (3%)

Query: 242 YPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFV 301
           YP+ VV + LQT   +  K   S+    + +Y++ G   FF G    +     +N   + 
Sbjct: 41  YPLIVVTTKLQTQDAKGEKL--SLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYY 98

Query: 302 SFE 304
            +E
Sbjct: 99  CYE 101

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 35.0 bits (79), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVI-EVVQNLLRNEGALAFYKGMLTP 86
           ++   G +  +    +  P    K  LQ S +K     EV+  L R+EGA A +KG+L P
Sbjct: 255 QNFLIGVLSKIISTCLTHPLIVAKASLQRSSSKFTSFQEVLTYLYRHEGAHALWKGLL-P 313

Query: 87  LLGVGICV 94
            L  G+ V
Sbjct: 314 QLTKGVIV 321

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/244 (18%), Positives = 89/244 (36%), Gaps = 13/244 (5%)

Query: 64  IEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVP 123
           ++V+  + RNEG    Y G+   LLG  I     F     ++R +      + +  +   
Sbjct: 91  LDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGEAARFST 150

Query: 124 LPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALM 183
           +   +  L  +     +     PI  V  + QT+     +  FK     +          
Sbjct: 151 I---EELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKAIAKEVYDEDGITGFW 207

Query: 184 RGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRN------QIPAWKLCSFGALSGTIL 237
           + L  +++   +   TY +A +   +    +   ++      Q+   +    G LS  I 
Sbjct: 208 KSLKVSLVLTINPSITYASAEKLKDILYHVEWNAKDLNDSSLQLKPGQNFLIGVLSKIIS 267

Query: 238 WLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANA 297
               +P+ V K+ LQ  S +   ++  +      LY+  G  A +KG +P + +      
Sbjct: 268 TCLTHPLIVAKASLQRSSSKFTSFQEVLT----YLYRHEGAHALWKGLLPQLTKGVIVQG 323

Query: 298 ATFV 301
             F+
Sbjct: 324 LLFM 327

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKA 268
           GA+S     L VYP+D+ K+V+QT   +   Y +S ++A
Sbjct: 10  GAVSSGFANLAVYPLDLAKTVIQTQLKQGDLYPSSDVQA 48

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 34.7 bits (78), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 59/124 (47%), Gaps = 8/124 (6%)

Query: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240
           A ++G   T+ R        F AY A     F++        A  + +  A S T++ +T
Sbjct: 158 AFVQGTTATIFRQIANTSIQFTAYTA-----FKRLLQARNDKASSVITGLATSFTLVAMT 212

Query: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300
             P+DVVK+ + + + +  +YKN++    R ++ Q G+  F+KG +   ++   +   TF
Sbjct: 213 -QPIDVVKTRMMSQNAKT-EYKNTLNCMYR-IFVQEGMATFWKGSIFRFMKVGISGGLTF 269

Query: 301 VSFE 304
             +E
Sbjct: 270 TVYE 273

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 42/210 (20%), Positives = 76/210 (36%), Gaps = 49/210 (23%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKV---------------------------RLQTSKTKIG 62
           + AGT+ G+ + L   PF+  K                            ++ T  T + 
Sbjct: 79  LIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 63  VIE----VVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDP 118
            IE     V+++ +  G  AF +G    +       S+QF    + KR   A N    D 
Sbjct: 139 RIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARN----DK 194

Query: 119 QKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK 178
              V        + GL        +  PI+ V+ R+    SQ  + ++K   +C+ ++  
Sbjct: 195 ASSV--------ITGLATSFTLVAMTQPIDVVKTRMM---SQNAKTEYKNTLNCMYRIFV 243

Query: 179 AKAL---MRGLLPTMIRAGHGLGTYFAAYE 205
            + +    +G +   ++ G   G  F  YE
Sbjct: 244 QEGMATFWKGSIFRFMKVGISGGLTFTVYE 273

 Score = 31.2 bits (69), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 3/79 (3%)

Query: 29  DIFAGTMGGVAQVLVGQPFDTTKVRL--QTSKTKI-GVIEVVQNLLRNEGALAFYKGMLT 85
            +  G       V + QP D  K R+  Q +KT+    +  +  +   EG   F+KG + 
Sbjct: 197 SVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGSIF 256

Query: 86  PLLGVGICVSVQFGVNESM 104
             + VGI   + F V E +
Sbjct: 257 RFMKVGISGGLTFTVYEQV 275

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 77/198 (38%), Gaps = 29/198 (14%)

Query: 123 PLPLH--QYYLCGLTGGVV----NSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKL 176
           P+PL   +YY     GGVV          P++ V+ RLQ      N + ++   D  K +
Sbjct: 6   PIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV-----NPQLYRSNLDGWKTI 60

Query: 177 AKAKALMR---GLLPTMI------RAGHGLGTYFA-AYEALVVKEFEKGTPRNQIPAWKL 226
            +++ L +   G+  T I         +G   YF   Y  L+  E    T      A  L
Sbjct: 61  VRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPE----TAHRHRTAVYL 116

Query: 227 CSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFV 286
           C+  A +  +  + + P + +K   QT     P +  + ++    +    G+   +KG  
Sbjct: 117 CA-SASAEFLADILLCPWEAIKVKQQTTI---PPFCKNFLEGWSKITAAEGLSGLYKGIT 172

Query: 287 PTMIRAAPANAATFVSFE 304
           P   R  P     F SFE
Sbjct: 173 PLWCRQIPYTMCKFTSFE 190

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 48/244 (19%), Positives = 100/244 (40%), Gaps = 27/244 (11%)

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
            V++ + N+ + +G L  Y+GM    +   +   V F     +++ +  +    +   K+
Sbjct: 56  NVVDCMINIFKEKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKN 115

Query: 122 VPLPLH----QYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLA 177
              P+     +  + G+    ++    +P+  V  R QT  S     +F    + IK + 
Sbjct: 116 RDGPITPSTIEELVLGVAAASISQLFTSPMAVVATRQQTVHS-AESAKFT---NVIKDIY 171

Query: 178 KAK-----ALMRGLLPTMIRAGHGL----GTYFAAYEALVVKEF-EKGTPRNQIPAWKLC 227
           +       A  +GL     R G  L       +A+++ L    F +       + A +  
Sbjct: 172 RENNGDITAFWKGL-----RTGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNF 226

Query: 228 SFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVP 287
             G LS  I  L   P+ V K++LQ+   +   ++ +++     LYK  G+ + +KG +P
Sbjct: 227 ILGVLSKMISTLVTQPLIVAKAMLQSAGSKFTTFQEALL----YLYKNEGLKSLWKGVLP 282

Query: 288 TMIR 291
            + +
Sbjct: 283 QLTK 286

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 21/85 (24%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQT--------DSIE-----NPKYKNSIIKATRALYKQH 276
           GA++  +  + VYP+D+ K+++Q+        DS E     N +YKN ++     ++K+ 
Sbjct: 10  GAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKN-VVDCMINIFKEK 68

Query: 277 GIPAFFKGFVPTMIRAAPANAATFV 301
           GI   ++G   T +       ATFV
Sbjct: 69  GILGLYQGMTVTTV-------ATFV 86

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 43  VGQPFDTTKVRLQTSKTKI-GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVN 101
           V  PFDT K R+Q   +K         ++++NE  L  + G+   L        + +G+ 
Sbjct: 240 VTAPFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGIAWGIY 299

Query: 102 ESM-KRFF 108
           E + KRF 
Sbjct: 300 EELVKRFM 307

 Score = 32.0 bits (71), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 51/143 (35%), Gaps = 15/143 (10%)

Query: 25  RVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGML 84
           R    +  G  GG+   +  QP D  K R+Q  K       + +NL   +  L  ++G L
Sbjct: 9   RNSSHLIGGFFGGLTSAVALQPLDLLKTRIQQDKKAT----LWKNLKEIDSPLQLWRGTL 64

Query: 85  TPLLGVGICVSVQFGVNESMKRFFAAY--------NADRVDPQKHVPLPLHQYYLCGLTG 136
              L   I  ++       M+   A          N   +   K   LP    Y   LTG
Sbjct: 65  PSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYENLLTG 124

Query: 137 GVVN---SFLAAPIEHVRIRLQT 156
                   ++  PI  +++R ++
Sbjct: 125 AFARGLVGYITMPITVIKVRYES 147

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 71/185 (38%), Gaps = 27/185 (14%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQN-------LLRNEGALAFYKG 82
           I  G  GGVAQ  +   F T    ++ +K K       Q+       +   EG     KG
Sbjct: 109 IMGGVSGGVAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSSWAAFKEIYNKEGIRGINKG 168

Query: 83  MLTPLLGVGICVSVQFG----VNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGV 138
           +    +        +FG    V E +++F    N D           L + +   + GG+
Sbjct: 169 VNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPD------DKLTALEKIFASAIGGGL 222

Query: 139 VNSFLAAPIEHVRIRLQTQTSQGN---ERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGH 195
             S    PIE +R+ +Q++T+  N   +      F  I +    K L RG+ P +     
Sbjct: 223 --SAWNQPIEVIRVEMQSKTNDPNRPKDLTVGKAFRYIYQSNGVKGLYRGVTPRI----- 275

Query: 196 GLGTY 200
           GLG +
Sbjct: 276 GLGIW 280

>Kwal_34.15907
          Length = 312

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 78/195 (40%), Gaps = 19/195 (9%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVV--------QNLLRNEGALAFYK 81
           I  G  GGVAQ  +   F T    ++ +K K  V   +        + +   EG     K
Sbjct: 112 IMGGVSGGVAQAYLTMGFCTCMKTVEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGINK 171

Query: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141
           G+    +        +FG++  +++    +   + +P   +   L + +   L GG+  S
Sbjct: 172 GVNAVAIRQMTNWGSRFGLSRLVEQGIRDFTG-KTNPDDKLT-ALEKIFASALGGGL--S 227

Query: 142 FLAAPIEHVRIRLQTQTSQGNERQ---FKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLG 198
               PIE +R+ +Q++    N  +       F  I + +  K L RG+ P   R G G+ 
Sbjct: 228 AWNQPIEVIRVEMQSKKEDPNRPKKLTVGSAFKYIYQSSGIKGLYRGVAP---RIGLGVW 284

Query: 199 -TYFAAYEALVVKEF 212
            T F      + KEF
Sbjct: 285 QTVFMVGFGDIAKEF 299

>Scas_705.9
          Length = 323

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 51/250 (20%), Positives = 99/250 (39%), Gaps = 20/250 (8%)

Query: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKH 121
            VI  +  + R  G    Y+GM T +    +     F     ++R + +    R    + 
Sbjct: 55  NVIRCLIRIFRKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARP 114

Query: 122 V-PLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKL---- 176
           +  +   +  + G+    +   +  PIE +  + QT   + N       +  +K++    
Sbjct: 115 INSISTVEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDNV----DFYSVLKQIYVES 170

Query: 177 -AKAKALMRGLLPTMIRAGHGLGTYFAAYEA---LVVKEFEKG--TPRNQIPAWKLCSFG 230
             K  +  +G   ++I   +   T FAAY+    +++K+      +   Q+   +    G
Sbjct: 171 NGKLSSYWKGFKVSLILTVNPSIT-FAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILG 229

Query: 231 ALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMI 290
           AL+  I  +   P+ V K  LQ     N K+K+   +  R LYK+ G+ A +KG  P + 
Sbjct: 230 ALAKIISTIITQPLIVAKVSLQRS---NSKFKH-FEEVLRYLYKEEGVLALWKGVGPQLT 285

Query: 291 RAAPANAATF 300
           +        F
Sbjct: 286 KGVLVQGLVF 295

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 35/66 (53%), Gaps = 11/66 (16%)

Query: 230 GALSGTILWLTVYPVDVVKSVLQ-------TDSIENPKYK----NSIIKATRALYKQHGI 278
           GA++ T+  + VYP+DV K+V+Q       TD +     +     ++I+    ++++ G+
Sbjct: 10  GAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKRGL 69

Query: 279 PAFFKG 284
              ++G
Sbjct: 70  RGLYQG 75

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 90/232 (38%), Gaps = 20/232 (8%)

Query: 57  SKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRV 116
           SK+K+   E V+ + R EG + FY G+ + + G+       +   E      AA    RV
Sbjct: 57  SKSKL---EAVREIYRKEGVVGFYYGLESAMYGMAANSLNYYYFYE-----LAARATMRV 108

Query: 117 DPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKL 176
              +   L   +  L     G + +  + PI  V  R+    S+  +       D ++K 
Sbjct: 109 RGSRR--LNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSE--QSTLAVLLDIVRK- 163

Query: 177 AKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWK--LCSFGALSG 234
               AL  GL P ++   + +  Y   +E L     +       +P+W   L + G L+ 
Sbjct: 164 DGVTALFNGLRPALMLVSNPIIQY-TVFEQLKNVVLKWSGSDVLLPSWAFLLGAVGKLAA 222

Query: 235 TILWLTVYPVDVVKSVLQ-TDSIENPKYKNSIIKATRALYKQHGIPAFFKGF 285
           T    + YP   +K+ +      E+   + S+      + K+ GI   + G 
Sbjct: 223 TG---STYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIVKKEGIQGLYHGI 271

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 51/273 (18%), Positives = 99/273 (36%), Gaps = 20/273 (7%)

Query: 27  VKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTP 86
           +  + +G   G +  L   P DT K RLQ                 N G    Y+G+ + 
Sbjct: 7   IASLVSGAAAGTSTDLAFFPIDTLKTRLQAKG----------GFFANGGYKGVYRGLGSA 56

Query: 87  LLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAP 146
           ++      S+ F   +SMK +        +   +        + +    G +    +  P
Sbjct: 57  VVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACMVRVP 116

Query: 147 IEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEA 206
            E ++ R QT  +  + +  +            + L RG   T++R        F  YE 
Sbjct: 117 AEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQFPLYEY 176

Query: 207 LVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKS--VLQTDSIENPKYKNS 264
           +  K + +   + +   W+    G ++G I      P+DV+K+  +L   S+       S
Sbjct: 177 M-KKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLHHKSV-------S 228

Query: 265 IIKATRALYKQHGIPAFFKGFVPTMIRAAPANA 297
            +   + + ++ G+  FF G  P  +  +   A
Sbjct: 229 ALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGA 261

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/63 (20%), Positives = 28/63 (44%)

Query: 46  PFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMK 105
           P D  K R+      +  + + + +L+ EG   F+ G+    + +    ++  GV E++ 
Sbjct: 212 PLDVLKTRIMLHHKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVH 271

Query: 106 RFF 108
             F
Sbjct: 272 SLF 274

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEVVQNLLRNEGALAFYKGMLTPLL 88
            A  +  VA  +   PFD    R+   +  +  G ++ +   +R EG  A YKG L  LL
Sbjct: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277

Query: 89  GV 90
            +
Sbjct: 278 RI 279

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 74/183 (40%), Gaps = 22/183 (12%)

Query: 30  IFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI----GV-----IEVVQNLLRNEGALAFY 80
           I  G  GGVAQ  +   F T    ++ +++K     GV     ++V + +   EG     
Sbjct: 111 ILGGVSGGVAQAYLTMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGIN 170

Query: 81  KGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVN 140
           KG+    +        +FG++  ++         R D +      + +     L GG+  
Sbjct: 171 KGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSA---MEKIVASALGGGL-- 225

Query: 141 SFLAAPIEHVRIRLQTQTSQGNERQ---FKGPFDCIKKLAKAKALMRGLLPTMIRAGHGL 197
           S    PIE +R+ +Q++T+  N  +       F  I +    + L RG+ P +     GL
Sbjct: 226 SAWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGLYRGVTPRI-----GL 280

Query: 198 GTY 200
           G +
Sbjct: 281 GVW 283

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/65 (21%), Positives = 30/65 (46%)

Query: 242 YPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFV 301
           YP+  + + LQT   +      S ++  + +Y++ G+  F+ G    +   A  N   + 
Sbjct: 32  YPLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYY 91

Query: 302 SFEMT 306
            +E+T
Sbjct: 92  FYELT 96

>Kwal_23.5757
          Length = 307

 Score = 28.1 bits (61), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 18/46 (39%)

Query: 259 PKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304
           P +  ++  A   +    G  + +KG  P   R  P     F SFE
Sbjct: 150 PPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.138    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,642,875
Number of extensions: 382920
Number of successful extensions: 2113
Number of sequences better than 10.0: 203
Number of HSP's gapped: 1323
Number of HSP's successfully gapped: 483
Length of query: 306
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 205
Effective length of database: 13,099,691
Effective search space: 2685436655
Effective search space used: 2685436655
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)