Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K12188g53552727390.0
YBR103W (SIF2)53553414470.0
Scas_718.6*54655413091e-176
Sklu_1926.550953112901e-174
ADL322C50153311771e-157
Kwal_27.1258650951911091e-147
KLLA0E11297g51252910851e-143
Scas_720.955152101648e-12
ADR077C12041411632e-11
CAGL0H03729g3032391582e-11
YCR072C5152991612e-11
CAGL0J03476g5172231612e-11
Scas_585.84603051602e-11
YNL317W (PFS2)4652311593e-11
Kwal_55.220674512261583e-11
CAGL0I03718g12011411603e-11
Kwal_23.6324514851575e-11
ADL184W4493061531e-10
Sklu_2318.17111781542e-10
Sklu_2416.54592691532e-10
AEL246C8152341542e-10
YDL145C (COP1)12011411542e-10
KLLA0D04840g3031611492e-10
Sklu_2173.2515881522e-10
Sklu_2442.23031641492e-10
Sklu_1963.23141731483e-10
Kwal_0.2123031871474e-10
AER263C513961504e-10
KLLA0C08547g5153041504e-10
Scas_624.1112051411514e-10
Scas_721.73251691467e-10
KLLA0F04884g12121431499e-10
Kwal_56.2452612101411471e-09
CAGL0C01441g10051461452e-09
CAGL0M06193g3161461403e-09
KLLA0E07073g4522681415e-09
KLLA0E04741g4591691405e-09
CAGL0K09284g9111961425e-09
KLLA0E23529g8262421416e-09
AEL269C4552621406e-09
Scas_629.126712501416e-09
YNL006W (LST8)3032391377e-09
YBR175W (SWD3)3151751378e-09
Sklu_2291.49971261409e-09
AFL009C413861381e-08
YCR084C (TUP1)7131551381e-08
AAL009C3031641351e-08
KLLA0F10263g6822811381e-08
Scas_465.41002911381e-08
CAGL0M04081g4552711371e-08
YPL183C10131121381e-08
CAGL0L03201g5791581362e-08
AFL056C976991362e-08
KLLA0E18986g990891363e-08
Scas_695.153272391333e-08
AAR057W9222031353e-08
Sklu_2431.127492321344e-08
Kwal_47.175554171101334e-08
Scas_631.174742731325e-08
Scas_630.66212751318e-08
YCR057C (PWP2)9231961328e-08
Kwal_23.53514742091301e-07
KLLA0C08976g9111991311e-07
CAGL0C03608g6433021301e-07
Kwal_23.62409132261311e-07
YPR178W (PRP4)4651311291e-07
AGL196C9352491282e-07
YMR146C (TIF34)347761262e-07
CAGL0M04279g9402261282e-07
Kwal_34.15818349791262e-07
Sklu_675.1308791253e-07
Kwal_23.50357441331273e-07
KLLA0D07546g6472241263e-07
YGL004C (RPN14)4171441254e-07
CAGL0E00561g8361431264e-07
Scas_720.83d915911255e-07
Kwal_23.64297501431256e-07
Scas_680.11347791201e-06
CAGL0G09845g5002201202e-06
CAGL0G04345g711971193e-06
YKR036C (CAF4)6591041193e-06
YBR198C (TAF5)7982771193e-06
Scas_719.309402341193e-06
CAGL0L00781g6731961183e-06
ADR264C346791164e-06
Scas_707.227301321174e-06
KLLA0B14410g7061971174e-06
Kwal_27.12053755761174e-06
CAGL0M05335g806931175e-06
KLLA0F13244g8141291175e-06
AGL234W6291501165e-06
Kwal_27.115858231191166e-06
KLLA0E12287g3261321146e-06
KLLA0C07425g4441431156e-06
CAGL0C00737g8161821167e-06
YLR409C (UTP21)9392081167e-06
CAGL0M02277g4272621148e-06
AGR168W8252201159e-06
CAGL0M09845g9362351159e-06
YFL009W (CDC4)7791191159e-06
CAGL0K00275g7151511149e-06
Scas_679.288151001141e-05
AFL007C5512361131e-05
Scas_704.40608851131e-05
KLLA0E07942g3901121121e-05
AFR199C3341441111e-05
YLR129W (DIP2)9431011132e-05
AGR180W8063181122e-05
CAGL0A00561g4121451112e-05
Scas_692.294561631112e-05
AGL024W756771122e-05
KLLA0F07403g3471871102e-05
Kwal_56.239209372171122e-05
CAGL0F06853g3881111102e-05
YPL151C (PRP46)4511981112e-05
YLR222C (UTP13)8171101113e-05
Scas_721.328223351103e-05
CAGL0A00605g6402351094e-05
KLLA0A08866g423741094e-05
YIL046W (MET30)6401021094e-05
Scas_685.113841131085e-05
YJL112W (MDV1)7142871095e-05
ACR166W3881091075e-05
Kwal_27.126677213431086e-05
CAGL0B03575g4192341076e-05
KLLA0F27511g623761076e-05
Scas_713.509832211086e-05
CAGL0L02629g7951631086e-05
ADL082C5691001077e-05
CAGL0L06952g347791067e-05
Scas_397.24101041068e-05
CAGL0C02937g4672671068e-05
ACR137W4252521051e-04
KLLA0E24508g327791041e-04
KLLA0D16390g936851051e-04
YKL021C (MAK11)4681151041e-04
Kwal_33.155917141691051e-04
Sklu_2364.24111031041e-04
Kwal_27.11126996891051e-04
Kwal_27.12239316771022e-04
KLLA0C07513g439861022e-04
Sklu_2430.9966361032e-04
Kwal_47.174658001951032e-04
CAGL0L10890g457911023e-04
KLLA0B02827g9421931023e-04
Kwal_33.151364731791023e-04
Sklu_2420.24411581013e-04
Kwal_14.8843951211004e-04
Sklu_2172.626372984e-04
Scas_603.55891581005e-04
AEL314W715981005e-04
Kwal_26.757021879966e-04
AER448W714148996e-04
YOR272W (YTM1)46094996e-04
Scas_711.1169588996e-04
Scas_677.3254398996e-04
CAGL0E02805g840133997e-04
AER337W44590987e-04
Kwal_26.8776433258978e-04
YKL213C (DOA1)715124989e-04
YOR269W (PAC1)49493970.001
YDR128W1148175970.001
Kwal_33.1351539875960.001
KLLA0D04664g50097970.001
KLLA0F21406g70557970.001
YER066W18594930.001
KLLA0E21263g429149960.001
Scas_693.221145111970.001
KLLA0F22000g793113970.001
KLLA0E21879g333276950.001
YMR116C (ASC1)319152950.001
KLLA0F15598g478179960.001
AAL157C479181960.001
CAGL0D02090g277154940.001
AGR207C320128950.001
CAGL0K10692g50584950.002
KLLA0F11231g434186950.002
CAGL0F07337g621212950.002
Scas_701.451276279950.002
CAGL0L02761g419239940.002
Kwal_33.13148673126940.002
Scas_702.16816134940.002
YLR429W (CRN1)65184940.003
Kwal_23.5769627192940.003
KLLA0B12804g852205940.003
KLLA0A04928g861196930.004
Kwal_33.15475783139920.004
AEL250C41799910.004
Scas_607.846295920.004
Scas_721.115*31891910.005
Scas_592.4*31891910.005
YBL008W (HIR1)840132920.005
ACR097W467104910.005
Kwal_26.8953458270910.005
YLL011W (SOF1)489169910.005
Scas_692.2548883910.005
YGL003C (CDH1)566236910.005
YDR364C (CDC40)45580900.006
AER081C1023212910.006
Sklu_2406.11426111900.007
Sklu_2139.254197900.007
CAGL0G03399g369146890.008
CAGL0J08998g1281253900.008
YGL116W (CDC20)610206890.009
Scas_670.2159599890.009
Scas_659.947599890.009
Sklu_2364.4555236890.009
YDL195W (SEC31)1273242890.010
CAGL0A02772g44173880.012
Sklu_1645.2587194880.013
AGR367C771126880.014
YBL106C (SRO77)101098880.015
Scas_721.2941492870.015
YMR102C83439870.018
Kwal_23.411893999870.020
Scas_719.5262890860.020
ADR176W46194860.021
CAGL0M05291g419124860.021
Scas_717.6890838860.021
AFL006C43399860.022
Kwal_26.765574335860.024
Kwal_26.8628422121850.027
Sklu_2382.21261285860.028
KLLA0F19734g1133111860.028
KLLA0B07667g199987860.030
Sklu_2167.530348830.034
Scas_700.27*43377840.036
Kwal_26.897544557840.037
AFL014C557298840.038
AGL301C36156830.039
Sklu_2423.1944207840.044
CAGL0H08932g90298840.044
CAGL0J04818g65484830.046
KLLA0B01958g890100840.047
Kwal_56.244781296116840.050
CAGL0G00704g44096830.051
Kwal_14.123560772830.056
Kwal_56.2439936942820.057
Kwal_56.23685110269830.058
YAR003W (SWD1)42698820.058
YML102W (CAC2)468128820.063
Scas_658.1442173820.067
Sklu_2113.277594820.080
Kwal_55.21450503110810.087
Scas_442.2*795157810.087
YCL039W (GID7)745172810.088
Scas_657.13411125800.096
CAGL0K03377g97838810.098
ABL024W73431810.099
Sklu_2332.736757800.10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K12188g
         (527 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...  1059   0.0  
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...   561   0.0  
Scas_718.6*                                                           508   e-176
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement        501   e-174
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...   457   e-157
Kwal_27.12586                                                         431   e-147
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...   422   e-143
Scas_720.95                                                            68   8e-12
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    67   2e-11
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    65   2e-11
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    67   2e-11
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    67   2e-11
Scas_585.8                                                             66   2e-11
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    66   3e-11
Kwal_55.22067                                                          65   3e-11
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    66   3e-11
Kwal_23.6324                                                           65   5e-11
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    64   1e-10
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          64   2e-10
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           64   2e-10
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    64   2e-10
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    64   2e-10
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    62   2e-10
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            63   2e-10
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            62   2e-10
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         62   3e-10
Kwal_0.212                                                             61   4e-10
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    62   4e-10
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    62   4e-10
Scas_624.11                                                            63   4e-10
Scas_721.7                                                             61   7e-10
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    62   9e-10
Kwal_56.24526                                                          61   1e-09
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    60   2e-09
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    59   3e-09
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    59   5e-09
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    59   5e-09
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    59   5e-09
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    59   6e-09
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    59   6e-09
Scas_629.12                                                            59   6e-09
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    57   7e-09
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    57   8e-09
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         59   9e-09
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    58   1e-08
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    58   1e-08
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    57   1e-08
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    58   1e-08
Scas_465.4                                                             58   1e-08
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    57   1e-08
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    58   1e-08
CAGL0L03201g complement(366795..368534) some similarities with s...    57   2e-08
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    57   2e-08
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    57   3e-08
Scas_695.15                                                            56   3e-08
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    57   3e-08
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      56   4e-08
Kwal_47.17555                                                          56   4e-08
Scas_631.17                                                            55   5e-08
Scas_630.6                                                             55   8e-08
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    55   8e-08
Kwal_23.5351                                                           55   1e-07
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    55   1e-07
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    55   1e-07
Kwal_23.6240                                                           55   1e-07
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    54   1e-07
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    54   2e-07
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    53   2e-07
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    54   2e-07
Kwal_34.15818                                                          53   2e-07
Sklu_675.1 YMR146C, Contig c675 761-1687                               53   3e-07
Kwal_23.5035                                                           54   3e-07
KLLA0D07546g complement(647984..649927) some similarities with s...    53   3e-07
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    53   4e-07
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    53   4e-07
Scas_720.83d                                                           53   5e-07
Kwal_23.6429                                                           53   6e-07
Scas_680.11                                                            51   1e-06
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    51   2e-06
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    50   3e-06
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    50   3e-06
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    50   3e-06
Scas_719.30                                                            50   3e-06
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    50   3e-06
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    49   4e-06
Scas_707.22                                                            50   4e-06
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    50   4e-06
Kwal_27.12053                                                          50   4e-06
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    50   5e-06
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    50   5e-06
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    49   5e-06
Kwal_27.11585                                                          49   6e-06
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    49   6e-06
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    49   6e-06
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    49   7e-06
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    49   7e-06
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    49   8e-06
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    49   9e-06
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    49   9e-06
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    49   9e-06
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    49   9e-06
Scas_679.28                                                            49   1e-05
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    48   1e-05
Scas_704.40                                                            48   1e-05
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    48   1e-05
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    47   1e-05
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    48   2e-05
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    48   2e-05
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    47   2e-05
Scas_692.29                                                            47   2e-05
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    48   2e-05
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    47   2e-05
Kwal_56.23920                                                          48   2e-05
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    47   2e-05
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    47   2e-05
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    47   3e-05
Scas_721.32                                                            47   3e-05
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    47   4e-05
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    47   4e-05
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    47   4e-05
Scas_685.11                                                            46   5e-05
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    47   5e-05
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    46   5e-05
Kwal_27.12667                                                          46   6e-05
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    46   6e-05
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    46   6e-05
Scas_713.50                                                            46   6e-05
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    46   6e-05
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    46   7e-05
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    45   7e-05
Scas_397.2                                                             45   8e-05
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    45   8e-05
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    45   1e-04
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    45   1e-04
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    45   1e-04
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    45   1e-04
Kwal_33.15591                                                          45   1e-04
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         45   1e-04
Kwal_27.11126                                                          45   1e-04
Kwal_27.12239                                                          44   2e-04
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    44   2e-04
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                          44   2e-04
Kwal_47.17465                                                          44   2e-04
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    44   3e-04
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    44   3e-04
Kwal_33.15136                                                          44   3e-04
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            44   3e-04
Kwal_14.884                                                            43   4e-04
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       42   4e-04
Scas_603.5                                                             43   5e-04
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    43   5e-04
Kwal_26.7570                                                           42   6e-04
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    43   6e-04
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    43   6e-04
Scas_711.11                                                            43   6e-04
Scas_677.32                                                            43   6e-04
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    43   7e-04
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    42   7e-04
Kwal_26.8776                                                           42   8e-04
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    42   9e-04
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    42   0.001
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    42   0.001
Kwal_33.13515                                                          42   0.001
KLLA0D04664g 397818..399320 similar to sp|P43601 Saccharomyces c...    42   0.001
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    42   0.001
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    40   0.001
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    42   0.001
Scas_693.22                                                            42   0.001
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    42   0.001
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    41   0.001
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    41   0.001
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    42   0.001
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    42   0.001
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    41   0.001
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    41   0.001
CAGL0K10692g 1039413..1040930 similar to sp|P43601 Saccharomyces...    41   0.002
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    41   0.002
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    41   0.002
Scas_701.45                                                            41   0.002
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    41   0.002
Kwal_33.13148                                                          41   0.002
Scas_702.16                                                            41   0.002
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    41   0.003
Kwal_23.5769                                                           41   0.003
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...    41   0.003
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    40   0.004
Kwal_33.15475                                                          40   0.004
AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH] (168010..16...    40   0.004
Scas_607.8                                                             40   0.004
Scas_721.115*                                                          40   0.005
Scas_592.4*                                                            40   0.005
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    40   0.005
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    40   0.005
Kwal_26.8953                                                           40   0.005
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    40   0.005
Scas_692.25                                                            40   0.005
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    40   0.005
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    39   0.006
AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372) [...    40   0.006
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      39   0.007
Sklu_2139.2 YFR021W, Contig c2139 1540-3165 reverse complement         39   0.007
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    39   0.008
CAGL0J08998g 882655..886500 highly similar to sp|P38968 Saccharo...    39   0.008
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    39   0.009
Scas_670.21                                                            39   0.009
Scas_659.9                                                             39   0.009
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         39   0.009
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    39   0.010
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    39   0.012
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          39   0.013
AGR367C [4678] [Homologous to ScYDR324C - SH] (1408366..1410681)...    39   0.014
YBL106C (SRO77) [97] chr2 complement(10847..13879) Protein that ...    39   0.015
Scas_721.29                                                            38   0.015
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    38   0.018
Kwal_23.4118                                                           38   0.020
Scas_719.52                                                            38   0.020
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    38   0.021
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    38   0.021
Scas_717.68                                                            38   0.021
AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH] (425925..42...    38   0.022
Kwal_26.7655                                                           38   0.024
Kwal_26.8628                                                           37   0.027
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         38   0.028
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    38   0.028
KLLA0B07667g 667863..673862 weakly similar to sp|P25356 Saccharo...    38   0.030
Sklu_2167.5 YGL213C, Contig c2167 8275-9186                            37   0.034
Scas_700.27*                                                           37   0.036
Kwal_26.8975                                                           37   0.037
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    37   0.038
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    37   0.039
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             37   0.044
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    37   0.044
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    37   0.046
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    37   0.047
Kwal_56.24478                                                          37   0.050
CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces cer...    37   0.051
Kwal_14.1235                                                           37   0.056
Kwal_56.24399                                                          36   0.057
Kwal_56.23685                                                          37   0.058
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    36   0.058
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    36   0.063
Scas_658.1                                                             36   0.067
Sklu_2113.2 YCL039W, Contig c2113 2538-4865                            36   0.080
Kwal_55.21450                                                          36   0.087
Scas_442.2*                                                            36   0.087
YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown func...    36   0.088
Scas_657.13                                                            35   0.096
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...    36   0.098
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...    36   0.099
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       35   0.10 
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    35   0.10 
Kwal_27.10785                                                          35   0.11 
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    35   0.11 
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    35   0.11 
Scas_721.128                                                           35   0.11 
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    35   0.11 
Kwal_47.17567                                                          35   0.11 
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    35   0.11 
Scas_712.34                                                            35   0.13 
Scas_510.5                                                             35   0.14 
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            35   0.14 
KLLA0D12760g complement(1090428..1091909) weakly similar to sgd|...    35   0.15 
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    35   0.18 
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    35   0.19 
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    35   0.21 
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    35   0.22 
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    35   0.23 
CAGL0M01430g 164428..166683 highly similar to tr|Q06679 Saccharo...    35   0.23 
Kwal_55.21559                                                          34   0.23 
Scas_615.11                                                            34   0.24 
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    35   0.25 
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    34   0.25 
AER439W [2939] [Homologous to ScYGL213C (SKI8) - SH] complement(...    34   0.25 
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    34   0.25 
AAL119W [68] [Homologous to ScYFR021W (AUT10) - SH] complement(1...    34   0.26 
Scas_649.10                                                            34   0.33 
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    34   0.34 
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         34   0.35 
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    34   0.35 
Kwal_55.22076                                                          34   0.37 
KLLA0D13222g complement(1132067..1134277) similar to sgd|S000273...    34   0.37 
YER149C (PEA2) [1578] chr5 complement(466203..467465) Protein in...    33   0.37 
Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement         34   0.37 
YFR021W (ATG18) [1701] chr6 (194800..196302) Protein that plays ...    34   0.38 
Scas_660.8                                                             34   0.38 
Scas_558.3                                                             34   0.38 
Kwal_0.356                                                             33   0.40 
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    34   0.43 
CAGL0I07073g complement(681102..682283) similar to sp|Q02793 Sac...    33   0.44 
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    33   0.45 
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    33   0.47 
ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH] complement(3...    33   0.47 
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    33   0.48 
Kwal_14.1611                                                           33   0.50 
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          33   0.53 
Kwal_14.1710                                                           33   0.54 
Kwal_47.17572                                                          33   0.55 
Kwal_55.21144                                                          33   0.59 
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    33   0.60 
Sklu_2364.5 YAR003W, Contig c2364 9220-10515 reverse complement        33   0.60 
KLLA0F17237g 1577197..1578768 similar to sp|Q04225 Saccharomyces...    33   0.63 
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...    33   0.63 
CAGL0K03861g complement(359448..360989) highly similar to sp|Q04...    33   0.63 
Scas_684.7                                                             33   0.64 
KLLA0A01650g complement(146030..147235) similar to sp|Q02793 Sac...    33   0.65 
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         33   0.65 
Scas_571.4                                                             33   0.65 
YPL100W (ATG21) [5343] chr16 (361867..363357) Protein required f...    33   0.72 
Kwal_47.19083                                                          32   0.84 
YDR030C (RAD28) [881] chr4 complement(501749..503269) Protein in...    33   0.85 
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    33   0.86 
Kwal_14.906                                                            32   0.95 
Scas_605.18                                                            32   0.99 
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    32   1.0  
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    32   1.0  
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         32   1.1  
Scas_670.22                                                            32   1.1  
ABR189W [782] [Homologous to ScYPL100W - SH] complement(764140.....    32   1.1  
ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH] (1126443..1...    32   1.1  
ACR085C [1132] [Homologous to NOHBY] (508364..511228) [2865 bp, ...    32   1.2  
YMR131C (RRB1) [4088] chr13 complement(533162..534697) Protein i...    32   1.3  
Sklu_1710.1 YDR267C, Contig c1710 17-739                               32   1.3  
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         32   1.3  
Scas_693.36                                                            32   1.4  
Kwal_47.17827                                                          32   1.4  
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    32   1.4  
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    32   1.4  
Scas_715.35                                                            32   1.5  
AFR153W [3345] [Homologous to ScYLR055C (SPT8) - SH] complement(...    32   1.5  
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    32   1.5  
Sklu_2092.4 YMR131C, Contig c2092 3964-5526                            32   1.5  
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    32   1.6  
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    32   1.6  
KLLA0F02013g 183770..185470 similar to sp|P40362 Saccharomyces c...    32   1.6  
Scas_660.7*                                                            32   1.7  
Kwal_56.24163                                                          32   1.7  
KLLA0C09262g 805512..807188 similar to sp|P40055 Saccharomyces c...    32   1.7  
CAGL0F02541g 248281..250173 similar to sp|Q04177 Saccharomyces c...    32   1.7  
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    32   1.8  
Scas_652.16                                                            31   1.9  
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    31   1.9  
Scas_512.3                                                             32   2.0  
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    31   2.1  
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    31   2.1  
Scas_711.46                                                            31   2.2  
Kwal_56.23895                                                          31   2.2  
Scas_469.3                                                             31   2.2  
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    31   2.3  
KLLA0F08811g complement(819834..821744) some similarities with s...    31   2.4  
YER124C (DSE1) [1554] chr5 complement(407338..409059) Protein in...    31   2.5  
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    31   2.5  
AFR715C [3908] [Homologous to ScYCL039W - SH] (1752847..1754997)...    31   2.6  
Kwal_0.49                                                              31   2.7  
YDR324C (UTP4) [1154] chr4 complement(1114426..1116756) Protein ...    31   2.9  
YOR230W (WTM1) [5021] chr15 (770800..772113) Transcriptional mod...    31   3.3  
Kwal_33.14971                                                          31   3.3  
KLLA0F16038g complement(1487475..1490063) weakly similar to ca|C...    31   3.5  
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    31   3.7  
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    30   3.8  
Scas_542.5                                                             30   4.0  
YGL213C (SKI8) [1783] chr7 complement(90057..91250) Protein invo...    30   4.1  
YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible...    30   4.2  
KLLA0C08723g 762625..765501 gi|7578634|gb|AAF64114.1|AF216585_1 ...    30   4.3  
Scas_705.2                                                             30   4.6  
Scas_661.19                                                            30   4.6  
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    30   4.7  
Scas_646.14                                                            30   5.0  
CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...    30   5.0  
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            30   5.1  
CAGL0H02937g complement(269645..271477) similar to sp|P40362 Sac...    30   5.8  
Sklu_1731.4 YJL069C, Contig c1731 3709-5439 reverse complement         30   6.3  
Kwal_27.10385                                                          30   6.3  
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    30   6.3  
Kwal_56.24332                                                          30   6.4  
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    30   6.7  
AEL153W [2353] [Homologous to ScYJL069C - SH] complement(343247....    30   6.9  
CAGL0K05291g 515641..518787 similar to sp|Q12038 Saccharomyces c...    30   6.9  
CAGL0L08140g 892201..898470 similar to sp|P25356 Saccharomyces c...    30   7.2  
Scas_720.45                                                            30   7.5  
Kwal_56.23035                                                          30   7.6  
KLLA0C17226g complement(1506737..1507705) similar to sp|Q06703 S...    29   8.8  
Kwal_55.20233                                                          29   8.8  
Kwal_56.23207                                                          29   9.2  
Scas_640.17                                                            29   9.7  
Scas_642.1                                                             29   9.7  

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 1059 bits (2739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/527 (97%), Positives = 515/527 (97%)

Query: 1   MSITSEELNYLIWRYLQETGNELSALALQEETRVLEFEKNYKENIPVGTLVNLVQRGILY 60
           MSITSEELNYLIWRYLQETGNELSALALQEETRVLEFEKNYKENIPVGTLVNLVQRGILY
Sbjct: 1   MSITSEELNYLIWRYLQETGNELSALALQEETRVLEFEKNYKENIPVGTLVNLVQRGILY 60

Query: 61  TESELLVHPNGKVKPIDENHFSENFNLVQALQIDKEKYPALVSKGRFELEKLGREDSNEL 120
           TESELLVHPNGKVKPIDENHFSENFNLVQALQIDKEKYPALVSKGRFELEKLGREDSNEL
Sbjct: 61  TESELLVHPNGKVKPIDENHFSENFNLVQALQIDKEKYPALVSKGRFELEKLGREDSNEL 120

Query: 121 ESTESAGVSADHTENDVRMDQDHDEEEVFAKTLNEIFKLGKAVCLQWNPVSSNILAIGEH 180
           ESTESAGVSADHTENDVRMDQDHDEEEVFAKTLNEIFKLGKAVCLQWNPVSSNILAIGEH
Sbjct: 121 ESTESAGVSADHTENDVRMDQDHDEEEVFAKTLNEIFKLGKAVCLQWNPVSSNILAIGEH 180

Query: 181 DSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATG 240
           DSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATG
Sbjct: 181 DSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATG 240

Query: 241 VENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQH 300
           VENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQH
Sbjct: 241 VENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQH 300

Query: 301 FESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRG 360
           FESKA            QMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRG
Sbjct: 301 FESKANQINGNNNNNSNQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRG 360

Query: 361 TISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASM 420
           TISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASM
Sbjct: 361 TISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASM 420

Query: 421 DGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAAL 480
           DGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAAL
Sbjct: 421 DGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAAL 480

Query: 481 LKRYSKGKKHKNHVMSIPICGDFQSAHSDDSVFDLSWKEDRLAIAYS 527
           LKRYSKGKKHKNHVMSIPICGDFQSAHSDDSVFDLSWKEDRLAIAYS
Sbjct: 481 LKRYSKGKKHKNHVMSIPICGDFQSAHSDDSVFDLSWKEDRLAIAYS 527

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/534 (52%), Positives = 366/534 (68%), Gaps = 15/534 (2%)

Query: 1   MSITSEELNYLIWRYLQETGNELSALALQEETRVLEFEKNYKENIPVGTLVNLVQRGILY 60
           MSITSEELNYLIWRY QE G+E+SALALQ+ETRVLEF++ YKE+IP+GTLVNLVQRGILY
Sbjct: 1   MSITSEELNYLIWRYCQEMGHEVSALALQDETRVLEFDEKYKEHIPLGTLVNLVQRGILY 60

Query: 61  TESELLVHPNGKVKPIDENHFSENFNLVQALQIDKEKYPALVSKGRFELEKLGREDSNEL 120
           TESEL+V   G +  ++E+H SE+FNLVQALQIDKEK+P + S+GRF LE     +SN+ 
Sbjct: 61  TESELMVDSKGDISALNEHHLSEDFNLVQALQIDKEKFPEISSEGRFTLET--NSESNKA 118

Query: 121 ESTESAGVSADHTENDVRMDQDHDEEEVFAKTLNEIFKLGKAVCLQWNPVSSNILAIGEH 180
               ++ V  +  E+D       D+ + F K L EI KL   V   WNP+  +ILA GE 
Sbjct: 119 GEDGASTVERETQEDDTNSIDSSDDLDGFVKILKEIVKLDNIVSSTWNPLDESILAYGEK 178

Query: 181 DSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATG 240
           +S A+L  +  T  + +       I ELRHPFA SA++GK TNQ+TCL+W+HDG+SI TG
Sbjct: 179 NSVARLARIVETDQEGKKYWKLTIIAELRHPFALSASSGKTTNQVTCLAWSHDGNSIVTG 238

Query: 241 VENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQH 300
           VENGELRLWNK G L NV NFH++PI+++ WN   TH IS D +N+TILW+V SG V+QH
Sbjct: 239 VENGELRLWNKTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENVTILWNVISGTVMQH 298

Query: 301 FESK--AXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGH 358
           FE K                  GVD  WVD DKFVIPGP G + VY +++  P GKL+GH
Sbjct: 299 FELKETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQITEKTPTGKLIGH 358

Query: 359 RGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISA 418
            G IS LEFN   KLL SA+DD T+R+WHGGNGNS +CFYGH+Q+IVS  WV +D +IS 
Sbjct: 359 HGPISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKVISC 418

Query: 419 SMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLA 478
           SMDGSV+LW   +        L+A +IVDGVPIFAG IS D ++YA  FMDGQV V++L 
Sbjct: 419 SMDGSVRLWSLKQN------TLLALSIVDGVPIFAGRISQDGQKYAVAFMDGQVNVYDLK 472

Query: 479 ALLKRYSKGKKHKNHVMS---IPICGDFQSAHSDDSVFDLSWK--EDRLAIAYS 527
            L  +      +++ +++   IP+   +QS+  +D +FDLSW    +++++AYS
Sbjct: 473 KLNSKSRSLYGNRDGILNPLPIPLYASYQSSQDNDYIFDLSWNCAGNKISVAYS 526

>Scas_718.6*
          Length = 546

 Score =  508 bits (1309), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 267/554 (48%), Positives = 370/554 (66%), Gaps = 45/554 (8%)

Query: 1   MSITSEELNYLIWRYLQETGNELSALALQEETRVLEFEKNYKENIPVGTLVNLVQRGILY 60
           MS++SEELNYLIWRYLQE+G+EL+ LALQEE+RVLEF+  YK ++PVG+LVNL+Q+GILY
Sbjct: 1   MSLSSEELNYLIWRYLQESGHELTTLALQEESRVLEFDSQYKLHVPVGSLVNLIQKGILY 60

Query: 61  TESELLVHPNGKVKPIDENHFSENFNLVQALQIDKEKYPALVSKGRFEL---------EK 111
           TESELLV  NG +   +  +F+ENFNLV ALQID EKYP +  KGRF L         E+
Sbjct: 61  TESELLVKSNGDITKEEMENFNENFNLVNALQIDLEKYPEIAKKGRFALANDSESQYEER 120

Query: 112 L--GREDS---------NELESTESAGVSADHTENDVRMD-QDHDEEEVFAKTLNEIFKL 159
           L  G+++S         + +E   +  + AD  +  +  D +D  E   FAKTLNE+  L
Sbjct: 121 LAKGKKESEINTPIIPTSGIEEETNTKIKADIEDISIHNDTEDSAESSFFAKTLNEVQTL 180

Query: 160 -GKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATT 218
             K V   WN  +  +LA G+ DS AK+IE      +D+ K+I     ELRHPFA S+ T
Sbjct: 181 DNKVVTSSWNLQNERLLAYGQEDSMAKMIEY---NKEDK-KIISSL--ELRHPFALSSIT 234

Query: 219 GKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHF 278
           G+ TNQ+T LSW+ DG+ I T VENGELRLWNK+G+LQNVFNFH+SPI++I WN  + HF
Sbjct: 235 GRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHF 294

Query: 279 ISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPG 338
           IS D DNITILW+  +G++LQHFE +             +  GVD  WVD DK V+PG  
Sbjct: 295 ISLDLDNITILWNAINGIILQHFEPEQ------KLENNTESLGVDIEWVDKDKLVVPGVN 348

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAAD-DNTIRVWHGGNGNSIHCF 397
           G++LVY++ D++PIGKL+GH+GTIS +EFN  ++LL +++D D +IR+WHG   N  +CF
Sbjct: 349 GSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCF 408

Query: 398 YGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAIS 457
           YGH+Q+I+SL W+N+D++ISASMDGSV++W        +   L+   +VDG  I  G IS
Sbjct: 409 YGHSQSIISLSWINDDLVISASMDGSVRIWSV------VENCLVGMAMVDGNAIICGKIS 462

Query: 458 DDRERYAAGFMDGQVTVFNLAALLKRYSKGKKHKNHV--MSIPICGDFQSAHSDDSVFDL 515
            D+ ++A G M+GQ+ V+++   + R  K  K +  V  ++IP+ G +Q+   DD +FD+
Sbjct: 463 HDKNKFAIGSMNGQINVYDIKRFVSRLLKRDKKQELVVPITIPLYGSYQNEKIDDCIFDI 522

Query: 516 SWKE--DRLAIAYS 527
           SW +  D + +A S
Sbjct: 523 SWNKSNDLITVANS 536

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score =  501 bits (1290), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 256/531 (48%), Positives = 355/531 (66%), Gaps = 36/531 (6%)

Query: 1   MSITSEELNYLIWRYLQETGNELSALALQEETRVLEFEKNYKENIPVGTLVNLVQRGILY 60
           MS+TSEEL+YLIWRYLQETG+E++ALALQEE+RVLEF++ ++E+IP+G LVN VQRGILY
Sbjct: 1   MSLTSEELSYLIWRYLQETGHEVTALALQEESRVLEFDEKFREHIPLGCLVNFVQRGILY 60

Query: 61  TESELLVHPNGKVKPIDENHFSENFNLVQALQIDKEKYPALVSKGRFELEKLGREDSNEL 120
           TES+LLV  +G+V PID +H+SENFNLVQAL++DK KYP LV+KGRF LE       N+ 
Sbjct: 61  TESDLLVRYDGEVTPIDPSHYSENFNLVQALEVDKNKYPDLVAKGRFALE-------NDQ 113

Query: 121 ESTESAGVSADHTENDVRMDQDHDEEEVFAKTLNEIFKLGKAVCLQWNPVSSNILAIGEH 180
              E       HT+     + + +    F KTL  +     +   QWNP   +  A G  
Sbjct: 114 SWEEQ------HTDEPFEENLNGEVSPDFIKTLQAVHLFPSSTISQWNPKLFDFFAWGGR 167

Query: 181 DSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATT--GKITNQLTCLSWAHDGDSIA 238
           DSTAK+++ E  +     KL       L+HPFA S  +   K TN++TCLSW+  G+S+ 
Sbjct: 168 DSTAKVVKFECNSG----KLAVLDTITLQHPFALSIASENSKTTNEVTCLSWSPSGESLI 223

Query: 239 TGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVL 298
           TGVENGELR+W+  G LQNVFNFH+SP+++I WN+ +TH +++D DNITI+W+  +G  L
Sbjct: 224 TGVENGELRMWSFRGILQNVFNFHRSPVVSIEWNADSTHVLTSDVDNITIVWNALTGTAL 283

Query: 299 QHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGH 358
           QHF+ K             +  G+D  W++TDKFVIPG  G++LV+++ +S+PIGKLVGH
Sbjct: 284 QHFDLK--------DTTGNESLGIDVEWIETDKFVIPGLQGSILVFSIGESKPIGKLVGH 335

Query: 359 RGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISA 418
             T++ L +NS+ KLL SA+DD T+R W GGN NS +CFYGHTQ+I    W+++D LIS 
Sbjct: 336 TKTLTVLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYGHTQSITYADWLDDDRLIST 395

Query: 419 SMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLA 478
           SMDGSV++W   +        L+  ++VDGVPIF G +S D++++A G +DG+V+V+N+ 
Sbjct: 396 SMDGSVRVWSVKQNA------LVGLSVVDGVPIFCGTLSSDKQKFATGTLDGEVSVYNVK 449

Query: 479 ALLKRYSKGKKHKNHVMSIPICGDFQSAHSDDSVFDLSWKED--RLAIAYS 527
            LL+     +K    V  IP  GD+QS      V DLSW +D   +A++YS
Sbjct: 450 KLLEVLDADEKPIGPV-RIPTIGDYQSTKEGSYVSDLSWDKDGTNIAVSYS 499

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score =  457 bits (1177), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 240/533 (45%), Positives = 335/533 (62%), Gaps = 48/533 (9%)

Query: 1   MSITSEELNYLIWRYLQETGNELSALALQEETRVLEFEKNYKENIPVGTLVNLVQRGILY 60
           MSITSEELNYLIWRYLQE G+E+SALA+QEETRVLEF++ YKE+IP+GTLV LVQ+GILY
Sbjct: 1   MSITSEELNYLIWRYLQEAGHEVSALAMQEETRVLEFDEKYKEHIPLGTLVKLVQKGILY 60

Query: 61  TESELLVHPNGKVKPIDENHFSENFNLVQALQIDKEKYPALVSKGRFELEKLGREDSNEL 120
           TESE LV  N + +  D  H+ ++FNLVQAL++DK+++P LV++GRF L     E   E 
Sbjct: 61  TESEFLVQYNAQSEGADAEHYGKDFNLVQALEVDKQRFPELVAQGRFALAHEREEPEAEP 120

Query: 121 ESTESAGVSADHTENDVRMDQDHDEEEVFAKTLNEIFKLGKAVCLQWNPVSSNILAIGEH 180
           E T              R++ D    + F KTL  +         QWNP    + A GE 
Sbjct: 121 EVT--------------RLESD----DSFIKTLQCVQTFPPGYVSQWNPKHEGVFAYGER 162

Query: 181 DSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATG 240
           DS A ++   T +  D +  I +T+          A TG+  N++TCL WA  G S+ TG
Sbjct: 163 DSRAAVV---TYSVADGLWNISETV------VLADANTGQ-QNEVTCLEWAPAGQSLLTG 212

Query: 241 VENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQH 300
           VE+GELRLW+ EGKLQN+ ++H++PI+ I WNS  TH ++ DADN+TI+W+V SG  +QH
Sbjct: 213 VESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQH 272

Query: 301 FESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRG 360
           F  K             +  GVD  W+D DKF IPG  G++LV+ +  S+PIGKL GH  
Sbjct: 273 FSFK--------EAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSK 324

Query: 361 TISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASM 420
           T++ + +N   KLL SA+DDNT+RVW GGN N  H FYGH+Q+I S  WV++D +IS SM
Sbjct: 325 TLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSM 384

Query: 421 DGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAAL 480
           DGS+++W         + + +A   VDGVP F GA+S D+ ++A G +DG+V V+++  L
Sbjct: 385 DGSIRVWSLA------SNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKL 438

Query: 481 LKRYS----KGKKHKNHVMSIPICGDFQSAHSDDSVFDLSWKED--RLAIAYS 527
           L++ +     G      V  IP+ GD +SA   + V  +SW ++  +L+++YS
Sbjct: 439 LQQLNHNGYHGTARSAEVARIPVVGDHRSAREGNYVTQISWSQESTQLSVSYS 491

>Kwal_27.12586
          Length = 509

 Score =  431 bits (1109), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 230/519 (44%), Positives = 318/519 (61%), Gaps = 34/519 (6%)

Query: 1   MSITSEELNYLIWRYLQETGNELSALALQEETRVLEFEKNYKENIPVGTLVNLVQRGILY 60
           MSI+SEELNYLIWRYLQE+G E++ALALQEE+RVLEFE  + E+IP+GTLVN +Q+GILY
Sbjct: 1   MSISSEELNYLIWRYLQESGKEVAALALQEESRVLEFESKFGEHIPIGTLVNFMQKGILY 60

Query: 61  TESELLVHPNGKVKPIDENHFSENFNLVQALQIDKEKYPALVSKGRFELEKLGREDSNEL 120
            ESELLV  + +  P+D    +++FNLVQAL+IDKEK P L    RF L      D N +
Sbjct: 61  AESELLVRYDRESTPVDPKRNAQDFNLVQALEIDKEKVPELEGVQRFSL------DDNSV 114

Query: 121 ESTESAGVSADHTENDVRMDQDHDEEEVFAKTLNEIFKLGKAVCLQWNPVSSNILAIGEH 180
           +S      S ++  ND       D+   F KTL    +L ++   QWNP   NILA G  
Sbjct: 115 KS------STEYLNNDSSNSSSGDDSGKFIKTLCRSIQLPQSFVCQWNPKDKNILAWGGP 168

Query: 181 DSTAKLIELETTTTDDQIKLIEKTIHEL--RHPFATSATTGKITNQLTCLSWAHDGDSIA 238
           +ST+ ++  +       I+      HE+  +HP A +      +  +TCL W+  GDS  
Sbjct: 169 NSTSTVVTFQDVDGTFSIQ------HEVTCQHPTAINVADASSSCDVTCLEWSPKGDSFL 222

Query: 239 TGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVL 298
           TGVE+GE+RLW  + KLQN F+FHKS I+ I WNS  THF++ D DN+ I+W+  +G  L
Sbjct: 223 TGVESGEIRLWTHDAKLQNAFDFHKSSIVTIKWNSDATHFLTYDVDNVAIVWNAQTGTAL 282

Query: 299 QHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGH 358
           Q F  +                GVD  W+  DKFVIPGP G++ +  M +SRP+GKL GH
Sbjct: 283 QQFSFRENGTVDS--------LGVDASWIGPDKFVIPGPQGSIYICGMGESRPLGKLNGH 334

Query: 359 RGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISA 418
             TI+  +FNSE  +L S +DD T+RVW  G+ +S +CF G+T  I S  W+++D +I+ 
Sbjct: 335 SATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAFWIDDDKVIAT 394

Query: 419 SMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLA 478
           S+DGSV+LW        +T  L A ++VDGVPIF G++S D+ ++A G MDG+VTV+N+ 
Sbjct: 395 SLDGSVRLW------SHLTNTLQAISMVDGVPIFCGSLSPDKLKFAIGKMDGEVTVYNIE 448

Query: 479 ALLKRYSKGKKHKNHVMSIPICGDFQSAHSDDSVFDLSW 517
            LL          N  +SIPI GD+QS    + V +++W
Sbjct: 449 KLLATLKSIADVGNSPISIPIYGDYQSNIEGNYVNNIAW 487

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score =  422 bits (1085), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 221/529 (41%), Positives = 317/529 (59%), Gaps = 30/529 (5%)

Query: 1   MSITSEELNYLIWRYLQETGNELSALALQEETRVLEFEKNYKENIPVGTLVNLVQRGILY 60
           MSI SEELNYLIWRYLQE G+E+SALALQEETRVLEFE+ +KE+IP+G LV LVQ+GILY
Sbjct: 1   MSIASEELNYLIWRYLQEAGHEVSALALQEETRVLEFEERFKEHIPLGCLVQLVQKGILY 60

Query: 61  TESELLVHPNGKVKPIDENHFSENFNLVQALQIDKEKYPALVSKGRFELEKLGREDSNEL 120
           TESE LV PNG++ P+D+  +  NF LVQAL++DK+K+P + ++GRF LE     +  E 
Sbjct: 61  TESEFLVPPNGEMVPVDQELYKRNFTLVQALEVDKQKFPEIAARGRFALENDVEAEMLEK 120

Query: 121 ESTESAGVSADHTENDVRMDQDHDEEEVFAKTLNEIFKLGKAVCLQWNPVSSNILAIGEH 180
           +  E A   A  + +  +          F KTL++   L ++   QWNP    +L  G  
Sbjct: 121 KEQEQAAAMAADSPSGTQSASSR-----FIKTLSDHLTLSQSFTSQWNPKYGILLVWGGA 175

Query: 181 DSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATG 240
            S A++  ++  T        +K    ++ P             +  +SW+ DG+ + TG
Sbjct: 176 QSQARIGSIDIVT--------DKESWSIKDPIDLVYPKRSEEEPIISVSWSPDGELVLTG 227

Query: 241 VENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQH 300
             +GELRLWNK+GKL+N+ + H+SPI+A+ WN   TH ++TD  N+ ILW   +G  LQH
Sbjct: 228 TTSGELRLWNKQGKLKNILDSHRSPIVAMKWNQDCTHLLTTDVSNVVILWSTLTGTQLQH 287

Query: 301 FESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRG 360
           F  K                G+D  WV+TDKFVIPGPGG+LLVYT+ +++P+G+L+GH  
Sbjct: 288 FSFKEGDIENEDS------LGIDLEWVETDKFVIPGPGGSLLVYTIGNNKPLGRLLGHTS 341

Query: 361 TISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASM 420
           TI+ LEFN   K L SA+DDNTI+VW GGN ++ + F  HT+TI S  W+N+D++IS + 
Sbjct: 342 TITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDHTKTISSAHWINDDLIISTAY 401

Query: 421 DGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAAL 480
           DG+VK+W   K       +++AE  +D  PIF  ++S DR     G + G   VF++   
Sbjct: 402 DGTVKVWSISKN------SIVAEASLDSEPIFEASLSPDRNWLTVGTLQGSAIVFDVKTF 455

Query: 481 LKRYSKGKKHKNHVMSIPIC--GDFQSAHSDDSVFDLSWKEDRLAIAYS 527
           L+ Y +    +    S+PI   G++Q       V +++W  +  A A S
Sbjct: 456 LESYDQNSVQQQ---SVPISTYGEYQIDQDGLQVTNIAWNNESTAFAVS 501

>Scas_720.95
          Length = 515

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 95/210 (45%), Gaps = 18/210 (8%)

Query: 222 TNQLTCLSWAHDGDSIATGVENGELRLW--NKEGKLQNVFNFHKSPIIAIHWNSSNTHFI 279
           TN ++C+ W+  G  I +G  +  +R+W  N +GK  N+   H       HW   N   +
Sbjct: 278 TNSVSCIKWSGQG-IIYSGSHDKTVRVWDMNADGKCINILKSHA------HW--VNHLSL 328

Query: 280 STDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGG 339
           STD       +D          +++                  + +   +D F +     
Sbjct: 329 STDYALRVGAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTM----- 383

Query: 340 NLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYG 399
             L   +  ++PI ++ GH+  ++ + F+ + + + SA+ DN+I++W G +G  I  F G
Sbjct: 384 -FLWNPLKSNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRG 442

Query: 400 HTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
           H  ++  + W  +  +L+S S D ++K+WD
Sbjct: 443 HVASVYQVAWSADCRLLVSCSKDTTLKVWD 472

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 8/96 (8%)

Query: 341 LLVYTMSDSRPIG-KLVGHRGTISQLEFNS-------ETKLLASAADDNTIRVWHGGNGN 392
           + ++   D +P+G  L GH   I+ L +         E+  LASA+ D TIR+W      
Sbjct: 210 IRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRV 269

Query: 393 SIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
            ++   GHT ++  +KW    ++ S S D +V++WD
Sbjct: 270 CLYTMSGHTNSVSCIKWSGQGIIYSGSHDKTVRVWD 305

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 55/116 (47%), Gaps = 10/116 (8%)

Query: 328 DTDKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
           +T   ++ G G N   ++      P   L GH   +  + +    +++A+ + DNTIR+W
Sbjct: 154 NTSSRMVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLW 213

Query: 387 HGGNGNSI-HCFYGHTQTIVSLKWV--------NNDMLISASMDGSVKLWDCGKKL 433
              +G  +     GH + I SL W          +  L SAS DG++++WD  +++
Sbjct: 214 DSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRV 269

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 60/274 (21%), Positives = 104/274 (37%), Gaps = 94/274 (34%)

Query: 163 VCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKIT 222
           +C  + P +S+ +  G  D+TA++ + +T T                 P AT   TG   
Sbjct: 147 LCSAFAPNTSSRMVTGAGDNTARIWDCDTQT-----------------PKAT--LTGHF- 186

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLWN-KEGK-LQNVFNFHKSPIIAIHWNS------- 273
           N + C+S+  +G+ IATG  +  +RLW+ K+GK L +    H   I ++ W         
Sbjct: 187 NWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPG 246

Query: 274 SNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFV 333
            +    S   D    +WD+   V L                                   
Sbjct: 247 ESPRLASASKDGTIRIWDITRRVCL----------------------------------- 271

Query: 334 IPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH-GGNGN 392
                     YTMS         GH  ++S ++++ +  ++ S + D T+RVW    +G 
Sbjct: 272 ----------YTMS---------GHTNSVSCIKWSGQ-GIIYSGSHDKTVRVWDMNADGK 311

Query: 393 SIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKL 426
            I+    H        WVN+   +S S D ++++
Sbjct: 312 CINILKSHAH------WVNH---LSLSTDYALRV 336

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 51/112 (45%), Gaps = 5/112 (4%)

Query: 184 AKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVEN 243
            KL EL  T +DD    +   +   + P A      K+ N +   +++ DG  I +   +
Sbjct: 368 GKLEELMVTASDDFTMFLWNPLKSNK-PIARMTGHQKLVNHV---AFSPDGRYIVSASFD 423

Query: 244 GELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNS 294
             ++LW+ ++GK  + F  H + +  + W++     +S   D    +WDV +
Sbjct: 424 NSIKLWDGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRT 475

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 70/141 (49%), Gaps = 13/141 (9%)

Query: 289 LWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSD 348
           LWD   GV+L  FE                + GVD        FV  G   ++ V+++S 
Sbjct: 37  LWDYRMGVLLHRFEEH-----------EGPVRGVD-FHPTQPLFVSAGDDYSIKVWSLST 84

Query: 349 SRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLK 408
            + +  L GH   +  + F++E   + SA+DD TIR+W+  N   I C  GH   ++  +
Sbjct: 85  HKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQ 144

Query: 409 W-VNNDMLISASMDGSVKLWD 428
           +    D+++SAS+D +V++WD
Sbjct: 145 FHPTEDLVVSASLDETVRIWD 165

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 37/200 (18%), Positives = 83/200 (41%), Gaps = 28/200 (14%)

Query: 237 IATGVENGELRLWNKEGKLQ-NVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295
           I +  ++  +R+WN + + +      H   ++   ++ +    +S   D    +WD+ SG
Sbjct: 110 IISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASLDETVRIWDI-SG 168

Query: 296 VVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKL 355
           +  +H                 Q F    +   T + +  G  G+ +V  +        L
Sbjct: 169 LRKRH------------SAPGSQSFEEQMI---TQQNLFDGGFGDCVVKFI--------L 205

Query: 356 VGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNS--IHCFYGHTQTIVSLKW-VNN 412
            GH   ++   F+    L+ S +DD  +++W   +  +  +    GHT  + S+ +    
Sbjct: 206 EGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPFQ 265

Query: 413 DMLISASMDGSVKLWDCGKK 432
           +++IS   D ++++WD  K+
Sbjct: 266 NLIISVGEDSTIRVWDLDKR 285

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 34/83 (40%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLI 416
           GH   +  + F+    L+ S  +D+TIRVW       +  F        S++   N  L 
Sbjct: 251 GHTNNVDSVIFHPFQNLIISVGEDSTIRVWDLDKRTPVKQFKREQDRFWSIRAHPNVNLF 310

Query: 417 SASMDGSVKLWDCGKKLQEITGN 439
            A+ D  + ++   ++   +  N
Sbjct: 311 GAAHDSGIMVFKLDRERPPVAVN 333

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 108/239 (45%), Gaps = 35/239 (14%)

Query: 278 FISTDADNITILWDVNSGVVL---QHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVI 334
            +S   D+    W+  +GV L   QH +S+                 V+ + +  DK ++
Sbjct: 5   LVSAGYDHTIRFWEALTGVCLRTIQHPDSQ-----------------VNRLEITNDKKLL 47

Query: 335 PGPG-GNLLVYTM--SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNG 391
              G  N+ +Y +  S+S P+    GHRG ++ + F  + K + ++++D TI+VW     
Sbjct: 48  AAAGHQNIRLYDIKTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVW-DIRS 106

Query: 392 NSIHCFYGHTQTIVSLK-WVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVP 450
            S+   Y H   +  +    N   LIS   DG++++WD G+   + T  L  E   D VP
Sbjct: 107 PSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGE--NQCTHQLTPE---DDVP 161

Query: 451 IFAGAISDDRERYAAGFMDGQVTVFNL-----AALLKRYSKGKKHKNHVMSIPICGDFQ 504
           + + +++ D     A    G   V+ +     A+ LK  +K K H +++  + +  D +
Sbjct: 162 LQSLSVASDGSMLVAANNKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVK 220

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 90/218 (41%), Gaps = 23/218 (10%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPI--IAIHWNSSNTHFISTD 282
           +T +S+  D   + T  E+G +++W+           H +P+  + IH N      IS D
Sbjct: 78  VTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIHPNQGE--LISCD 135

Query: 283 ADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLL 342
            D    +WD+         E++             Q   V +   D    V     GN  
Sbjct: 136 RDGNIRIWDLG--------ENQCTHQLTPEDDVPLQSLSVAS---DGSMLVAANNKGNCY 184

Query: 343 VYTM------SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH-GGNGNSIH 395
           V+ M      S+ +P  K   H   I+++  +S+ K +A+ + D+T R+W    N N   
Sbjct: 185 VWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDNFNLES 244

Query: 396 CFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWDCGKK 432
              GH + +    +  ++  L++AS D  V+LWD   +
Sbjct: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/299 (21%), Positives = 126/299 (42%), Gaps = 49/299 (16%)

Query: 163 VCLQWNPVSSNILAIGEHDSTAKLIELET-TTTDDQIKLIEKTIHEL------------R 209
           +C+ W+P    ++A G  D+T +L + ++     D ++   K I  L            +
Sbjct: 190 LCVSWSP-DGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSK 248

Query: 210 HPFATSATTGKI-----------------TNQLTCLSWAHDGDSIATGVENGELRLW--N 250
              A+S+  G I                 TN ++C+ W   G  + +G  +  +R+W  N
Sbjct: 249 PRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQG-LLYSGSHDRTVRVWDIN 307

Query: 251 KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXX 310
            +G+  N+   H       HW   N   +STD       +D          E++      
Sbjct: 308 SQGRCINILKSHA------HW--VNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALEN 359

Query: 311 XXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSE 370
                       + +   +D + +       L   +  ++PI ++ GH+  ++ + F+ +
Sbjct: 360 YEKICKKNGNSEEMMVTASDDYTM------FLWNPLKSTKPIARMTGHQKLVNHVAFSPD 413

Query: 371 TKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN-DMLISASMDGSVKLWD 428
            + + SA+ DN+I++W G +G  I  F GH  ++  + W ++  +L+S S D ++K+WD
Sbjct: 414 GRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 472

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 59/119 (49%), Gaps = 10/119 (8%)

Query: 329 TDKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
           T   ++ G G N   ++      P+  L GH   +  + ++ + +++A+ + DNTIR+W 
Sbjct: 155 TSSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWD 214

Query: 388 GGNGNSI-HCFYGHTQTIVSLKWV--------NNDMLISASMDGSVKLWDCGKKLQEIT 437
             +G  +     GH++ I SL W         +   L S+S DG++K+WD   ++ + T
Sbjct: 215 PKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYT 273

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 102/274 (37%), Gaps = 94/274 (34%)

Query: 163 VCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKIT 222
           +C  + P +S+ +  G  D+TA++ + +T T           +H L+  +          
Sbjct: 147 LCSAFAPHTSSRMVTGAGDNTARIWDCDTQTP----------MHTLKGHY---------- 186

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLWN-KEGK-LQNVFNFHKSPIIAIHWNS------- 273
           N + C+SW+ DG+ IATG  +  +RLW+ K G+ L +    H   I ++ W         
Sbjct: 187 NWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPG 246

Query: 274 SNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFV 333
           S     S+  D    +WD  S V                                     
Sbjct: 247 SKPRLASSSKDGTIKIWDTVSRVCQ----------------------------------- 271

Query: 334 IPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH-GGNGN 392
                     YTMS         GH  ++S +++  +  LL S + D T+RVW     G 
Sbjct: 272 ----------YTMS---------GHTNSVSCVKWGGQ-GLLYSGSHDRTVRVWDINSQGR 311

Query: 393 SIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKL 426
            I+    H        WVN+   +S S D ++++
Sbjct: 312 CINILKSHAH------WVNH---LSLSTDYALRI 336

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 49/108 (45%), Gaps = 5/108 (4%)

Query: 188 ELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELR 247
           E+  T +DD    +   +   + P A      K+ N +   +++ DG  I +   +  ++
Sbjct: 372 EMMVTASDDYTMFLWNPLKSTK-PIARMTGHQKLVNHV---AFSPDGRYIVSASFDNSIK 427

Query: 248 LWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNS 294
           LW+ ++GK  + F  H + +  + W+S     +S   D    +WDV +
Sbjct: 428 LWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRT 475

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 100/223 (44%), Gaps = 34/223 (15%)

Query: 217 TTGKITNQLTCLSWAHDGDSIATGVENGELRLWN--KEGKLQNVFNFHKSPIIAIHW--- 271
           T G  TN ++C+ W  +G  + +G  +  +R W+  + GK  N+   H       HW   
Sbjct: 275 TLGGHTNSVSCVKWGGEG-ILYSGSHDKTVRAWDMKQNGKCINILKSHA------HWVNH 327

Query: 272 -NSSNTHFISTDADNITILWDVNSG----VVLQHFESKAXXXXXXXXXXXXQMFGVDTVW 326
            + S  + +   A + T +   N+       LQ++E  A                     
Sbjct: 328 LSLSTDYALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMVTA-------- 379

Query: 327 VDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
             +D F +       L   +  ++PI ++ GH+  ++ + F+ + K + SA+ DN+I++W
Sbjct: 380 --SDDFTM------FLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLW 431

Query: 387 HGGNGNSIHCFYGHTQTIVSLKWVNN-DMLISASMDGSVKLWD 428
            G  G  +  F GH  ++  + W ++  +L+S S D ++K+WD
Sbjct: 432 DGKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 474

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 61/119 (51%), Gaps = 10/119 (8%)

Query: 329 TDKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
           T   V+ G G N   ++      P   L GHR  +  + ++++ +++A+ + DNTIR+W 
Sbjct: 157 TSSRVVTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWD 216

Query: 388 GGNGNSI-HCFYGHTQTIVSLKWV--------NNDMLISASMDGSVKLWDCGKKLQEIT 437
             +G  +     GH++ I SL W         +   L SAS DG++++WD  +++  +T
Sbjct: 217 AESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMT 275

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 8/96 (8%)

Query: 341 LLVYTMSDSRPIG-KLVGHRGTISQLEFN-------SETKLLASAADDNTIRVWHGGNGN 392
           + ++     +P+G  L GH   I+ L +             LASA+ D TIR+W      
Sbjct: 212 IRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRV 271

Query: 393 SIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
            +    GHT ++  +KW    +L S S D +V+ WD
Sbjct: 272 CLMTLGGHTNSVSCVKWGGEGILYSGSHDKTVRAWD 307

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 63/145 (43%), Gaps = 29/145 (20%)

Query: 163 VCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKIT 222
           +C  + P +S+ +  G  D+TA++ + +T T        + T++  R             
Sbjct: 149 LCSAFAPHTSSRVVTGGGDNTARIWDCDTQTP-------KVTLNGHR------------- 188

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLWNKE-GK-LQNVFNFHKSPIIAIHWN-------S 273
           N + C+SW+ DG+ IATG  +  +RLW+ E GK L +    H   I ++ W         
Sbjct: 189 NWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPG 248

Query: 274 SNTHFISTDADNITILWDVNSGVVL 298
           S     S   D    +WD +  V L
Sbjct: 249 SKPRLASASKDGTIRIWDSSRRVCL 273

 Score = 36.6 bits (83), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 48/108 (44%), Gaps = 5/108 (4%)

Query: 188 ELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELR 247
           EL  T +DD    +   +   + P +      K+ N +   +++ DG  I +   +  ++
Sbjct: 374 ELMVTASDDFTMFLWNPLKGTK-PISRMTGHQKLVNHV---AFSPDGKYIVSASFDNSIK 429

Query: 248 LWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNS 294
           LW+ KEG   + F  H + +  + W+S     +S   D    +WDV +
Sbjct: 430 LWDGKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKT 477

>Scas_585.8
          Length = 460

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 126/305 (41%), Gaps = 28/305 (9%)

Query: 182 STAKLIELETTTTDDQIKLIEKTIHE------LRHPFATSATTGKITNQLTCLSWAHDGD 235
           ST  +IE ET+ + D +       H       L   F T  ++ K+ + +  ++W  +G 
Sbjct: 45  STTPVIEPETSYSADILPPDTYKGHSNHRIINLACKF-THLSSNKVKHVIPAITWTPEGR 103

Query: 236 SIATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295
            +     NGE  LWN     +++   H S +  I ++ +     S DAD    +W  N  
Sbjct: 104 RLVVATYNGEFSLWNGTSFNESLMQAHDSAVSCIQYSHAGDWMCSGDADGGIKIWQPNFN 163

Query: 296 VVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTD-KFVIPGPGGNLLVYTMSDSRPIGK 354
           +V + FE+                   D  + + D KFV       L ++  S+ +    
Sbjct: 164 MV-KEFENAHTECIR------------DISFSNNDSKFVTCSDDNVLKIWNFSNGQVERT 210

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCF--YGHTQTIVSLKWVNN 412
           L GH   I   +++ E  L+ SA+ DN +++W   +G  I     + HT      +    
Sbjct: 211 LSGHHWDIKSCDWHPEMGLIVSASKDNLVKLWDPRSGQCISTIIKFKHTVLKTRFQPTRG 270

Query: 413 DMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQV 472
           ++L + S D S +++D    ++E+   +     VD + +    I++    +  G  DG +
Sbjct: 271 NLLAAISKDKSCRVFDIRHSMKEL---MCVRDEVDYMTLTWNPINE--SMFTVGNYDGAM 325

Query: 473 TVFNL 477
             F+L
Sbjct: 326 KYFDL 330

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 99/231 (42%), Gaps = 25/231 (10%)

Query: 214 TSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEG-KLQNVFNFHKSPIIAIHWN 272
           T  ++ K+ + +  + W  +G  +     +GE  LWN      + +   H S +  + ++
Sbjct: 85  THLSSNKVKHVIPAIQWTPEGRRLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYS 144

Query: 273 SSNTHFISTDADNITILWDVNSGVVLQ----HFESKAXXXXXXXXXXXXQMFGVDTVWVD 328
             +   IS DAD +  +W  N  +V +    H ES                   D  +  
Sbjct: 145 HDSDWMISGDADGMIKIWQPNFSMVKEIDAAHTESIR-----------------DMAFSS 187

Query: 329 TD-KFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
            D KFV       L ++  S+ +    L GH   +   +++ E  L+ASA+ DN +++W 
Sbjct: 188 NDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSCDWHPEMGLIASASKDNLVKLWD 247

Query: 388 GGNGNSIHCFYGHTQTIVSLKW--VNNDMLISASMDGSVKLWDCGKKLQEI 436
             +GN I        T++  ++     ++L++ S D S +++D    ++E+
Sbjct: 248 PRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKEL 298

>Kwal_55.22067
          Length = 451

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 93/226 (41%), Gaps = 15/226 (6%)

Query: 214 TSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEG-KLQNVFNFHKSPIIAIHWN 272
           T  ++ K+ + +  L W  +G  +     +GE  LWN      +++   H S +  + ++
Sbjct: 75  THLSSNKVKHVIPALEWTPEGRRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVAVMKYS 134

Query: 273 SSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKF 332
            +    IS D+D    +W  N  +V      K                G D+      KF
Sbjct: 135 HAGDWLISGDSDGTIKIWQPNFNMV------KVLDEAHTQCIRGISFSGTDS------KF 182

Query: 333 VIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGN 392
           V       L ++  S+ +    L GH   +   +++    L+AS + DN +++W    G 
Sbjct: 183 VTCSDDNILKIWNFSNGQQESTLSGHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRAGQ 242

Query: 393 SIHCFYGHTQTIVSLKW--VNNDMLISASMDGSVKLWDCGKKLQEI 436
            I    G   TI+S K+     +ML   S D S +++D  + ++E+
Sbjct: 243 CISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIRQNMKEL 288

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 66/141 (46%), Gaps = 13/141 (9%)

Query: 289 LWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSD 348
           LWD   G +L  FE                +F            V  G   ++ V+++  
Sbjct: 37  LWDYRMGTLLHRFEGHEGPVRAVDFHPTQPIF------------VSAGDDASIKVWSLET 84

Query: 349 SRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLK 408
           +R +  L GH   +  + F+SE   + SA+DD T+R+W+  N   + C  GH   ++  +
Sbjct: 85  NRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQ 144

Query: 409 W-VNNDMLISASMDGSVKLWD 428
           +    D+++SAS+D +V++WD
Sbjct: 145 FHQTEDLVVSASLDETVRVWD 165

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 71/178 (39%), Gaps = 27/178 (15%)

Query: 340 NLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNS--IHCF 397
           NLL     D +    L GH   ++   F+    L+ +  DD  +++W   +  +  +   
Sbjct: 190 NLLDGAFGDCKVKFILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTC 249

Query: 398 YGHTQTIVSLKW-VNNDMLISASMDGSVKLWDCGKKL----------------QEITGNL 440
            GHT  +  + +  + ++++S + D ++++WD  K+                      +L
Sbjct: 250 RGHTNNVDCVVFHPDQNLILSVAEDKTLRIWDLDKRTPVKQFKRENDRFWLIRSHPNMSL 309

Query: 441 IAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAALLKRYSKGKKHKNHVMSIP 498
                  G+ IF      DRER AA     Q+   N    L+ +  GKK    V S+P
Sbjct: 310 FGAAHDSGIMIFKL----DRERPAATTYQNQLFFVNKEKQLQSFDYGKK----VTSLP 359

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 381 NTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLW--DCGKKLQEIT 437
           +TI++W    G  +H F GH   + ++ +     + +SA  D S+K+W  +  + L  +T
Sbjct: 33  STIQLWDYRMGTLLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNRCLYTLT 92

Query: 438 GNL 440
           G+L
Sbjct: 93  GHL 95

>Kwal_23.6324
          Length = 514

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 53/85 (62%), Gaps = 1/85 (1%)

Query: 349 SRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLK 408
           S+PI ++ GH+  ++ + F+ + + + SA+ DN+I++W G NG  I  F GH  ++  + 
Sbjct: 391 SKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVA 450

Query: 409 WVNN-DMLISASMDGSVKLWDCGKK 432
           W ++  +L+S S D ++K+WD   K
Sbjct: 451 WSSDCRLLVSCSKDTTLKVWDVRTK 475

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 59/119 (49%), Gaps = 10/119 (8%)

Query: 329 TDKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
           T   ++ G G N   ++  + + P+  L GH   +  + +  + +L+A+ + DNTIR+W 
Sbjct: 154 TSGRMVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWD 213

Query: 388 GGNGNSI-HCFYGHTQTIVSLKWV--------NNDMLISASMDGSVKLWDCGKKLQEIT 437
              G S      GH + I SL W         +   L SAS DG++K+WD  +++  +T
Sbjct: 214 SNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLT 272

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 7/81 (8%)

Query: 355 LVGHRGTISQLEFNS-------ETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSL 407
           L GH   I+ L +         +   LASA+ D TI++W       +    GHT ++  +
Sbjct: 224 LRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCV 283

Query: 408 KWVNNDMLISASMDGSVKLWD 428
           KW    +L S S D +++ WD
Sbjct: 284 KWGGRGILYSGSHDKTIRAWD 304

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 54/145 (37%), Gaps = 29/145 (20%)

Query: 163 VCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKIT 222
           +C  + P +S  +  G  D+TA++ +  T T           ++ L+  F          
Sbjct: 146 LCSAFAPHTSGRMVTGSGDNTARIWDCNTNTP----------MYTLKGHF---------- 185

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLW--NKEGKLQNVFNFHKSPIIAIHWNS------- 273
           N + C++W  DG+ IATG  +  +RLW  NK          H   I ++ W         
Sbjct: 186 NWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAG 245

Query: 274 SNTHFISTDADNITILWDVNSGVVL 298
                 S   D    +WD    V +
Sbjct: 246 DQPRLASASKDGTIKIWDTTRRVCV 270

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 42/224 (18%), Positives = 77/224 (34%), Gaps = 63/224 (28%)

Query: 168 NPVSSNILAIGEHDSTAK----LIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITN 223
           +P  +   A+  ++  AK    L EL  T +DD    +   +   + P        K+ N
Sbjct: 347 SPEEARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASK-PITRMTGHQKLVN 405

Query: 224 QLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTD 282
            +   +++ DG  I +   +  ++LW+ + G     F  H + +  + W+S     +S  
Sbjct: 406 HV---AFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSSDCRLLVSCS 462

Query: 283 ADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLL 342
            D    +WDV                                    T K  +  PG N  
Sbjct: 463 KDTTLKVWDVR-----------------------------------TKKLSVDLPGHNDE 487

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
           VYT                   ++++ + K + SA  D  +R+W
Sbjct: 488 VYT-------------------VDWSVDGKRVCSAGKDKMVRIW 512

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/306 (20%), Positives = 126/306 (41%), Gaps = 25/306 (8%)

Query: 179 EHDSTAKLIELETTTTDDQIKLIEKTIHE--LRHPFA-TSATTGKITNQLTCLSWAHDGD 235
           +H    + I+ E+T T D +       H   L  P   T  ++ K+ + +  ++W  +G 
Sbjct: 33  KHAIPLRTIQPESTYTADIMPPDAYRDHRRVLNIPTKFTHLSSNKVKHVIPAITWTPEGR 92

Query: 236 SIATGVENGELRLWNKEG-KLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNS 294
            +     +GE  LWN      +++   H S +  + ++ +    IS DAD    +W  N 
Sbjct: 93  RLVVATYSGEFSLWNGSSFNFESIMQAHDSAVTVMQYSHAGDWLISGDADGTIKIWQPNF 152

Query: 295 GVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGK 354
            +V                     M  +   + D  KFV       L ++  S+ +    
Sbjct: 153 NMV-----------KVLDRAHTECMRDISFSYSD-QKFVTCSDDNVLKIWNFSNGQQERV 200

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW--VNN 412
           L GH   +   +++ +  L+ S + DN I++W    G ++    G   T++  K+     
Sbjct: 201 LSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLWDPRTGRNVSTILGLKHTVIKTKFQPTQG 260

Query: 413 DMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRER-YAAGFMDGQ 471
           ++L   S D S+K++D  + ++E+      +TI D +   + +     E  ++ G  +G 
Sbjct: 261 NLLAVVSKDKSIKIYDMRQHMREL------QTIRDDMDYMSLSWHPINETIFSVGCYNGA 314

Query: 472 VTVFNL 477
           +  F+L
Sbjct: 315 IKHFDL 320

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 40/198 (20%), Positives = 74/198 (37%), Gaps = 39/198 (19%)

Query: 228 LSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNI 286
           +S+++      T  ++  L++WN   G+ + V + H   + +  W+      +S   DN+
Sbjct: 169 ISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNL 228

Query: 287 TILWDVNSG------------VVLQHFESK--------AXXXXXXXXXXXXQMFGVDTVW 326
             LWD  +G            V+   F+          +             M  + T+ 
Sbjct: 229 IKLWDPRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTIR 288

Query: 327 VDTDK------------FVIPGPGGNL----LVYTMSDSRPIGKLV--GHRGTISQLEFN 368
            D D             F +    G +    L++  S+S P    +   H  +++ L ++
Sbjct: 289 DDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHTIPYAHEKSVTSLAYS 348

Query: 369 SETKLLASAADDNTIRVW 386
               +LASAA D TIR W
Sbjct: 349 PVGHILASAAKDRTIRFW 366

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 92/178 (51%), Gaps = 18/178 (10%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           G +     +D  P+  L+GH+G +  L  +S+   + S++ D T +VWH  NG++I+   
Sbjct: 79  GGISPLATTDEDPVYMLIGHKGNVCSL--SSKNNFVISSSWDKTAKVWH--NGSAIYDLV 134

Query: 399 GHTQTIVSLKWV-NNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAIS 457
           GH+ ++   K++   D  ++AS D ++KLW   K ++  +G  I + ++  +      IS
Sbjct: 135 GHSASVWDAKFLPEKDFFLTASADCTIKLWHGNKLIKTFSG--IHKDVIRHLD-----IS 187

Query: 458 DDRERYAAGFMDGQVTVFNL-AALLKRYSKGKKHKNHVMSIPIC--GDFQSAHSDDSV 512
            D E +A+   DG V + ++   +LK ++    H++ V S+     GD  S   D SV
Sbjct: 188 PDGETFASCSNDGTVKINDMDGNILKTFT---GHESFVYSVKFLPNGDLVSCGEDRSV 242

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLIS 417
           H+  I  L+ + + +  AS ++D T+++ +  +GN +  F GH   + S+K++ N  L+S
Sbjct: 177 HKDVIRHLDISPDGETFASCSNDGTVKI-NDMDGNILKTFTGHESFVYSVKFLPNGDLVS 235

Query: 418 ASMDGSVKLW 427
              D SV++W
Sbjct: 236 CGEDRSVRVW 245

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/269 (21%), Positives = 108/269 (40%), Gaps = 28/269 (10%)

Query: 179 EHDSTAKLIELETTTTDDQI--------KLIEKTIHELRHPFATSATTGKITNQLTCLSW 230
            H+  A  I+ ETT T + +        K +  T  +  H      ++ K+ + +  + W
Sbjct: 35  RHNLPAPHIQPETTYTTEILPPDAYYGNKRVINTPTKFTH-----LSSNKVKHVIPAIKW 89

Query: 231 AHDGDSIATGVENGELRLWNKEG-KLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITIL 289
             +G  +     +GE  LWN      +++   H S +  + ++ +    IS D+D I  +
Sbjct: 90  TPEGRRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDWLISGDSDGIIKI 149

Query: 290 WDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDS 349
           W  N  +V      K                G D+      KFV       L ++  S+ 
Sbjct: 150 WQPNFNMV------KVLDQAHMECVRDVSFSGTDS------KFVTCSDDNILKIWNFSNG 197

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
           +    L GH   +   +++    L+ S + DN I++W   +G  I    G   TI+  K+
Sbjct: 198 QQERVLSGHHWDVKSCDWHPTMGLIVSGSKDNLIKLWDPRSGQCISTILGFKHTIIKTKF 257

Query: 410 --VNNDMLISASMDGSVKLWDCGKKLQEI 436
                ++L   + D S K++D  + ++E+
Sbjct: 258 QPTKGNLLAVVAKDKSCKIFDIRQNMKEL 286

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/87 (20%), Positives = 36/87 (41%), Gaps = 1/87 (1%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN-NDMLISASM 420
           I  +++  E + L  A       +W+G   N       H   + ++++ +  D LIS   
Sbjct: 84  IPAIKWTPEGRRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDWLISGDS 143

Query: 421 DGSVKLWDCGKKLQEITGNLIAETIVD 447
           DG +K+W     + ++      E + D
Sbjct: 144 DGIIKIWQPNFNMVKVLDQAHMECVRD 170

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/234 (20%), Positives = 101/234 (43%), Gaps = 31/234 (13%)

Query: 224 QLTCLSWAHDGDSIATGVENGELRLWNKEG---------KLQNVFNF-----HKSPIIAI 269
           ++TCL ++ D   +A G ++  ++LW+ +G         K ++  N      H  P+ ++
Sbjct: 489 EMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSV 548

Query: 270 HWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDT 329
            ++  N + +S   D    LW +++   L  ++                 F   +     
Sbjct: 549 SFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGS----H 604

Query: 330 DKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGG 389
           D+           +++     P+    GH   +  + F+     + + + D T R+W   
Sbjct: 605 DQ--------TARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQ 656

Query: 390 NGNSIHCFYGHTQTIVSLKWVNND--MLISASMDGSVKLWD--CGKKLQEITGN 439
            G+S+  F GHT ++VS+  V+ D   L + S DG + +WD   GK+++++ G+
Sbjct: 657 TGDSVRLFLGHTASVVSVA-VSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGH 709

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 68/141 (48%), Gaps = 13/141 (9%)

Query: 289 LWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSD 348
           LWD   G +L  FE                + G+D        FV  G    + V+++  
Sbjct: 37  LWDYRMGTLLHRFEDH-----------EGPVRGLD-FHPTQPIFVSAGDDYTIKVWSLDT 84

Query: 349 SRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLK 408
           ++ +  L GH   +  + F+ E   + SA+DD TIR+W+  N   I C  GH   ++  +
Sbjct: 85  NKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQ 144

Query: 409 W-VNNDMLISASMDGSVKLWD 428
           +   +D+++SAS+D ++++WD
Sbjct: 145 FHPTDDLIVSASLDETIRIWD 165

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 3/96 (3%)

Query: 340 NLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNS--IHCF 397
           NLL  ++ D      L GH   ++   F+    L+ S +DD  +++W      +  +   
Sbjct: 190 NLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTC 249

Query: 398 YGHTQTIVSLKW-VNNDMLISASMDGSVKLWDCGKK 432
            GHT  + S+ +  + +++IS   D ++++WD  K+
Sbjct: 250 RGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLDKR 285

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 77/161 (47%), Gaps = 14/161 (8%)

Query: 351 PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTI--VSLK 408
           P+    GH+G ++ + F  E + + S+++D TI+VW      S+   Y H   +  V++ 
Sbjct: 67  PVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVW-DVRSPSVQRNYKHNAPVNEVAIH 125

Query: 409 WVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFM 468
             N   LIS   DG++++WD G+   + T  L  E   D  P+ + +++ D     AG  
Sbjct: 126 -PNQGELISCDQDGNIRIWDLGEN--QCTNQLTPE---DNTPLQSLSVASDGSMLVAGNN 179

Query: 469 DGQVTVFNL-----AALLKRYSKGKKHKNHVMSIPICGDFQ 504
            G   V+ +     A+ L+  +K K H  ++  + +  D +
Sbjct: 180 KGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVK 220

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 98/229 (42%), Gaps = 26/229 (11%)

Query: 211 PFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPI--I 267
           P   S+  G   N +T +++  +   + +  E+G +++W+ +   +Q  +  H +P+  +
Sbjct: 65  PNPVSSFEGHKGN-VTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYK-HNAPVNEV 122

Query: 268 AIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWV 327
           AIH N      IS D D    +WD+         E++             Q   V +   
Sbjct: 123 AIHPNQGE--LISCDQDGNIRIWDLG--------ENQCTNQLTPEDNTPLQSLSVAS--- 169

Query: 328 DTDKFVIPGPGGNLLVYTM------SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDN 381
           D    V     GN  V+ M      S   P+ K   H   I+++  +++ K LA+ + D+
Sbjct: 170 DGSMLVAGNNKGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADH 229

Query: 382 TIRVWHGGNGNSIH-CFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
           T RVW+  +   +     GH + +    +  ++  L++A  D  V+LWD
Sbjct: 230 TARVWNIEDNFELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWD 278

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 55/88 (62%), Gaps = 1/88 (1%)

Query: 346 MSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIV 405
           +  ++PI ++ GH+  ++ + F+ + + + SA+ DN+I++W+G +G  I  F GH  ++ 
Sbjct: 389 LKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVY 448

Query: 406 SLKWVNN-DMLISASMDGSVKLWDCGKK 432
            + W ++  +L+S S D ++K+WD   K
Sbjct: 449 QVAWSSDCRLLVSCSKDTTLKVWDVKTK 476

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 59/119 (49%), Gaps = 10/119 (8%)

Query: 329 TDKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
           T   +I G G N   ++  +   P+  L GH   +  + ++ + +L+A+ + DNTIR+W 
Sbjct: 155 TSSRMITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWE 214

Query: 388 GGNGNSI-HCFYGHTQTIVSLKWV--------NNDMLISASMDGSVKLWDCGKKLQEIT 437
           G  G  +     GH + I SL W             L SAS DG++K+WD  +++  IT
Sbjct: 215 GNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRVCLIT 273

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 68/168 (40%), Gaps = 30/168 (17%)

Query: 274 SNTHFISTDADNITILWDVNSGVVLQ----HFESKAXXXXXXXXXXXXQMFGVDTVWVDT 329
           +++  I+   DN   +WD N+   +     HF                  + +   W   
Sbjct: 155 TSSRMITGAGDNTARIWDCNTQTPMSTLKGHFN-----------------WVLCVSWSPD 197

Query: 330 DKFVIPGPGGNLL-VYTMSDSRPIG-KLVGHRGTISQLEFNS-------ETKLLASAADD 380
            + +  G   N + ++  +  +P+G  L GH   I+ L +         +   LASA+ D
Sbjct: 198 GELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKD 257

Query: 381 NTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
            TI++W       +    GHT ++  +KW    +L S S D +++ WD
Sbjct: 258 GTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWD 305

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 57/145 (39%), Gaps = 29/145 (20%)

Query: 163 VCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKIT 222
           +C  + P +S+ +  G  D+TA++ +  T T           +  L+  F          
Sbjct: 147 LCSAFAPHTSSRMITGAGDNTARIWDCNTQTP----------MSTLKGHF---------- 186

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLW--NKEGKLQNVFNFHKSPIIAIHWNS------- 273
           N + C+SW+ DG+ IATG  +  +RLW  NK   + +    H   I ++ W         
Sbjct: 187 NWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPG 246

Query: 274 SNTHFISTDADNITILWDVNSGVVL 298
                 S   D    +WD    V L
Sbjct: 247 QKPRLASASKDGTIKIWDTTRRVCL 271

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 48/108 (44%), Gaps = 5/108 (4%)

Query: 188 ELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELR 247
           EL  T +DD    +   +   + P        K+ N +   +++ DG  I +   +  ++
Sbjct: 372 ELMVTASDDFTMYLWNPLKSTK-PITRMTGHQKLVNHV---AFSPDGRHIVSASFDNSIK 427

Query: 248 LWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNS 294
           LWN ++GK  + F  H + +  + W+S     +S   D    +WDV +
Sbjct: 428 LWNGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKT 475

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 77/164 (46%), Gaps = 12/164 (7%)

Query: 347 SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVS 406
           ++  P+    GHRG ++ + F  + K + S+++D TI+VW      S+   Y H   +  
Sbjct: 63  TNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVW-DVRAPSVQRNYKHHAPVNE 121

Query: 407 LK-WVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAA 465
           +    N   LIS   DG++++WD G+   + T  L  E   D  P+ + +I+ D     A
Sbjct: 122 VVIHPNQGELISCDQDGNIRIWDLGEN--QCTHQLTPE---DDTPLQSLSIASDGSMLVA 176

Query: 466 GFMDGQVTVFNL-----AALLKRYSKGKKHKNHVMSIPICGDFQ 504
           G   G   V+ +     AA LK  +K + H  ++  + +  D +
Sbjct: 177 GNNKGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVK 220

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 88/214 (41%), Gaps = 23/214 (10%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPI--IAIHWNSSNTHFISTD 282
           +T +S+  D   + +  E+G +++W+           H +P+  + IH N      IS D
Sbjct: 78  VTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVIHPNQGE--LISCD 135

Query: 283 ADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLL 342
            D    +WD+         E++             Q   + +   D    V     GN  
Sbjct: 136 QDGNIRIWDLG--------ENQCTHQLTPEDDTPLQSLSIAS---DGSMLVAGNNKGNCY 184

Query: 343 VYTMSDS------RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIH- 395
           V+ M +       +P+ K   H   I+++  +S+ K LA+ + D+T RVW   +   +  
Sbjct: 185 VWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNFKLET 244

Query: 396 CFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
              GH + +    +  ++  L++A  D  V+LWD
Sbjct: 245 TLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWD 278

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 87/173 (50%), Gaps = 13/173 (7%)

Query: 331 KFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGN 390
           KF+    G + L+Y +SD         H  ++S + ++ +++ +A+A+DD TI + H   
Sbjct: 28  KFIAVSQGTSYLLYNVSDGLSAFIPTSHVESMSDICWSPDSQCIATASDDFTIEINHITY 87

Query: 391 GNSIHCFYGHTQTIVSLKWVNN-DMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGV 449
           G  +H   GHT  ++SL + +  ++L SASMD S+K+WD       +TG L+        
Sbjct: 88  GR-LHRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWD------VLTGTLLKTISAHSE 140

Query: 450 PIFAGAIS-DDRERYAAGFMDGQVTVFNLAA--LLK--RYSKGKKHKNHVMSI 497
           P+ +  +   D    ++G  DG + +F+      LK   Y K  K +N V+ I
Sbjct: 141 PVVSIDMPVCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVVPI 193

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 228 LSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNI 286
           + W+ D   IAT  ++  + + +   G+L  +   H +P++++ + S      S   D  
Sbjct: 62  ICWSPDSQCIATASDDFTIEINHITYGRLHRLVG-HTAPVLSLVYTSKGNLLCSASMDES 120

Query: 287 TILWDVNSGVVLQ 299
             +WDV +G +L+
Sbjct: 121 IKIWDVLTGTLLK 133

>Kwal_0.212
          Length = 303

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 86/187 (45%), Gaps = 15/187 (8%)

Query: 327 VDTDKFVIPGPGG-NLLVYTM--SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTI 383
           + +DK  +   G  N+ +Y +  ++  P+    GHRG ++ + F  E K + S+++D TI
Sbjct: 40  ISSDKRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTI 99

Query: 384 RVWHGGNGNSIHCFYGHTQTIVSLK-WVNNDMLISASMDGSVKLWDCGKKLQEITGNLIA 442
           +VW      S+   Y H   +  +    N   LIS   DG+V++WD G+   +    L  
Sbjct: 100 KVW-DVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGEN--QCVHQLAP 156

Query: 443 ETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNL-----AALLKRYSKGKKHKNHVMSI 497
           E   D  P+ + +++ D     AG   G   V+ +     AA  K  +K + H  ++  +
Sbjct: 157 E---DDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRV 213

Query: 498 PICGDFQ 504
            +  D +
Sbjct: 214 LLSSDVK 220

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 89/219 (40%), Gaps = 33/219 (15%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPI--IAIHWNSSNTHFISTD 282
           +T +++  +   + +  E+G +++W+           H++ +  + IH N      IS D
Sbjct: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGE--LISCD 135

Query: 283 ADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLL 342
            D    +WD+         E++             Q   V +   D    V     GN  
Sbjct: 136 QDGNVRIWDLG--------ENQCVHQLAPEDDTPLQSLSVAS---DGSMLVAGNNKGNCY 184

Query: 343 VYTM------SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHC 396
           V+ M      ++ +P+ K   H   I+++  +S+ K LA+ + D+T RVW   +   +  
Sbjct: 185 VWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLET 244

Query: 397 FYGHTQTIVSLKWV-------NNDMLISASMDGSVKLWD 428
              + Q     +WV       ++  L++A  D  V+LWD
Sbjct: 245 TLDNHQ-----RWVWDCAFSADSAYLVTACSDHYVRLWD 278

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 346 MSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIV 405
           +  S+PI ++ GH+  ++ + F+ + + + SA+ DN+I++W G +G  I  F GH  ++ 
Sbjct: 387 LKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVY 446

Query: 406 SLKWVNN-DMLISASMDGSVKLWDCGKKLQEITGNL 440
            + W ++  +L+S S D ++K+WD   K +++T +L
Sbjct: 447 QVAWSSDCRLLVSCSKDTTLKVWDV--KTRKLTVDL 480

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 7/81 (8%)

Query: 355 LVGHRGTISQLEFNS-------ETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSL 407
           L GH   I+ L +         E   LASA+ D TI++W       I+   GHT ++  +
Sbjct: 223 LRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSGHTSSVSCI 282

Query: 408 KWVNNDMLISASMDGSVKLWD 428
           KW   ++L SAS D +V+ WD
Sbjct: 283 KWGGRNVLYSASHDRTVRCWD 303

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 57/115 (49%), Gaps = 10/115 (8%)

Query: 329 TDKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
           T   ++ G G N   ++      P+  L GH   +  + ++++ +++A+ + D TIR+W 
Sbjct: 153 TSSRMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWD 212

Query: 388 GGNGNSI-HCFYGHTQTIVSLKW--------VNNDMLISASMDGSVKLWDCGKKL 433
              G S+     GHT+ I SL W             L SAS DG++K+WD  +++
Sbjct: 213 SEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRV 267

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/274 (20%), Positives = 95/274 (34%), Gaps = 94/274 (34%)

Query: 163 VCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKIT 222
           +C  + P +S+ +  G  D+TA++ + +T T                 P  T       +
Sbjct: 145 LCSAFAPHTSSRMVTGAGDNTARIWDCDTQT-----------------PLCTLKGH---S 184

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLWNKEG--KLQNVFNFHKSPIIAIHWN-------S 273
           N + C++W+ DG+ IATG  +  +RLW+ E    L +    H   I ++ W         
Sbjct: 185 NWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPG 244

Query: 274 SNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFV 333
                 S   D    +WD    V                                     
Sbjct: 245 EKPRLASASKDGTIKIWDTTRRVC------------------------------------ 268

Query: 334 IPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW-HGGNGN 392
                    +YT+S         GH  ++S +++     +L SA+ D T+R W     G 
Sbjct: 269 ---------IYTLS---------GHTSSVSCIKWGGR-NVLYSASHDRTVRCWDMAAGGK 309

Query: 393 SIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKL 426
            I+    H        WVN+   +S S D ++++
Sbjct: 310 CINILKSHAH------WVNH---LSLSTDYALRM 334

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 228 LSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNI 286
           ++++ DG  I +   +  ++LW+ ++GK    F  H + +  + W+S     +S   D  
Sbjct: 406 VAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTT 465

Query: 287 TILWDVNS 294
             +WDV +
Sbjct: 466 LKVWDVKT 473

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/304 (19%), Positives = 120/304 (39%), Gaps = 59/304 (19%)

Query: 163 VCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKIT 222
           +C  W+P    ++A G  D+T +L E                      P+   A  G  +
Sbjct: 190 LCCSWSP-DGELIATGSMDNTIRLWESSKG-----------------KPYG-DALRGH-S 229

Query: 223 NQLTCLSW-------AHDGDSIATGVENGELRLWNKEGKLQNV-FNFHKSPIIAIHWNSS 274
             +T LSW         D   +AT  ++G +++W+   ++  +    H S +  + W   
Sbjct: 230 KWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGK 289

Query: 275 NTHFISTDADNITILWDVN------------------------SGVVLQHFESKAXXXXX 310
           N  + S   D     WD+N                          + L  F+ K      
Sbjct: 290 NVLY-SGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPAS 348

Query: 311 XXXXXXXQMFGVDTVWVDTDKF--VIPGPGGNLLVY---TMSDSRPIGKLVGHRGTISQL 365
                   +   + V      F  ++     +  +Y    +  ++PI ++ GH+  ++ +
Sbjct: 349 PEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHV 408

Query: 366 EFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN-DMLISASMDGSV 424
            F+ + + + SA+ DN+I++W G +G  +  F GH  ++  + W ++  +L+S S D ++
Sbjct: 409 AFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTL 468

Query: 425 KLWD 428
           K+WD
Sbjct: 469 KVWD 472

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 58/120 (48%), Gaps = 10/120 (8%)

Query: 328 DTDKFVIPGPGGNLLVYTMSDSRP-IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
           +T   ++ G G N       D++  +  L GH   +    ++ + +L+A+ + DNTIR+W
Sbjct: 154 NTSSRMVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLW 213

Query: 387 HGGNGNSI-HCFYGHTQTIVSLKWV--------NNDMLISASMDGSVKLWDCGKKLQEIT 437
               G        GH++ I SL W         +   L +AS DG++K+WD  +++  +T
Sbjct: 214 ESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLT 273

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 54/145 (37%), Gaps = 29/145 (20%)

Query: 163 VCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKIT 222
           +C  + P +S+ +  G  D+TA + + +T     Q ++     H                
Sbjct: 147 LCSAFAPNTSSRMVTGAGDNTACIWDCDT-----QTRMCTLQGHH--------------- 186

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLW--NKEGKLQNVFNFHKSPIIAIHWNS------- 273
           N + C SW+ DG+ IATG  +  +RLW  +K     +    H   I ++ W         
Sbjct: 187 NWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPG 246

Query: 274 SNTHFISTDADNITILWDVNSGVVL 298
                 +   D    +WD    V L
Sbjct: 247 DKPRLATASKDGTIKIWDTTRRVCL 271

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 48/108 (44%), Gaps = 5/108 (4%)

Query: 188 ELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELR 247
           EL  T +DD    +   +   + P        K+ N +   +++ DG  I +   +  ++
Sbjct: 372 ELMVTASDDFTMYLWNPLKSTK-PITRMTGHQKLVNHV---AFSPDGRYIVSASFDNSIK 427

Query: 248 LWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNS 294
           LW+ ++GK  + F  H + +  + W+S     +S   D    +WDV +
Sbjct: 428 LWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKT 475

>Scas_624.11
          Length = 1205

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 13/141 (9%)

Query: 289 LWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSD 348
           LWD   G +L  FE                +F            V  G    + V+++  
Sbjct: 37  LWDYRMGTLLHRFEDHEGPVRSVDFHPTQPIF------------VSGGDDYTIKVWSLET 84

Query: 349 SRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLK 408
           ++ +  L GH   I  + F+ E   + SA+DD TIR+W+  N   I C  GH   ++  +
Sbjct: 85  NKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQ 144

Query: 409 W-VNNDMLISASMDGSVKLWD 428
           +   +D+++SAS+D ++++WD
Sbjct: 145 FHPTDDLVVSASLDETIRVWD 165

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/82 (19%), Positives = 39/82 (47%), Gaps = 3/82 (3%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNS--IHCFYGHTQTIVSLKW-VN 411
           L GH   ++   F+    ++ S +DD  +++W   +  +  +    GHT  +  + +   
Sbjct: 205 LEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVIFHPT 264

Query: 412 NDMLISASMDGSVKLWDCGKKL 433
              ++S   D ++++WD  K++
Sbjct: 265 QKFILSVGEDKTLRIWDLDKRI 286

>Scas_721.7
          Length = 325

 Score = 60.8 bits (146), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 93/169 (55%), Gaps = 19/169 (11%)

Query: 340 NLLVYTMSDSRPIGKLV--GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCF 397
            +L+Y +  +R I  ++   H   IS++ ++ + + LASA+DD TI + H  +G  +H  
Sbjct: 37  QILIYDL-QTRAIHSIIPTSHVAPISEVAWSPDNQCLASASDDFTIEITHLTHG-CLHRL 94

Query: 398 YGHTQTIVSLKWVNN-DMLISASMDGSVKLWDC--GKKLQEITGNLIAETIVDGVPIFAG 454
            GHT  ++SL + ++ ++L ++SMD S+K+WD   G  L+ I+ +  +E++V      + 
Sbjct: 95  MGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTISAH--SESVV------SL 146

Query: 455 AISDDRER--YAAGFMDGQVTVFNLAA--LLKRYSKGKKHKNHVMSIPI 499
           +I  DR+    A+G  DG + +F+      LK  +  K  K+    +PI
Sbjct: 147 SICPDRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPI 195

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 64/128 (50%), Gaps = 5/128 (3%)

Query: 354 KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWV--- 410
           +L+GH   +  L +N    LL +++ D +I++W   +G  +     H++++VSL      
Sbjct: 93  RLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTISAHSESVVSLSICPDR 152

Query: 411 NNDMLISASMDGSVKLWD--CGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFM 468
           ++ +L S S DG ++L+D   G  L+ +T +   ++    VPI     S + +       
Sbjct: 153 DSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVRFSPNGKFLLVSSF 212

Query: 469 DGQVTVFN 476
           DG V +++
Sbjct: 213 DGIVKIWD 220

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 54/282 (19%), Positives = 107/282 (37%), Gaps = 55/282 (19%)

Query: 228 LSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNI 286
           ++W+ D   +A+  ++  + + +   G L  +   H +P+I++ +N S     ++  D  
Sbjct: 63  VAWSPDNQCLASASDDFTIEITHLTHGCLHRLMG-HTAPVISLTYNDSGNLLFTSSMDES 121

Query: 287 TILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTM 346
             +WD   G +L+   + +                  ++  D D  V+     + L+  +
Sbjct: 122 IKIWDTFHGAILKTISAHSESVVSL------------SICPDRDSSVLASGSFDGLI-RL 168

Query: 347 SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVS 406
            D+R      GH   +  L ++ + K     +DD  + +               +Q   S
Sbjct: 169 FDTR-----TGH--CLKTLTYDKDWK-----SDDGVVPI---------------SQVRFS 201

Query: 407 LKWVNNDMLISASMDGSVKLWDC-----GKKLQEITGNLIAETIVDGVPIFAGAISDDRE 461
               N   L+ +S DG VK+WDC      +  +   G  +A     G+   A   S+  +
Sbjct: 202 ---PNGKFLLVSSFDGIVKIWDCVRGYVVRTFKPSDGESVALKHCCGIDFLAQEGSNSEK 258

Query: 462 ----RYAAGFMDGQVTVFNLAALLKRYSKGKKHKNHVMSIPI 499
                  +G+  GQ+  ++       YS      +HV S PI
Sbjct: 259 LPTPLVVSGYETGQIYCWDSNTKELLYSSANDDLHHVNS-PI 299

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 68/143 (47%), Gaps = 13/143 (9%)

Query: 289 LWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSD 348
           LWD   GV+L  FE                + G+D        FV  G    + V+++  
Sbjct: 37  LWDYRMGVLLHRFEDH-----------EGPVRGID-FHPTQPLFVSAGDDYTIKVWSLES 84

Query: 349 SRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLK 408
           ++ +  L GH   +  + F+ E   + S++DD TIR+W+  N   I C  GH   ++  +
Sbjct: 85  NKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQ 144

Query: 409 W-VNNDMLISASMDGSVKLWDCG 430
           +    D+++SAS+D +V++WD  
Sbjct: 145 FHPVEDLVVSASLDETVRVWDIS 167

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNS--IHCFYGHTQTIVSLKW-VN 411
           L GH   ++   F+    L+ S +DD  +++W      +  +    GHT  + S+ +   
Sbjct: 205 LEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQ 264

Query: 412 NDMLISASMDGSVKLWDCGKK 432
            +++IS   D +V++WD  K+
Sbjct: 265 QNLIISVGEDKTVRVWDLDKR 285

>Kwal_56.24526
          Length = 1210

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 65/141 (46%), Gaps = 13/141 (9%)

Query: 289 LWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSD 348
           LWD   G +L  FE                + G+D        FV  G    + V+++  
Sbjct: 37  LWDYRMGTLLHKFEDH-----------EGPVRGID-FHPTQPLFVSAGDDYTIKVWSLDT 84

Query: 349 SRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLK 408
            + +  L GH   +  + F+ E   + SA+DD TIR+W+  N   I C  GH   ++   
Sbjct: 85  KKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAD 144

Query: 409 W-VNNDMLISASMDGSVKLWD 428
           +    D+++SAS+D +V++WD
Sbjct: 145 FHPTEDLVVSASLDETVRVWD 165

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 3/81 (3%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNS--IHCFYGHTQTIVSLKW-VN 411
           L GH   ++   F+    L+ S  DD  +++W   +  +  +    GHT  + S+ +  +
Sbjct: 205 LEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPH 264

Query: 412 NDMLISASMDGSVKLWDCGKK 432
            +++IS   D +V++WD  K+
Sbjct: 265 QNLIISVGEDKTVRVWDLDKR 285

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 74/146 (50%), Gaps = 11/146 (7%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           G  +V+ +     I  L GH G+I  ++ +   KL+AS +DD +IR+W    G  +   +
Sbjct: 159 GGAIVWDLYKEELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKELSIGW 218

Query: 399 GHTQTIVSLKWVNNDM-LISASMDGSVKLWD------CGKKLQEITGNLIAETIVDGVPI 451
            HT  I +LK+ NND  L+S S D + ++W+       G +LQ    N+    ++  V  
Sbjct: 219 SHTARIWNLKFFNNDENLVSVSEDCTCRVWNIIPNDISGYELQ--ISNIFEGHLLKNV-- 274

Query: 452 FAGAISDDRERYAAGFMDGQVTVFNL 477
           +   ++D++   A    DG++ V +L
Sbjct: 275 WGVDVNDEKRIIATSGNDGRINVIDL 300

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 76/146 (52%), Gaps = 11/146 (7%)

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN-DMLI 416
           H   +SQ+ ++ + K +AS +DD T+ V H   G  +H   GHT  ++SL + N  ++L 
Sbjct: 54  HAAGVSQICWSPDGKCIASCSDDFTVVVTHRQLG-LLHRLVGHTAPVISLCYNNKGNLLF 112

Query: 417 SASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISD-DRERYAAGFMDGQVTVF 475
           ++SMD S+K+WD       +TG ++        P+ +  +SD D    ++G  DG + +F
Sbjct: 113 TSSMDESIKVWD------VLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDGLIRIF 166

Query: 476 NLAA--LLKRYSKGKKHKNHVMSIPI 499
           + A    LK  +  K  ++    +PI
Sbjct: 167 DTATGHCLKTLTYDKDWQSETGVVPI 192

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 81/173 (46%), Gaps = 10/173 (5%)

Query: 354 KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND 413
           +LVGH   +  L +N++  LL +++ D +I+VW    G  +     H++ +VS+   +ND
Sbjct: 91  RLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDND 150

Query: 414 --MLISASMDGSVKLWD--CGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMD 469
             +L S S DG ++++D   G  L+ +T +   ++    VPI     S + +       D
Sbjct: 151 GSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKSYD 210

Query: 470 GQVTVFNLAA--LLKRYSKGKKHKNHVMSIPICG-DFQSAHSDDSVFDLSWKE 519
           G V +++  +  +++ +    K  N       CG DF    S  S   LS  E
Sbjct: 211 GVVKIWDSVSGDVVRTFKPSNKKYNLTHC---CGMDFMYPQSTQSPLILSGYE 260

 Score = 37.0 bits (84), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 34/211 (16%), Positives = 90/211 (42%), Gaps = 28/211 (13%)

Query: 197 QIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQ 256
           ++ + E + ++LR         G     ++ + W+ DG  IA+  ++  + + +++  L 
Sbjct: 35  EVYIYETSGYQLRETLVLEHAAG-----VSQICWSPDGKCIASCSDDFTVVVTHRQLGLL 89

Query: 257 NVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXX 316
           +    H +P+I++ +N+      ++  D    +WDV +G V++   + +           
Sbjct: 90  HRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHS----------- 138

Query: 317 XQMFGVDTVWVDTDKFVIPGPG--GNLLVYTMSDSRPIGKLVGHRG--------TISQLE 366
             +  +D    D D  ++      G + ++  +    +  L   +          I++++
Sbjct: 139 EPVVSIDL--SDNDGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVK 196

Query: 367 FNSETKLLASAADDNTIRVWHGGNGNSIHCF 397
           F++ TK L   + D  +++W   +G+ +  F
Sbjct: 197 FSANTKYLLVKSYDGVVKIWDSVSGDVVRTF 227

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/268 (20%), Positives = 108/268 (40%), Gaps = 20/268 (7%)

Query: 214 TSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEG-KLQNVFNFHKSPIIAIHWN 272
           T  ++ K+ + +  L+W  +G  +     NGE  LW+      +++   H S +  + ++
Sbjct: 73  THLSSNKVKHVIPALTWTPEGRRLVVATYNGEFSLWSGSSFNFESIMQAHDSAVTVMTYS 132

Query: 273 SSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKF 332
            +    +S  AD    +W  N  +V    ++              Q            KF
Sbjct: 133 HTGDWMVSGSADGELKIWQPNFNMVKVMDQAHMECVREISFSPTDQ------------KF 180

Query: 333 VIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGN 392
           V       L ++  S+ +    L GH   +   +++ +  L+ S + DN I+ W   +G+
Sbjct: 181 VSCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFWDPRSGS 240

Query: 393 SIHCFYGHTQTIVSLKWV--NNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVP 450
            +    G   TI+S K+     ++L   S D + K++D  ++ +E+         VD + 
Sbjct: 241 CVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQQAKEL---FSVRDDVDYMT 297

Query: 451 IFAGAISDDRERYAAGFMDGQVTVFNLA 478
           +    I  D   +  G  DG +  F+L+
Sbjct: 298 LQWHPI--DETVFTVGCYDGSIKHFDLS 323

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 81/169 (47%), Gaps = 18/169 (10%)

Query: 351 PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWV 410
           PI    GH   +  L F+++  L+++A  D    +W   +G +I    GH++ I S+ W 
Sbjct: 297 PILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWS 356

Query: 411 NND-MLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFM- 468
            N   L S S DG++K+WD  KK     GN+  ETI+    I +        +   G++ 
Sbjct: 357 QNGYQLASGSGDGTIKVWDIRKK-----GNV--ETILAHNSIVSQV---KFNKQNGGYLV 406

Query: 469 ----DGQVTVFNLAALLKRYSKGKKHKNHVMSIPICG-DFQSAHSDDSV 512
               D +V +FN    +K  S  + H + VMSI I G D  SA  D SV
Sbjct: 407 SSGYDKKVNIFNDGNWIKERSL-EGHLDKVMSIDIVGPDIYSAGWDRSV 454

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 72/168 (42%), Gaps = 16/168 (9%)

Query: 262 HKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFG 321
           H + + ++ +++  +   +   D I ++WD+ SG  +   +  +             ++ 
Sbjct: 304 HSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSK-----------PIYS 352

Query: 322 VDTVWVDTDKFVIPGPG-GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSET-KLLASAAD 379
           VD  W      +  G G G + V+ +     +  ++ H   +SQ++FN +    L S+  
Sbjct: 353 VD--WSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNKQNGGYLVSSGY 410

Query: 380 DNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLW 427
           D  + +++ GN        GH   ++S+  V  D+  SA  D SV  W
Sbjct: 411 DKKVNIFNDGNWIKERSLEGHLDKVMSIDIVGPDIY-SAGWDRSVNKW 457

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/70 (22%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 224 QLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTD 282
           ++  LS+ +DG  ++T   +    +W+ + GK       H  PI ++ W+ +     S  
Sbjct: 307 EVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQLASGS 366

Query: 283 ADNITILWDV 292
            D    +WD+
Sbjct: 367 GDGTIKVWDI 376

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 83/196 (42%), Gaps = 20/196 (10%)

Query: 228 LSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNI 286
           L+++ DG  + T  E+G++++W+   G     F  H S + A+ +        S   D  
Sbjct: 347 LTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTSAVTAVQFAKKGQVLFSASLDGT 406

Query: 287 TILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTM 346
              WD+   +  ++F                +  G       TD F       ++ V+++
Sbjct: 407 VRAWDL---IRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSF-------DVFVWSV 456

Query: 347 SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVS 406
              + +  L GH G +S L F+ E  +LASA+ D TIR+W           +G +Q +  
Sbjct: 457 QTGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIW---------SIFGRSQQVEP 507

Query: 407 LKWVNNDMLISASMDG 422
           L+   + + I+ + DG
Sbjct: 508 LEVFADILAITITPDG 523

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           G LLVY       I K  GH    + L ++ +   + +AA+D  I+VW   +G  +  F 
Sbjct: 321 GQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFE 380

Query: 399 GHTQTIVSLKWVNN-DMLISASMDGSVKLWD 428
            HT  + ++++     +L SAS+DG+V+ WD
Sbjct: 381 EHTSAVTAVQFAKKGQVLFSASLDGTVRAWD 411

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 59/330 (17%), Positives = 124/330 (37%), Gaps = 38/330 (11%)

Query: 211 PFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLW--NKEGK--LQNVFNFHKSPI 266
           PF            +T  +W+HD   + T  ++   R+W  N E K  +      H+  +
Sbjct: 135 PFVRYRVHAGHFQDITSFTWSHDSRFLLTTSKDLTSRVWSINSEDKELVATTLAGHRDYV 194

Query: 267 IAIHWNSSNTHFISTDADNITILWDVNSGV---------VLQHFESKAXXXXXXXXXXXX 317
           +  ++NS+     +   D     W+  S           +     SK             
Sbjct: 195 LGAYFNSTQEKIYTISKDGAVFTWEYISKAQKEGLDEEDLEDEDLSKLSWRITKKNFFYA 254

Query: 318 QMFGVD--TVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLA 375
               V   T  ++++  ++    G   +Y M +   + +L   +  ++ +  N+  + LA
Sbjct: 255 NQAKVKCCTFHINSNLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVNTVSVNNSGEWLA 314

Query: 376 SAADD-NTIRVWHGGNGNSIHCFYGHTQTIVSLKWV-NNDMLISASMDGSVKLWD----- 428
             +     + V+   + + I    GH     SL +  +   +++A+ DG +K+WD     
Sbjct: 315 FGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGF 374

Query: 429 CGKKLQEITGNLIAETIV-DGVPIFAGAISDDRERYAAGFMDGQVTVFNLAAL--LKRYS 485
           C    +E T  + A      G  +F+ +            +DG V  ++L      + ++
Sbjct: 375 CLATFEEHTSAVTAVQFAKKGQVLFSAS------------LDGTVRAWDLIRYRNFRVFT 422

Query: 486 KGKKHKNHVMSIPICGDFQSAHSDDSVFDL 515
             ++ +   +++   G+  SA S DS FD+
Sbjct: 423 ATERVQFTCLAVEPSGEVVSAGSTDS-FDV 451

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 49/242 (20%), Positives = 91/242 (37%), Gaps = 30/242 (12%)

Query: 208 LRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNF-HKSPI 266
           ++  F  S   G +  Q   + ++HDG+ + + V N  + +++        F + H+  I
Sbjct: 1   MKSDFKFSNLLGTVYRQ-GNVQFSHDGNMLLSPVGN-RISVFDLVNNKSFTFAYEHRKNI 58

Query: 267 IAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVW 326
                N   T  +S D D   IL +  +  VL HF  K               F  D   
Sbjct: 59  ATFDVNKQGTLLLSVDTDGRAILVNFKTRNVLHHFNFKDKCYSVK--------FSPD--- 107

Query: 327 VDTDKFVIPGPGGNLLVYT---MSDSRPIGKLV------GHRGTISQLEFNSETKLLASA 377
               ++     G  L ++    +S  R     V      GH   I+   ++ +++ L + 
Sbjct: 108 ---GRYFALAVGRFLQIWKTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSRFLLTT 164

Query: 378 ADDNTIRVWHGGNGNS---IHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWDCGKKL 433
           + D T RVW   + +         GH   ++   +    + + + S DG+V  W+   K 
Sbjct: 165 SKDLTSRVWSINSEDKELVATTLAGHRDYVLGAYFNSTQEKIYTISKDGAVFTWEYISKA 224

Query: 434 QE 435
           Q+
Sbjct: 225 QK 226

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/242 (20%), Positives = 98/242 (40%), Gaps = 51/242 (21%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKEG-KLQNVFNF-------------HKSPIIAIH 270
           +TC+ ++ D    A G ++  +++W  +G  LQ++                H  P+ ++ 
Sbjct: 501 MTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVA 560

Query: 271 WNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTD 330
           ++  N + +S   D    LW +++   L  ++                      VW    
Sbjct: 561 FSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNH-----------------PVW---- 599

Query: 331 KFVIPGPGGNLLVYTMSDSR----------PIGKLVGHRGTISQLEFNSETKLLASAADD 380
            +V   P G+  +    D            P+    GH   +    F+     + + + D
Sbjct: 600 -YVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSD 658

Query: 381 NTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND--MLISASMDGSVKLWD--CGKKLQEI 436
            T R+W    G+S+  F GHT  + +L+ V+ D   L + S DG++ +WD   GK+++++
Sbjct: 659 KTCRMWDIQTGDSVRLFLGHTSPVTALE-VSPDGRWLTTGSEDGTIIVWDIGTGKRIKQM 717

Query: 437 TG 438
            G
Sbjct: 718 KG 719

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 14/82 (17%)

Query: 360 GTISQLEFNSETKLLASAADDNTIRVWH--GGNGNSI-----------HCFYGHTQTIVS 406
           G ++ +EF+ + +L A+   D+TI+VW+  G    SI               GH+  + S
Sbjct: 499 GNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYS 558

Query: 407 LKW-VNNDMLISASMDGSVKLW 427
           + +  +N  L+SAS D +V+LW
Sbjct: 559 VAFSPDNRYLLSASEDKTVRLW 580

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFIST 281
           N + C ++  +G  + TG  +   R+W+ + G    +F  H SP+ A+  +       + 
Sbjct: 638 NDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTG 697

Query: 282 DADNITILWDVNSGVVLQHFE 302
             D   I+WD+ +G  ++  +
Sbjct: 698 SEDGTIIVWDIGTGKRIKQMK 718

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 222 TNQLTCLSWAHDGDSIATGVENGELRLWN--KEGKLQNVFNFHKSPIIAIHWNSSNTHFI 279
           T+ +T L  + DG  + TG E+G + +W+     +++ +    K+PI +I +N      +
Sbjct: 679 TSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLV 738

Query: 280 STDADNITILWDV 292
           +  AD    +WD+
Sbjct: 739 TGGADQSVRVWDI 751

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 103/262 (39%), Gaps = 39/262 (14%)

Query: 233 DGDSIATGVENGELRLWNKE--GKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILW 290
           DG  +ATG   G +++ + E  G  +++   H+  I  + W+    H +S   DN+  LW
Sbjct: 183 DGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLW 242

Query: 291 DV--NSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWV--------------------- 327
           D+  NS   L+    +                  D  W+                     
Sbjct: 243 DMTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVY 302

Query: 328 ----DTDKFVIPGPGGNLL--VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDN 381
                +D  ++   G + +  ++ +    PI KL GH G IS ++++     LA+A  D 
Sbjct: 303 TIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADG 362

Query: 382 TIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND--MLISASMDGSVKLW--DCGKKLQEIT 437
           T+RVW   N  +      H    + +K+  N+   L+S   D  V ++  D  +KL  + 
Sbjct: 363 TVRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLE 422

Query: 438 GN----LIAETIVDGVPIFAGA 455
           G+       +   DG  I++G 
Sbjct: 423 GHTDRVFTVDITEDGSTIYSGG 444

>Scas_629.12
          Length = 671

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 104/250 (41%), Gaps = 49/250 (19%)

Query: 211 PFATSATTGKITNQ---LTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPI 266
           P  +SAT+G   +    +  + ++ DG+ +ATG E+  +R+W+ +E K+  V   H+  +
Sbjct: 373 PDTSSATSGSTPSTDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDV 432

Query: 267 IAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVW 326
            ++ +  +    +S   D    +WD+ +G        +               +GV TV 
Sbjct: 433 YSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIE---------------YGVTTVA 477

Query: 327 VDTD--KFVIPG----------PGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLL 374
           V  +  KF+  G               LV  +     +G   GHR ++  + F  +   +
Sbjct: 478 VSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELG--TGHRDSVYSVVFTRDGNEV 535

Query: 375 ASAADDNTIRVW---HGGNGN---------SIHC---FYGHTQTIVSLKWVNND-MLISA 418
            S + D T+++W   H GN N         S  C   + GH   ++S+    +D  ++S 
Sbjct: 536 VSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSG 595

Query: 419 SMDGSVKLWD 428
           S D  +  WD
Sbjct: 596 SKDRGILFWD 605

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 69/144 (47%), Gaps = 15/144 (10%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWV-NNDMLISASM 420
           I  + F+ + + LA+ A+D  IR+W       +    GH Q + SL +  N + L+S S 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSG 449

Query: 421 DGSVKLWDCGKKLQEITGNL-IAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAA 479
           D +V++WD        TG   +  +I  GV   A + +D +   AAG +D  V V++   
Sbjct: 450 DRTVRIWDLR------TGQCSLTLSIEYGVTTVAVSPNDGK-FIAAGSLDRAVRVWDSTT 502

Query: 480 --LLKRYSK----GKKHKNHVMSI 497
             L++R       G  H++ V S+
Sbjct: 503 GFLVERLDSENELGTGHRDSVYSV 526

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 35/83 (42%), Gaps = 7/83 (8%)

Query: 356 VGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDML 415
           VGH+  +  +  + + K + S + D  I  W   +GN +    GH  +++S+   N   L
Sbjct: 574 VGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRNSVISVAVANGSAL 633

Query: 416 -------ISASMDGSVKLWDCGK 431
                   + S D   ++W   K
Sbjct: 634 GPKYNVFATGSGDCKARIWKYSK 656

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 105/239 (43%), Gaps = 35/239 (14%)

Query: 278 FISTDADNITILWDVNSGVV---LQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVI 334
            +S   D+    W+  +GV    +QH +S+                 V+ + +  DK ++
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQ-----------------VNRLEITNDKKLL 47

Query: 335 PGPG-GNLLVYTM--SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNG 391
              G  N+ +Y +  ++  P+    GHRG ++ + F  + + + ++++D TI+VW     
Sbjct: 48  ATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVW-DVRS 106

Query: 392 NSIHCFYGHTQTIVSLK-WVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVP 450
            SI   Y H   +  +    N   LIS   DG++++WD G+   + T  L  E   D   
Sbjct: 107 PSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGEN--QCTHQLTPE---DDTS 161

Query: 451 IFAGAISDDRERYAAGFMDGQVTVFNL-----AALLKRYSKGKKHKNHVMSIPICGDFQ 504
           + + +++ D    AA    G   V+ +     A+ LK  +K + H  ++  I +  D +
Sbjct: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVK 220

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 89/218 (40%), Gaps = 23/218 (10%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPI--IAIHWNSSNTHFISTD 282
           +T +S+  D   + T  E+G +++W+           H +P+  + IH N      IS D
Sbjct: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCD 135

Query: 283 ADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLL 342
            D    +WD+         E++             Q   + +   D          GN  
Sbjct: 136 RDGNIRIWDLG--------ENQCTHQLTPEDDTSLQSLSMAS---DGSMLAAANTKGNCY 184

Query: 343 VYTM------SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIH- 395
           V+ M      S  +P+ K   H   I+++  +S+ K LA+ + D+T RVW   +   +  
Sbjct: 185 VWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLET 244

Query: 396 CFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWDCGKK 432
              GH + +    +  ++  L++AS D  V+LWD   +
Sbjct: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 57.4 bits (137), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 91/175 (52%), Gaps = 16/175 (9%)

Query: 331 KFVIPGPGGNLLVYTMSDSRPIGKLV-GHRGTISQLEFNSETKLLASAADDNTIRVWHGG 389
           +F+    G N+L+Y ++       LV  H    S+L ++ + + +A+A+DD ++ + H  
Sbjct: 26  QFLAITQGLNILIYDINRRTVSQTLVTSHARPFSELCWSPDGQCIATASDDFSVEIIHLS 85

Query: 390 NGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWDC--GKKLQEITGNLIAETIV 446
            G  +H F GHT  ++SL +    ++L ++SMD S+K+WD   G  ++ I+ +  A   V
Sbjct: 86  YG-LLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSV 144

Query: 447 DGVPIFAGAISDDRERYAAGFMDGQVTVFNLAA--LLK--RYSKGKKHKNHVMSI 497
           D VP+      +D    ++G  DG + +F+      LK   Y K  K +N V+ I
Sbjct: 145 D-VPM------NDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPI 192

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 63/126 (50%), Gaps = 4/126 (3%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND- 413
            +GH   +  L FN +  LL +++ D +I++W   NG+ +     H++ +VS+    ND 
Sbjct: 92  FIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPMNDS 151

Query: 414 -MLISASMDGSVKLWDC--GKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDG 470
            +L S S DG ++++D   G  L+ +T +   +     VPI     S++        +DG
Sbjct: 152 SILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKSLDG 211

Query: 471 QVTVFN 476
            V +++
Sbjct: 212 VVKIWD 217

 Score = 35.8 bits (81), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 36/72 (50%)

Query: 228 LSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNIT 287
           L W+ DG  IAT  ++  + + +    L + F  H +P+I++ +N       ++  D   
Sbjct: 61  LCWSPDGQCIATASDDFSVEIIHLSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESI 120

Query: 288 ILWDVNSGVVLQ 299
            +WD  +G +++
Sbjct: 121 KIWDTLNGSLMK 132

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 237 IATGVENGELRLWNKEGK-----LQNVFNFHKSPIIAIH 270
           + +G ENG++  WN + K     L      H SP+++IH
Sbjct: 256 VISGYENGDIYCWNSDTKSLLQLLDGSLYHHSSPVMSIH 294

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 67/126 (53%), Gaps = 2/126 (1%)

Query: 321 GVDTVWVDTDKFVIPGP-GGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAAD 379
           G  +V+ DT  ++  G   G + ++ +     +  L+GH G+I  +  +   + + S +D
Sbjct: 142 GSISVFSDTKVYINAGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSD 201

Query: 380 DNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDM-LISASMDGSVKLWDCGKKLQEITG 438
           D +I++W+  +G  +   +GHT  I  LK+++ND  ++S S D + ++WD  K   ++  
Sbjct: 202 DRSIKLWNLKSGELLSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDIAKPHDDLVQ 261

Query: 439 NLIAET 444
           + I E 
Sbjct: 262 SGIYEV 267

>AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248)
           [1242 bp, 413 aa]
          Length = 413

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 4/86 (4%)

Query: 346 MSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIV 405
            SD R    L GH G I+ L +    K+L SA+ D  +++W   +G +    +GHT  I 
Sbjct: 136 FSDCR---SLDGHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPIT 192

Query: 406 SLKWVNNDM-LISASMDGSVKLWDCG 430
               +     ++S+S DGSV+LW+CG
Sbjct: 193 GCGLIERGRNVLSSSKDGSVRLWECG 218

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/74 (21%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY-- 398
           L +++ +D      L GH   I+        + + S++ D ++R+W  G+G+ +  F+  
Sbjct: 170 LKIWSAADGTNPRTLFGHTAPITGCGLIERGRNVLSSSKDGSVRLWECGSGSMLRAFHRR 229

Query: 399 -GHTQTIVSLKWVN 411
             H+  + +L+ +N
Sbjct: 230 DRHSDGVNALQVLN 243

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 71/155 (45%), Gaps = 15/155 (9%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWV-NNDMLISASM 420
           I  + F+ + K LA+ A+D  IR+W   N   +    GH Q I SL +  + D L+S S 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 421 DGSVKLWDCGKKLQEITGNL-IAETIVDGVPIFAGAISDDRERYAAGFMDGQVTV----- 474
           D +V++WD        TG   +  +I DGV   A +  D +   AAG +D  V V     
Sbjct: 506 DRTVRIWDLR------TGQCSLTLSIEDGVTTVAVSPGDGK-YIAAGSLDRAVRVWDSET 558

Query: 475 -FNLAALLKRYSKGKKHKNHVMSIPICGDFQSAHS 508
            F +  L      G  HK+ V S+    D QS  S
Sbjct: 559 GFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVS 593

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 60/279 (21%), Positives = 112/279 (40%), Gaps = 62/279 (22%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKEG-KLQNVFNFHKSPIIAIHWNSSNTHFISTDA 283
           +  + ++ DG  +ATG E+  +R+W+ E  K+  +   H+  I ++ +  S    +S   
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLV 343
           D    +WD+ +G        +                GV TV V       PG G  +  
Sbjct: 506 DRTVRIWDLRTGQCSLTLSIED---------------GVTTVAVS------PGDGKYIAA 544

Query: 344 YTMSDSRPI-----GKLV-----------GHRGTISQLEFNSETKLLASAADDNTIRVWH 387
            ++  +  +     G LV           GH+ ++  + F  + + + S + D ++++W+
Sbjct: 545 GSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 388 GGNG---------NSIHC---FYGHTQTIVSLKWVNND-MLISASMDGSVKLWD--CGKK 432
             N          NS  C   + GH   ++S+    ND  ++S S D  V  WD   G  
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 664

Query: 433 LQEITG---NLIAETIVDGVP------IFAGAISDDRER 462
           L  + G   ++I+  + +G P      +FA    D + R
Sbjct: 665 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKAR 703

 Score = 29.3 bits (64), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 15/83 (18%), Positives = 34/83 (40%), Gaps = 7/83 (8%)

Query: 356 VGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN--- 412
           +GH+  +  +      + + S + D  +  W   +GN +    GH  +++S+   N    
Sbjct: 627 IGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPL 686

Query: 413 ----DMLISASMDGSVKLWDCGK 431
               ++  + S D   ++W   K
Sbjct: 687 GPEYNVFATGSGDCKARIWKYKK 709

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 75/164 (45%), Gaps = 12/164 (7%)

Query: 347 SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVS 406
           ++  P+    GHRG ++ + F  + K + S+++D TI+VW      S+   Y H   +  
Sbjct: 63  TNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVW-DVRSPSVQRNYKHDAPVNE 121

Query: 407 LK-WVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAA 465
           +    N   LIS   DG++K+WD G+   + T  L  E   D   + + +I+ D     A
Sbjct: 122 VVIHPNQGELISCDQDGNIKIWDLGEN--QCTNQLALE---DNTALQSLSIASDGSMLVA 176

Query: 466 GFMDGQVTVFNL-----AALLKRYSKGKKHKNHVMSIPICGDFQ 504
           G   G   V+ +      A LK  +K + H  ++  + +  D +
Sbjct: 177 GNNKGNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVK 220

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 90/220 (40%), Gaps = 35/220 (15%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPI--IAIHWNSSNTHFIST 281
           +T +++  D   + +  E+G +++W+ +   +Q  +  H +P+  + IH N      IS 
Sbjct: 78  VTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYK-HDAPVNEVVIHPNQGE--LISC 134

Query: 282 DADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNL 341
           D D    +WD+         E++             Q   + +   D    V     GN 
Sbjct: 135 DQDGNIKIWDLG--------ENQCTNQLALEDNTALQSLSIAS---DGSMLVAGNNKGNC 183

Query: 342 LVYTMSDS------RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIH 395
            V+ M +       +P+ K   H   I+++  + + K LA+ + D+T RVW   +     
Sbjct: 184 YVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDN---- 239

Query: 396 CFYGHTQTIVSLKWV-------NNDMLISASMDGSVKLWD 428
            F   T      +WV       ++  L++A  D  V+LWD
Sbjct: 240 -FQLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWD 278

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 115/281 (40%), Gaps = 49/281 (17%)

Query: 214 TSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKE-GKLQNVFNFHKSPIIAIHWN 272
           ++A+T      +  + ++ DG  +ATG E+  +R+W+ E  K+      H+  I ++ + 
Sbjct: 398 SAASTASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYF 457

Query: 273 SSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDT--D 330
            S    +S   D    +WD+ +G        +                GV TV V     
Sbjct: 458 PSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIED---------------GVTTVAVSPGEG 502

Query: 331 KFVIPG----------PGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADD 380
           KF+  G               LV  +     +G   GHR ++  + F  + K + S + D
Sbjct: 503 KFIAAGSLDRTVRVWDSDTGFLVERLDSENELG--TGHRDSVYSVVFTRDGKGVVSGSLD 560

Query: 381 NTIRVW--HGGNGNSIHC-----FYGHTQTIVSLKWVNND-MLISASMDGSVKLWD--CG 430
            ++++W  +G +G   H      + GH   ++S+    ND  ++S S D  V  WD   G
Sbjct: 561 RSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSG 620

Query: 431 KKLQEITG---NLIAETIVDGVP------IFAGAISDDRER 462
             L  + G   ++I+ T+ +G P      +FA    D + R
Sbjct: 621 NPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKAR 661

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 70/145 (48%), Gaps = 17/145 (11%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWV-NNDMLISASM 420
           I  + F+ + K LA+ A+D  IR+W       +    GH Q I SL +  + + L+S S 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSG 468

Query: 421 DGSVKLWDCGKKLQEITGNL-IAETIVDGVPIFAGAISDDRERY-AAGFMDGQVTVF--N 476
           D +V++WD        TG   +  +I DGV     A+S    ++ AAG +D  V V+  +
Sbjct: 469 DRTVRIWDL------TTGTCSLTLSIEDGVTTV--AVSPGEGKFIAAGSLDRTVRVWDSD 520

Query: 477 LAALLKRYSK----GKKHKNHVMSI 497
              L++R       G  H++ V S+
Sbjct: 521 TGFLVERLDSENELGTGHRDSVYSV 545

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 88/202 (43%), Gaps = 21/202 (10%)

Query: 331 KFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGG 389
           KF+  G    L+ ++ +   + +  L GH   I  L++      L S + D T+R+W   
Sbjct: 419 KFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLT 478

Query: 390 NGN-SIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDC--GKKLQEI-TGNLIAETI 445
            G  S+        T V++       + + S+D +V++WD   G  ++ + + N +    
Sbjct: 479 TGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGH 538

Query: 446 VDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAALLKRYSKGK------KHKNHVMSIPI 499
            D V  ++   + D +   +G +D  V ++NL  L  + S  +       HK+ V+S+  
Sbjct: 539 RDSV--YSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSV-- 594

Query: 500 CGDFQSAHSDDSVFDLSWKEDR 521
                 A + +  + LS  +DR
Sbjct: 595 ------ATTQNDEYILSGSKDR 610

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/83 (20%), Positives = 33/83 (39%), Gaps = 7/83 (8%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDML- 415
           GH+  +  +      + + S + D  +  W   +GN +    GH  +++S+   N   L 
Sbjct: 586 GHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVTVANGHPLG 645

Query: 416 ------ISASMDGSVKLWDCGKK 432
                  + S D   ++W   KK
Sbjct: 646 PEYGVFATGSGDCKARIWKYSKK 668

>Scas_465.4
          Length = 1002

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 51/91 (56%), Gaps = 1/91 (1%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           G +L++ +     +  LVGH G+I     +   + + S +DD +I++W+   G  +   +
Sbjct: 159 GGVLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGW 218

Query: 399 GHTQTIVSLKWVNND-MLISASMDGSVKLWD 428
           GHT  I +LK+ NND  LIS S D + ++WD
Sbjct: 219 GHTARIWNLKFFNNDTQLISVSEDNTCRVWD 249

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/271 (19%), Positives = 109/271 (40%), Gaps = 26/271 (9%)

Query: 214 TSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEG-KLQNVFNFHKSPIIAIHWN 272
           T  ++ K+ + +  + W+ +G  +     +GE  LWN      + +   H + +  + ++
Sbjct: 74  THLSSNKVKHVIPAIQWSPEGRRLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTMKYS 133

Query: 273 SSNTHFISTDADNITILWDVNSGVV--LQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTD 330
            +    IS DAD    +W  N  +V  L    ++                  D  + + D
Sbjct: 134 HAGDWMISGDADGTIKIWQPNFNMVKELDRIHTEGIR---------------DVAFSNND 178

Query: 331 -KFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGG 389
            KFV       L ++  S+ +    L GH   +   +++ E  L+ S + DN +++W   
Sbjct: 179 SKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHPELGLIVSGSKDNLVKLWDPR 238

Query: 390 NGNSIHCF--YGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVD 447
           +G  +     + HT      +    ++L + S D S +++D    + E+   +     VD
Sbjct: 239 SGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRASMNEL---MCVRDEVD 295

Query: 448 GVPIFAGAISDDRERYAAGFMDGQVTVFNLA 478
            + +    I++    +  G  DG +  F+L 
Sbjct: 296 FMELEWSTINE--SMFTVGCYDGSLKHFDLG 324

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 37/195 (18%), Positives = 73/195 (37%), Gaps = 36/195 (18%)

Query: 228 LSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNI 286
           ++++++     T  ++  L++WN   G+ + V + H   + +  W+      +S   DN+
Sbjct: 172 VAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHPELGLIVSGSKDNL 231

Query: 287 TILWDVNSG------VVLQH--------------------------FESKAXXXXXXXXX 314
             LWD  SG      +  +H                          F+ +A         
Sbjct: 232 VKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRASMNELMCVR 291

Query: 315 XXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSD--SRPIGKL-VGHRGTISQLEFNSET 371
                  ++   ++   F +    G+L  + +     +PI  +   H   IS + +N   
Sbjct: 292 DEVDFMELEWSTINESMFTVGCYDGSLKHFDLGQDTEKPIHIIPFAHEKCISAIAYNPVG 351

Query: 372 KLLASAADDNTIRVW 386
            +LA+AA D TIR W
Sbjct: 352 HILATAAKDRTIRFW 366

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 61/112 (54%), Gaps = 6/112 (5%)

Query: 318 QMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASA 377
           ++FG D V+V+    +     G ++++ +     I  L+GH G+I  +  ++  + +AS 
Sbjct: 143 KVFGPDKVYVNAGTVM-----GGVIIWDLFSETKIHNLLGHEGSIFYVNLSNNGRYVASC 197

Query: 378 ADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND-MLISASMDGSVKLWD 428
           +DD +IR+W    G  +   + HT  I +L + +ND  LIS S D + ++W+
Sbjct: 198 SDDRSIRLWDLETGKQLSVGWSHTARIWNLMFFDNDSKLISVSEDCTCRVWN 249

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 74/158 (46%), Gaps = 25/158 (15%)

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW-------HGGNGNSIH 395
           ++ +S ++ +G L GHR T++   F  +T+LLASA  D +++VW         GN N   
Sbjct: 307 LWDISTTQCLGVLSGHRATVNTTRFIDDTRLLASAGKDASVKVWDVDNIVDKDGNANDNL 366

Query: 396 C---FYGHTQTIVSLKWVNNDMLISASMDGSVKLWD--CGKKLQEITGNLIAETIVDGV- 449
           C   F GH  ++ +L    N  ++S S D +++ WD   GK +Q I   +  + +   V 
Sbjct: 367 CLATFDGHKDSVTALATTGN-AIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKMVPQSVS 425

Query: 450 ----------PIFAGAISDDRERYAAGFMDGQVTVFNL 477
                     P+  GA   D      G  DG V +++L
Sbjct: 426 KLDITPSFNTPLIGGADCIDNA-LVTGTKDGIVYLWDL 462

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 3/80 (3%)

Query: 352 IGK-LVGHRGTISQLEFNSETKLLASAAD-DNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
           +GK L  H   I+ L  N++  +L+S A+ DN I++W       +    GH  T+ + ++
Sbjct: 272 LGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTTRF 331

Query: 410 VNND-MLISASMDGSVKLWD 428
           +++  +L SA  D SVK+WD
Sbjct: 332 IDDTRLLASAGKDASVKVWD 351

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 374 LASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
           L +   D  + +W    G  +    GH   I SLK++ ++ LI+ SMD S ++WD
Sbjct: 448 LVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGSE-LITGSMDKSTRIWD 501

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 56/99 (56%), Gaps = 2/99 (2%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           G ++V+ +     + +L GH G+I     + + +L+AS +DD +IRVW    G  +   +
Sbjct: 161 GGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGIAW 220

Query: 399 GHTQTIVSLKWVN-NDMLISASMDGSVKLWDCG-KKLQE 435
           GHT  I  L+++   D L+S S D + ++W  G +++QE
Sbjct: 221 GHTARIWDLRFLRVADKLVSVSEDCTCRVWAVGAERMQE 259

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 53/89 (59%), Gaps = 1/89 (1%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH 400
           ++V+ +   + I  L GH G+I  +  ++  KLLAS +DD +I +W   +G  +   +GH
Sbjct: 163 IIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRAWGH 222

Query: 401 TQTIVSLKWVNND-MLISASMDGSVKLWD 428
           T  I +LK+ N+D  LIS S D + ++W+
Sbjct: 223 TARIWNLKFFNDDTQLISVSEDCTCRVWN 251

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 28/51 (54%)

Query: 340 NLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGN 390
           +++++ M   + + +  GH   I  L+F ++   L S ++D T RVW+  N
Sbjct: 204 SIIIWDMVSGKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKN 254

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 28/61 (45%), Gaps = 3/61 (4%)

Query: 381 NTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN-DMLISASMDGSVKLWD--CGKKLQEIT 437
           N I VW   +   IH   GH  +I  +   NN  +L S S D S+ +WD   GK L    
Sbjct: 161 NGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRAW 220

Query: 438 G 438
           G
Sbjct: 221 G 221

>Scas_695.15
          Length = 327

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 105/239 (43%), Gaps = 34/239 (14%)

Query: 278 FISTDADNITILWDVNSGVV---LQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVI 334
            +S   D+    W+  +GV    +QH +S+                 V+ + +  DK ++
Sbjct: 25  LVSAGYDHTIRFWEALTGVCSRTIQHSDSQ-----------------VNRLEITNDKKLL 67

Query: 335 PGPG-GNLLVYTMSDSRP--IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNG 391
              G  N+ +Y +  + P  +    GH+G ++ + F  + K + ++++D TI+VW     
Sbjct: 68  AAAGYQNVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVW-DVRS 126

Query: 392 NSIHCFYGHTQTIVSLK-WVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVP 450
            S+   Y H   +  +    N   LIS   DG++K+WD G+   + T  LI +   D   
Sbjct: 127 PSVPRNYKHNAPVNEVVIHPNQGELISCDRDGTIKIWDLGE--NQCTHQLIPDD--DNTS 182

Query: 451 IFAGAISDDRERYAAGFMDGQVTVFNL-----AALLKRYSKGKKHKNHVMSIPICGDFQ 504
           + + +++ D     A    G   V+ +     A+ LK  +K   HK+++  + +  D +
Sbjct: 183 LQSLSVASDGSMLVAANNKGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVK 241

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 99/239 (41%), Gaps = 28/239 (11%)

Query: 205 IHELR--HPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFH 262
           ++++R  +P A +   G   N +T +S+  D   + T  E+G +++W+           H
Sbjct: 77  LYDIRTTNPNAVATFEGHKGN-VTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKH 135

Query: 263 KSPI--IAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMF 320
            +P+  + IH N      IS D D    +WD+                         Q  
Sbjct: 136 NAPVNEVVIHPNQG--ELISCDRDGTIKIWDLGENQCTHQL-------IPDDDNTSLQSL 186

Query: 321 GVDTVWVDTDKFVIPGPGGNLLVYTM------SDSRPIGKLVGHRGTISQLEFNSETKLL 374
            V +   D    V     G+  V+ M      S+ +PI K   H+  I+++  +S+ K +
Sbjct: 187 SVAS---DGSMLVAANNKGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHM 243

Query: 375 ASAADDNTIRVWHGG----NGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
           A+ + D T ++W  G    + N      GH + +    +  ++  L++AS D  V+LWD
Sbjct: 244 ATCSADRTAKIWSVGETEDDFNLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 302

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 88/203 (43%), Gaps = 24/203 (11%)

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFIST 281
           + L  L+++ DG  I T  E+G++++W+   G     F  H S + ++ +  +     S+
Sbjct: 357 DALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQIMFSS 416

Query: 282 DADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGN- 340
             D     WD+   +  ++F +                   D     T + V  G   N 
Sbjct: 417 SLDGTVKAWDL---MRFRNFRT-----FTATERIQFSCLAADP----TGEVVCAGSLDNY 464

Query: 341 -LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYG 399
            + V+++   + +  L GH G +S L F+ E  +LASA+ D TIRVW           +G
Sbjct: 465 DIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILASASWDKTIRVW---------SIFG 515

Query: 400 HTQTIVSLKWVNNDMLISASMDG 422
            +Q +  ++  ++ + IS   DG
Sbjct: 516 RSQQVEPIEAYSDVLDISMRPDG 538

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 51/91 (56%), Gaps = 1/91 (1%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           G LLVY       I K  GH   ++ L ++ +   + +AA+D  I++W   +G  +  F 
Sbjct: 336 GQLLVYEWQSESYILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFE 395

Query: 399 GHTQTIVSLKWVNN-DMLISASMDGSVKLWD 428
            HT ++ S+++  N  ++ S+S+DG+VK WD
Sbjct: 396 EHTSSVTSVQFAKNGQIMFSSSLDGTVKAWD 426

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 60/287 (20%), Positives = 122/287 (42%), Gaps = 42/287 (14%)

Query: 167 WNPVSSNILA-IGEHDSTAKLIELE-------TTTTDDQIKLIEKTIHELRHPFATSATT 218
           W+ VS   LA   EH S+   ++         +++ D  +K  +  +   R+ F T   T
Sbjct: 383 WDIVSGFCLATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWD--LMRFRN-FRTFTAT 439

Query: 219 GKITNQLTCLSWAHDGDSIATG-VENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNT 276
            +I  Q +CL+    G+ +  G ++N ++++W+ + G+L +  + H+ P+  + ++  N+
Sbjct: 440 ERI--QFSCLAADPTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENS 497

Query: 277 HFISTDADNITILWDV-NSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIP 335
              S   D    +W +      ++  E+ +                  ++  D  +  + 
Sbjct: 498 ILASASWDKTIRVWSIFGRSQQVEPIEAYSDVLDI-------------SMRPDGKQVAVS 544

Query: 336 GPGGNLLVYTMSDSRPIGKLVGHRGTIS--QLEFNSETKLLASAADDNTIR-------VW 386
              G L  + +  SR +G +   R  IS   LE    +K  A +    TI        + 
Sbjct: 545 TLNGQLSFFDVETSRQVGNIDCKRDIISGRHLEDRFTSKNSARSKYFTTIHYSFDGLSIV 604

Query: 387 HGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMD--GSVKLWDCG 430
            GGN NSI C Y     ++  ++ V+ +M ++ +M+   S K+ + G
Sbjct: 605 AGGNNNSI-CLYDIPNEVLIKRFIVSRNMTLNGTMEFLNSSKMTEAG 650

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/232 (20%), Positives = 93/232 (40%), Gaps = 31/232 (13%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKEG-------------KLQNVFNF-HKSPIIAIH 270
           +TCL ++ D    A G ++  ++LW+ +G             K+ N     H   + +  
Sbjct: 424 MTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTS 483

Query: 271 WNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTD 330
           ++  N + +S   D    LW +++   L  ++                 F         D
Sbjct: 484 FSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFAT----ASHD 539

Query: 331 KFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGN 390
           +           +++     P+    GH   +  + F+     + + + D T R+W  G 
Sbjct: 540 Q--------TARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGT 591

Query: 391 GNSIHCFYGHTQTIVSLKWVNND--MLISASMDGSVKLWD--CGKKLQEITG 438
           G+S+  F GHT  ++S   V+ D   L + S DG + +WD   GK+L+++ G
Sbjct: 592 GDSVRLFLGHTAPVISTA-VSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRG 642

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 65/143 (45%), Gaps = 9/143 (6%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDML 415
           GH   +  + F+      A+A+ D T R+W   +   +  F GH   +  + +  N   +
Sbjct: 516 GHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYV 575

Query: 416 ISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVF 475
            + S D + ++WD G      TG+ +   +    P+ + A+S D    + G  DG + V+
Sbjct: 576 FTGSTDKTCRMWDIG------TGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVW 629

Query: 476 NLAALLKRYSKGKKH-KNHVMSI 497
           ++    KR  + + H KN V S+
Sbjct: 630 DIGT-GKRLKQMRGHGKNAVYSL 651

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 55/278 (19%), Positives = 108/278 (38%), Gaps = 27/278 (9%)

Query: 163 VCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKIT 222
            CL+++   + + A G  DS  KL  L+ T  D ++        + R     +   G  +
Sbjct: 425 TCLEFSD-DATLAAAGFQDSYIKLWSLDGTPLDSKLP------SKQREKINNTTLIGH-S 476

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNV-FNFHKSPIIAIHWNSSNTHFIST 281
             +   S++ D   + +  E+  +RLW+ +     V +  H  P+  + ++    +F + 
Sbjct: 477 GTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATA 536

Query: 282 DADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTD-KFVIPGPGGN 340
             D    LW  +    L+ F                 +  VD V    +  +V  G    
Sbjct: 537 SHDQTARLWSCDHIYPLRIFAG--------------HLNDVDCVSFHPNGTYVFTGSTDK 582

Query: 341 LL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYG 399
              ++ +     +   +GH   +     + + + L++ ++D  I VW  G G  +    G
Sbjct: 583 TCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRG 642

Query: 400 HTQTIV-SLKWVN-NDMLISASMDGSVKLWDCGKKLQE 435
           H +  V SL +     +L+S   D SV++WD  +   E
Sbjct: 643 HGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLKRSTAE 680

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 30/148 (20%), Positives = 66/148 (44%), Gaps = 29/148 (19%)

Query: 147 EVFAKTLNEIFKLGKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIH 206
            +FA  LN++       C+ ++P  + +   G  D T ++ ++    T D ++L      
Sbjct: 554 RIFAGHLNDV------DCVSFHPNGTYVFT-GSTDKTCRMWDI---GTGDSVRLF----- 598

Query: 207 ELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWN--KEGKLQNVFNFHKS 264
            L H           T  +   + + DG  ++TG E+G + +W+     +L+ +    K+
Sbjct: 599 -LGH-----------TAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKN 646

Query: 265 PIIAIHWNSSNTHFISTDADNITILWDV 292
            + ++ ++   T  +S  AD+   +WD+
Sbjct: 647 AVYSLSYSKEGTVLVSGGADHSVRVWDL 674

>Kwal_47.17555
          Length = 417

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 1/110 (0%)

Query: 322 VDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDN 381
           +D    D D     G  G ++    S +     L GH   I+ ++F    ++L S + D 
Sbjct: 111 IDQYESDGDYLYATGDQGGIISIYDSQAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADM 170

Query: 382 TIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDM-LISASMDGSVKLWDCG 430
            ++VW   +G++     GHT T+ +L  ++    ++S+S DGS+KLW+CG
Sbjct: 171 QLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKLWECG 220

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 8/90 (8%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH 400
           L V++  D      L GH  T++ L      + + S++ D ++++W  G+G +IH F   
Sbjct: 172 LKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKLWECGSGETIHSFARK 231

Query: 401 TQTIVSLKWVNNDMLI----SASMDGSVKL 426
           T     +    NDMLI     +S DGS  L
Sbjct: 232 TDQSDPV----NDMLILCSPGSSEDGSRHL 257

>Scas_631.17
          Length = 474

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 59/273 (21%), Positives = 116/273 (42%), Gaps = 36/273 (13%)

Query: 160 GKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTG 219
           GK   L WN  ++++++ G  D   K+      + D  +K+I++         A    TG
Sbjct: 230 GKIGGLAWNSTNTHLVS-GADDCLVKI-----HSFDPDVKIIKELT-------ALQGHTG 276

Query: 220 KITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFN-FHKSPIIAIHWNSSNTHF 278
           ++ N    + +   G  +A+   +   RLW+ E + +  F   H   + ++ + +     
Sbjct: 277 RVVN----VDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALL 332

Query: 279 ISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPG 338
            S   DN  I+WDV +G  + + +  A             ++ VD  W      +  G G
Sbjct: 333 CSGGLDNAAIVWDVRTGKSIMNLQGHA-----------KPIYSVD--WSPDGYHIATGGG 379

Query: 339 -GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSET-KLLASAADDNTIRVWHGGNGNSIHC 396
            G + ++ +  +    +L+ H   ++ + F   T   L S   D  IR++   N   +  
Sbjct: 380 DGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKT 439

Query: 397 FYGHTQTIVSLKWVNND--MLISASMDGSVKLW 427
             GHT  I+ +  ++ D  +++S+  D S+KLW
Sbjct: 440 LEGHTDKILDVD-ISEDAQLIVSSGWDRSLKLW 471

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 84/216 (38%), Gaps = 14/216 (6%)

Query: 238 ATGVENGELRLWNKE--GKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295
           ATG   G++++ + +    +  + N H   I  + WNS+NTH +S   D +         
Sbjct: 202 ATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCL--------- 252

Query: 296 VVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGP-GGNLLVYTMSDSRPIGK 354
           V +  F+                   V+  +  + +FV          ++ +     +  
Sbjct: 253 VKIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQF 312

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDM 414
             GH   +  L F ++  LL S   DN   VW    G SI    GH + I S+ W  +  
Sbjct: 313 QEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGY 372

Query: 415 LI-SASMDGSVKLWDCGKKLQEITGNLIAETIVDGV 449
            I +   DG + +WD  +K  E T  L    IV GV
Sbjct: 373 HIATGGGDGVINIWDI-RKTTETTRLLAHNNIVTGV 407

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 63/131 (48%), Gaps = 11/131 (8%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
           + +  L GH G +  ++F+   + +ASA+ D T R+W   +   +    GH + + SL +
Sbjct: 266 KELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSF 325

Query: 410 VNND-MLISASMDGSVKLWDC--GKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAG 466
            N+  +L S  +D +  +WD   GK +  + G+          PI++   S D    A G
Sbjct: 326 QNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGH--------AKPIYSVDWSPDGYHIATG 377

Query: 467 FMDGQVTVFNL 477
             DG + ++++
Sbjct: 378 GGDGVINIWDI 388

>Scas_630.6
          Length = 621

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 58/275 (21%), Positives = 107/275 (38%), Gaps = 36/275 (13%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDA 283
           +  + ++ DG+ +ATG E+  +R+WN KE K+  V   H+  I ++ +       +S   
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSG 403

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDT------VWVDTDKFVIPGP 337
           D    +WD+ +G        +             ++    +      +W  +  F     
Sbjct: 404 DRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGF----- 458

Query: 338 GGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW-----HGGNGN 392
               LV  +      G   GH+ ++  + F  + + + S + D T+++W       G G 
Sbjct: 459 ----LVERLDSDNESGN--GHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGK 512

Query: 393 SIHCFYGHTQTIVSLKWVNNDMLI-SASMDGSVKLWD----------CGKKLQEITGNLI 441
               + GH   ++S+   N+D  I S S D  V +WD           G +   I+   +
Sbjct: 513 CEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRKSVISVATV 572

Query: 442 AETIVDG--VPIFAGAISDDRERYAAGFMDGQVTV 474
              + DG    +FA    D + R    F  G+VT 
Sbjct: 573 NSNVDDGKNYKLFATGSGDCKARIWKYFKMGEVTA 607

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 73/151 (48%), Gaps = 15/151 (9%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWV-NNDMLISASM 420
           I  + F+ + + LA+ A+D  IR+W+      +    GH Q I SL +  +   L+S S 
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSG 403

Query: 421 DGSVKLWDCGKKLQEITGNL-IAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAA 479
           D S+++WD        TG   +  +I DGV   A + ++ +   AAG +D  V +++ + 
Sbjct: 404 DRSIRIWDLK------TGQCSLTLSIEDGVTTVAVSPNEGK-LIAAGSLDRSVRIWDSST 456

Query: 480 --LLKRY----SKGKKHKNHVMSIPICGDFQ 504
             L++R       G  H++ V S+    D Q
Sbjct: 457 GFLVERLDSDNESGNGHQDSVYSVAFTKDGQ 487

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 84/196 (42%), Gaps = 26/196 (13%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGN-SIHCFYG 399
           + ++ + + + +  L GH   I  L++  + + L S + D +IR+W    G  S+     
Sbjct: 365 IRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIE 424

Query: 400 HTQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGV-------PIF 452
              T V++      ++ + S+D SV++WD        TG L+     D          ++
Sbjct: 425 DGVTTVAVSPNEGKLIAAGSLDRSVRIWDSS------TGFLVERLDSDNESGNGHQDSVY 478

Query: 453 AGAISDDRERYAAGFMDGQVTVFNLAALLKRYSKGK----KHKNHVMSIPICGDFQSAHS 508
           + A + D +   +G +D  V ++NL        K +     HK+ V+S+        A S
Sbjct: 479 SVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSV--------ATS 530

Query: 509 DDSVFDLSWKEDRLAI 524
           +D  +  S  +DR  I
Sbjct: 531 NDDKYIFSGSKDRGVI 546

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 41/229 (17%), Positives = 97/229 (42%), Gaps = 24/229 (10%)

Query: 228 LSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDA-DN 285
           L +  DG  + +G  +  +R+W+ K G+     +     +  +  + +    I+  + D 
Sbjct: 389 LDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDG-VTTVAVSPNEGKLIAAGSLDR 447

Query: 286 ITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGP-GGNLLVY 344
              +WD ++G +++  +S                F  D       + V+ G     + ++
Sbjct: 448 SVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKD------GQHVVSGSLDRTVKLW 501

Query: 345 TMSDSRP-IGKL----VGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYG 399
            + D++   GK     +GH+  +  +  +++ K + S + D  + +W   +GN I    G
Sbjct: 502 NLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQG 561

Query: 400 HTQTIVSLKWVNND--------MLISASMDGSVKLWDCGKKLQEITGNL 440
           H ++++S+  VN++        +  + S D   ++W    K+ E+T  +
Sbjct: 562 HRKSVISVATVNSNVDDGKNYKLFATGSGDCKARIWKYF-KMGEVTAKI 609

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 83/196 (42%), Gaps = 20/196 (10%)

Query: 228 LSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNI 286
           L+++ DG  + T  E+G++++W+   G     F  H S + A+ +        S+  D  
Sbjct: 351 LAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGT 410

Query: 287 TILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTM 346
              WD+   +  ++F +                 G        D F       ++ V+++
Sbjct: 411 VRAWDL---IRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNF-------DIHVWSV 460

Query: 347 SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVS 406
              + +  L GH G +S L F+ E  +LASA+ D TIR+W           +G +Q +  
Sbjct: 461 QTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIW---------SIFGRSQQVEP 511

Query: 407 LKWVNNDMLISASMDG 422
           ++  ++ + +S   DG
Sbjct: 512 IEVYSDVLALSMRPDG 527

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           G LLVY       I K  GH  + + L ++ +   + +A++D  I+VW   +G  +  F 
Sbjct: 325 GQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFE 384

Query: 399 GHTQTIVSLKWVNN-DMLISASMDGSVKLWD 428
            HT ++ ++++     ++ S+S+DG+V+ WD
Sbjct: 385 EHTSSVTAVQFAKRGQVMFSSSLDGTVRAWD 415

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 64/331 (19%), Positives = 123/331 (37%), Gaps = 60/331 (18%)

Query: 160 GKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTG 219
            K  C+ ++P ++ +LA+G      +L +L   T   Q+ + +                 
Sbjct: 261 AKVKCVTFHP-ATRLLAVGFTSGEFRLYDLPDFTLIQQLSMGQ----------------- 302

Query: 220 KITNQLTCLSWAHDGDSIATGVEN-GELRL--WNKEG---KLQNVFNFHKSPIIAIHWNS 273
              N +  +S    G+ +A G    G+L +  W  E    K Q  F+   S    + ++ 
Sbjct: 303 ---NPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNS----LAYSP 355

Query: 274 SNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFV 333
             +  ++   D    +WD+ SG  L  FE               Q+    ++        
Sbjct: 356 DGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSL-------- 407

Query: 334 IPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFN------SETKLLASAADDNTIRVWH 387
                G +  + +   R      G      +++FN      S   + A + D+  I VW 
Sbjct: 408 ----DGTVRAWDLIRYRNFRTFTG----TERIQFNCLAVDPSGEVVCAGSLDNFDIHVWS 459

Query: 388 GGNGNSIHCFYGHTQTIVSLKWVN-NDMLISASMDGSVKLWDCGKKLQEITGNLIAETIV 446
              G  +    GH   +  L +   N +L SAS D ++++W    + Q++      E I 
Sbjct: 460 VQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQV------EPIE 513

Query: 447 DGVPIFAGAISDDRERYAAGFMDGQVTVFNL 477
               + A ++  D +  A   + GQ+++FN+
Sbjct: 514 VYSDVLALSMRPDGKEVAVSTLKGQISIFNI 544

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 71/184 (38%), Gaps = 27/184 (14%)

Query: 262 HKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFG 321
           H+  I AI  N   T  IS D D   IL +  +  VL HF  K               F 
Sbjct: 54  HRKNIAAIDLNKQGTLLISIDEDGRAILVNFKARNVLHHFNFKEKCSAVK--------FS 105

Query: 322 VDTVWVDTDKFVIPGPGGNLLVYTMSD---SRPIGKLVGHR------GTISQLEFNSETK 372
            D       +      G  L ++   D    R     V HR        I+ L ++ +++
Sbjct: 106 PD------GRLFALASGRFLQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSR 159

Query: 373 LLASAADDNTIRVWHGGNGN---SIHCFYGHTQTIVSLKWVNN-DMLISASMDGSVKLWD 428
            + + + D + ++W   +     +   F GH   ++   + ++ + + + S DG+V +W+
Sbjct: 160 FILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWE 219

Query: 429 CGKK 432
             K+
Sbjct: 220 FTKR 223

>Kwal_23.5351
          Length = 474

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 84/209 (40%), Gaps = 25/209 (11%)

Query: 233 DGDSIATGVENGELRLWNKEG--KLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILW 290
           DG S+A G  NG++++ + +    ++++   H   I  + W+S +    +  ADN+  +W
Sbjct: 193 DGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIW 252

Query: 291 DVN-------SGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLV 343
           +         S VVL+  E++                  D  W                +
Sbjct: 253 NPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTW---------------RL 297

Query: 344 YTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQT 403
           + +     +    GH   +  L+F  +  LL SA  D+   VW    G S+    GH + 
Sbjct: 298 WDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKP 357

Query: 404 IVSLKWV-NNDMLISASMDGSVKLWDCGK 431
           I  + W  N   + + S DG+V++WD  K
Sbjct: 358 IYGVSWSPNGHHVATGSGDGTVQVWDIRK 386

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 96/249 (38%), Gaps = 37/249 (14%)

Query: 219 GKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQN-----VFNFHKSPIIAIHWNS 273
           G   +++  ++W+ D   +ATG  +  +++WN + +  +     V   H++ +  + ++ 
Sbjct: 222 GAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHP 281

Query: 274 SNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMF---GVDTV----- 325
           S+    S   D    LWDV     LQ  E  A             +    G+D+V     
Sbjct: 282 SDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWD 341

Query: 326 ---------------------WVDTDKFVIPGPG-GNLLVYTMSDSRPIGKLVGHRGTIS 363
                                W      V  G G G + V+ +  +     ++ H   +S
Sbjct: 342 MRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVS 401

Query: 364 QLEFNSET-KLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDM-LISASMD 421
           ++ F  E    L S++ D TI V+  G+   +    GHT  I+S+        L S+  D
Sbjct: 402 EVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWD 461

Query: 422 GSVKLWDCG 430
            SVK+W  G
Sbjct: 462 RSVKIWALG 470

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 80/199 (40%), Gaps = 20/199 (10%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDA 283
           L  L ++ DG  I T    G++++W+   G     F+ H   + A+ +        S   
Sbjct: 344 LNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQVLFSASL 403

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLV 343
           D     WD+   +  ++F +                 G        D F       ++ V
Sbjct: 404 DGTVKAWDL---IRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSEDSF-------DIFV 453

Query: 344 YTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQT 403
           +++   + +  L GH G IS L F++E  +LASA+ D TIRVW           +G +Q 
Sbjct: 454 WSVQTGQLVDTLSGHEGPISCLSFSNENGVLASASWDKTIRVW---------SLFGRSQQ 504

Query: 404 IVSLKWVNNDMLISASMDG 422
           +   +  ++ + IS   DG
Sbjct: 505 VEPFEVFSDVLSISMKPDG 523

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           G L+VY       I K  GH  T++ L ++ +   + +A+ +  I++W   +G  +  F 
Sbjct: 321 GQLIVYEWQSESYILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFD 380

Query: 399 GHTQTIVSLKWVNN-DMLISASMDGSVKLWD 428
            H   + ++++     +L SAS+DG+VK WD
Sbjct: 381 EHAGGVSAVEFAKKGQVLFSASLDGTVKAWD 411

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 47/239 (19%), Positives = 92/239 (38%), Gaps = 30/239 (12%)

Query: 208 LRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNF-HKSPI 266
           ++  F  S   G +  Q   L ++ DG  + + V N  + +++        F + H+  +
Sbjct: 1   MKSDFKFSNLLGTVYRQGNVL-FSQDGSKLLSPVGN-RVSVFDLINNTAFTFEYEHRKNV 58

Query: 267 IAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVW 326
             +  N   T  +S D D   IL +  +  VL HF  K                  D  +
Sbjct: 59  AVVDINKQGTLLLSIDVDGRGILANFKTRNVLHHFNFKEKV--------------YDLKF 104

Query: 327 VDTDKFVIPGPGGNLLVYTMSDS---RPIGKLV------GHRGTISQLEFNSETKLLASA 377
               K      G  L ++   ++   R     V      GH   I+ L ++ +++ + S 
Sbjct: 105 SPDGKLFALACGRFLQIWRTPETTEDRQFAPFVRYRIHAGHFSDITSLTWSKDSRFIIST 164

Query: 378 ADDNTIRVWHGGNGN---SIHCFYGHTQTIVSLKWVNN-DMLISASMDGSVKLWDCGKK 432
           + D T R+W   +     +   F GH   ++   + ++ + + + S DG++  W+  KK
Sbjct: 165 SKDLTARIWSVNSEEKNLASTTFAGHRDNVIGAYFSDDQEKIYTVSKDGALFQWEYTKK 223

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/302 (22%), Positives = 119/302 (39%), Gaps = 56/302 (18%)

Query: 213 ATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHW 271
           A SA++  +  +  C S   DG  +ATG E+  +R+W+  + K+  V   H+  I ++ +
Sbjct: 366 ANSASSADLYIRSVCFS--PDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDY 423

Query: 272 NSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVD--T 329
             S    +S   D    +WD+++G        +                GV TV V    
Sbjct: 424 FQSGNKLVSGSGDRTIRIWDLHTGQCSLTLSIED---------------GVTTVAVSPGN 468

Query: 330 DKFVIPG----------PGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAAD 379
             +V  G               LV  +      G  VGH+ ++  + F  + K + S + 
Sbjct: 469 GNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETG--VGHKDSVYSVVFTRDGKNIVSGSL 526

Query: 380 DNTIRVWHGGN-------------GNSIHCFYGHTQTIVSLKWVNNDMLI-SASMDGSVK 425
           D ++++W+  N             GN    + GH   ++S+    ND  I S S D  V 
Sbjct: 527 DRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVI 586

Query: 426 LWD--CGKKLQEITG---NLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAAL 480
            WD   G  L  + G   ++I+  + +G P+ A     +   +A G  D +  ++    +
Sbjct: 587 FWDKVSGVPLLMLQGHRNSVISVAVANGKPLGA-----NYNVFATGSGDCKAKIWKFQTI 641

Query: 481 LK 482
            K
Sbjct: 642 RK 643

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 70/150 (46%), Gaps = 17/150 (11%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN-DMLISASM 420
           I  + F+ + K LA+ A+D  IR+W       +    GH Q I SL +  + + L+S S 
Sbjct: 376 IRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSG 435

Query: 421 DGSVKLWDCGKKLQEITGNL-IAETIVDGVPIFAGAISDDRERY-AAGFMDGQVTVF--N 476
           D ++++WD        TG   +  +I DGV     A+S     Y AAG +D  V V+  N
Sbjct: 436 DRTIRIWDLH------TGQCSLTLSIEDGVTTV--AVSPGNGNYVAAGSLDRTVRVWDSN 487

Query: 477 LAALLKRYSK----GKKHKNHVMSIPICGD 502
              L++R       G  HK+ V S+    D
Sbjct: 488 SGFLVERLDSEGETGVGHKDSVYSVVFTRD 517

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/227 (19%), Positives = 95/227 (41%), Gaps = 17/227 (7%)

Query: 261 FHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMF 320
            H S +  + + S+N  +++T  +  T +++V +G ++                      
Sbjct: 316 LHDSVVCCVKF-SNNGEYLATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADL 374

Query: 321 GVDTVWVDTD-KFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAA 378
            + +V    D KF+  G    L+ ++ ++  + +  L GH   I  L++      L S +
Sbjct: 375 YIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGS 434

Query: 379 DDNTIRVWHGGNGN-SIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEIT 437
            D TIR+W    G  S+        T V++   N + + + S+D +V++WD        +
Sbjct: 435 GDRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSN------S 488

Query: 438 GNLIAETIVDGV-------PIFAGAISDDRERYAAGFMDGQVTVFNL 477
           G L+     +G         +++   + D +   +G +D  V ++NL
Sbjct: 489 GFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNL 535

>Kwal_23.6240
          Length = 913

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 93/226 (41%), Gaps = 34/226 (15%)

Query: 227 CLSWAHDGDSIATGVENGELRLWNK-EGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADN 285
            ++++ DG  + T  E+G++++W+   G     F  H + + A+ +        S   D 
Sbjct: 346 AVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAFAKRGQVLFSASLDG 405

Query: 286 ITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYT 345
               WD+   V  ++F +                 G        D F +        V++
Sbjct: 406 TVRAWDL---VRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVH-------VWS 455

Query: 346 MSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIV 405
           +   + +  L GH G +S L F+ E  +LASA+ D TIR+W           +G +Q + 
Sbjct: 456 VQTGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIW---------SIFGRSQQVE 506

Query: 406 SLKWVNNDML-----------ISASMDGSVKLWDC--GKKLQEITG 438
            L+ V  D+L            +A++DG +  +D   GK++  I G
Sbjct: 507 PLE-VYADVLSLSVRPDGNEVAAATLDGQILFFDVHEGKQVNAIDG 551

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 47/91 (51%), Gaps = 1/91 (1%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           G LLVY       I K  GH    + + ++ +   + +A++D  I++W   +G  +  F 
Sbjct: 321 GQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQ 380

Query: 399 GHTQTIVSLKWVNN-DMLISASMDGSVKLWD 428
            HT  + +L +     +L SAS+DG+V+ WD
Sbjct: 381 EHTAAVSALAFAKRGQVLFSASLDGTVRAWD 411

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 65/180 (36%), Gaps = 27/180 (15%)

Query: 262 HKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFG 321
           H+  +  +  N   T  +S D D   IL +  +  VL HF  K                 
Sbjct: 54  HRKNVQCVALNPQGTLLLSVDEDGRAILVNFRAKTVLHHFNFKEPVS------------- 100

Query: 322 VDTVWVDTDKFVIPGPGGNLLVYTMSD---SRPIGKLVGHR------GTISQLEFNSETK 372
            D  +    K      G  + V+   D    R     V HR        I  L ++ +++
Sbjct: 101 -DLKFSPDGKVFAIACGRFVQVWKTPDVAEDRQFAPFVRHRVHAGHFSNIISLTWSRDSR 159

Query: 373 LLASAADDNTIRVW---HGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
            L S + D T R+W       G +   F GH   ++   +  + + + + S DG+V  W+
Sbjct: 160 FLISTSKDLTARIWSLDSQEKGLASVTFAGHRDYVMGAFFSADQERIYTVSKDGAVFQWE 219

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 62/131 (47%), Gaps = 11/131 (8%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
           R +G LVGH   IS ++++   K + SA+ D T R+W       +    GH + + SL +
Sbjct: 256 RLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSF 315

Query: 410 -VNNDMLISASMDGSVKLWD--CGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAG 466
             +  ++ S  MD    LWD   G K+  + G+          PI+  A S +  + A G
Sbjct: 316 QCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGH--------SKPIYTVAWSPNGYQVATG 367

Query: 467 FMDGQVTVFNL 477
             DG + V+++
Sbjct: 368 GGDGIINVWDI 378

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/279 (20%), Positives = 111/279 (39%), Gaps = 40/279 (14%)

Query: 159 LGKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTI-HELRHPFATSAT 217
           +GK   + W+P S+N +     D   K    + +  +  ++L+   + HE R        
Sbjct: 218 VGKIGAIDWHPDSNNQMISCAEDGLIK--NFQYSNEEGGLRLLGDLVGHERR-------- 267

Query: 218 TGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFN-FHKSPIIAIHWNSSNT 276
                  ++ + +   G  I +   +   RLW+     + +    H   + ++ +    +
Sbjct: 268 -------ISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGS 320

Query: 277 HFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPG 336
              S   D++++LWD+ SG  +      +                + TV    + + +  
Sbjct: 321 LVCSGGMDSLSMLWDIRSGSKVMTLAGHSKP--------------IYTVAWSPNGYQVAT 366

Query: 337 PGGNLLV----YTMSDSRPIGKLVGHRGTISQLEFNSET--KLLASAADDNTIRVWHGGN 390
            GG+ ++        D   + +++ HR  ++Q+ F+ E   K L S   DN I V+    
Sbjct: 367 GGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSSDT 426

Query: 391 GNSIHCFYGHTQTIVSLKWVNND-MLISASMDGSVKLWD 428
              +    GHT  I+SL   NN   L+S   D S+KLW+
Sbjct: 427 WLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN 465

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/249 (22%), Positives = 106/249 (42%), Gaps = 19/249 (7%)

Query: 227 CLSWAHDGDSIATGVENGELRLWN--KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDAD 284
           C  +   G  +  G   G+L+L++      L+N+   H + I ++   S     ++  AD
Sbjct: 429 CCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASAD 488

Query: 285 NITILWD--VNSGVV---LQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGG 339
                WD  V   +V   L  F  K              ++ V       D+F+      
Sbjct: 489 KTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKIS--PEDRFLAVSLLD 546

Query: 340 NLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           N + V+ +   +    L GH+  +  ++ + ++KL+ +++ D  I++W    G+     +
Sbjct: 547 NTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLF 606

Query: 399 GHTQTIVSLKWV-NNDMLISASMDGSVKLW-----DCGKKLQEITGNLIAETI-VDGVPI 451
            H  +I+++K++  +    S S DG+VK W     DC +KL    G + A  +  DG  +
Sbjct: 607 AHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAV 666

Query: 452 FAGAISDDR 460
              ++S DR
Sbjct: 667 V--SVSHDR 673

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 4/91 (4%)

Query: 342 LVYTMSDSRPIGKL---VGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           L+ TM D  P G +          + L+++ ET +LA    D TI++W       +  F+
Sbjct: 55  LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFH 114

Query: 399 GHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
            H+  I  L++      LIS S D ++ LWD
Sbjct: 115 SHSSAITILRFDQTGTRLISGSRDATIILWD 145

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 51/125 (40%), Gaps = 5/125 (4%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           G + ++ M     +     H   I+ L F+     L S + D TI +W       +    
Sbjct: 97  GTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLR 156

Query: 399 GHTQTIVSLKWVNNDMLISASMDGSVKLWD-----CGKKLQEITGNLIAETIVDGVPIFA 453
            H   I  +   N+D LIS S DG +KLWD     C +     TG   +  + D + I A
Sbjct: 157 SHKDAITGIWCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITA 216

Query: 454 GAISD 458
            A S+
Sbjct: 217 NAESE 221

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/208 (19%), Positives = 77/208 (37%), Gaps = 59/208 (28%)

Query: 237 IATGVENGELRLWNKEGK-LQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295
           +A G  +G +++W+ + + +  VF+ H S I  + ++ + T  IS   D   ILWD+ + 
Sbjct: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149

Query: 296 VVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKL 355
             L    S                  +  +W + D ++I                     
Sbjct: 150 TGLCKLRSHKD--------------AITGIWCENDDWLI--------------------- 174

Query: 356 VGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDML 415
                               S + D  I++W       +     HT    SL  V ++M+
Sbjct: 175 --------------------SVSKDGLIKLWDMKVHQCVETHMAHTGECWSLA-VKDNMV 213

Query: 416 ISASMDGSVKLWDCGKKLQEITGNLIAE 443
           I+A+ +  +KLW+    L+   G+++ E
Sbjct: 214 ITANAESEIKLWELD--LERPNGSMLLE 239

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
           I KL GH+G +  L  +S+ + + S + D +IRVW
Sbjct: 644 IQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 354 KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNN 412
           KL GH   ++Q+++N E  LL S + D++  VW+  NG  +    GHT TI S+      
Sbjct: 5   KLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFT 64

Query: 413 DMLISASMDGSVKLWD 428
              ++ S D S+KLWD
Sbjct: 65  KYCVTGSADYSIKLWD 80

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/245 (19%), Positives = 101/245 (41%), Gaps = 44/245 (17%)

Query: 165 LQWNPVSSNILAI----GEHDSTAKLIELET-TTTDDQIKLIEKTIHELRHPFATSATTG 219
           ++++P  +  LAI     ++  +  + E+E  + T +  K+ E+ IH++         T 
Sbjct: 99  VEFSPCGNYFLAILDNVMKNPGSINIYEIERDSATHELTKVSEEPIHKI--------ITH 150

Query: 220 KITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNV--FNFHKSPIIAIHWNSSNTH 277
           +  +  T   W+  G  I  G ++G++  ++     + V   + H+  I  + ++   T+
Sbjct: 151 EGLDAATVAGWSTKGKYIIAGHKDGKISKYDVSNNYEYVDSIDLHEKSISDMQFSPDLTY 210

Query: 278 FISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGP 337
           FI++  D  + L DV++  VL+ +E+                     V     +F+I G 
Sbjct: 211 FITSSRDTNSFLVDVSTLQVLKKYETDCPLNT--------------AVITPLKEFIILGG 256

Query: 338 GGNLLVYTMSDS---------------RPIGKLVGHRGTISQLEFNSETKLLASAADDNT 382
           G      T + +                 IG++ GH G ++ +  + +    AS  +D  
Sbjct: 257 GQEAKDVTTTSANEGKFEARFYHKIFEEEIGRVQGHFGPLNTVAISPQGTSYASGGEDGF 316

Query: 383 IRVWH 387
           IR+ H
Sbjct: 317 IRLHH 321

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 344 YTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSI 394
           Y+++  R +G L GH GTI  ++ +  TK   + + D +I++W   NG  +
Sbjct: 38  YSLNGER-LGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNGQCV 87

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 93/226 (41%), Gaps = 23/226 (10%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWN--KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTD 282
           LTC  +   G  +  G  NGEL+L++      L N    H + I ++   S     ++  
Sbjct: 431 LTC-KFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGS 489

Query: 283 ADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKF-VIPGPGGNL 341
           AD     W      V    ES              Q+F   T+ +D D   V+  P    
Sbjct: 490 ADKTVRFWTFEVSEVPVSDESNKTMPML-------QLFHDTTLELDDDILSVVISPDDKF 542

Query: 342 LVYTMSDS----------RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNG 391
           +  ++ D+          +    L GH+  +  ++ + ++KL+ + + D  I++W    G
Sbjct: 543 IAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFG 602

Query: 392 NSIHCFYGHTQTIVSLKWVNNDM-LISASMDGSVKLWDCGKKLQEI 436
           +     + H  +I+++K++       S S D +VK WD G+K + I
Sbjct: 603 DCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWD-GQKFECI 647

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 37/72 (51%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLI 416
           GH+  I+ L F++    L SA+ D+ I VW     + ++    H   I  L   + + LI
Sbjct: 119 GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLI 178

Query: 417 SASMDGSVKLWD 428
           S S DG VK+WD
Sbjct: 179 STSKDGLVKIWD 190

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 47/109 (43%), Gaps = 13/109 (11%)

Query: 333 VIPGPGGNLLVYTMSDSRPIGKL------------VGHRGTISQLEFNSETKLLASAADD 380
           VI G   N+LV+ +     I +L            +      + L+++ ET LLA+   D
Sbjct: 41  VIVGGLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYAD 100

Query: 381 NTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
             I++W   +   +  F GH   I  L +      LISAS D  + +WD
Sbjct: 101 GVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWD 149

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 211 PFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNV-FNFHKSPIIAI 269
           P A+ A   K   + T L +  + + +A G  +G +++W+   K   + FN HKS I  +
Sbjct: 69  PGASDAKLSK-PAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVL 127

Query: 270 HWNSSNTHFISTDADNITILWDV 292
            ++++ T  IS   D+  I+WD+
Sbjct: 128 AFDTTGTRLISASKDSDIIVWDL 150

>Kwal_34.15818
          Length = 349

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
           RPI  L GH  +++Q++FN E  L+ + A DN   VW+  NG  +  F GH  TI S+  
Sbjct: 2   RPI-LLKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDV 60

Query: 410 VN-NDMLISASMDGSVKLW 427
                  ++ S D S+KLW
Sbjct: 61  DQFTQYAVTGSADFSIKLW 79

 Score = 32.7 bits (73), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 34/175 (19%), Positives = 67/175 (38%), Gaps = 30/175 (17%)

Query: 229 SWAHDGDSIATGVENGELRLW-NKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNIT 287
           +W+ +   I  G ++G +  +    G+  +    H   +  I ++   T+FI++  D+  
Sbjct: 160 AWSFNDTYIVAGHKDGRVSKYEGHSGEYIDSAALHTQNVSDIQFSPDGTYFITSSRDSAA 219

Query: 288 ILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMS 347
            L D  +  VL+ +E+                           +FVI G G +    T +
Sbjct: 220 KLVDTETLEVLKTYETDCPLNS--------------ACITPLKQFVILGGGQDAKDVTTT 265

Query: 348 DSRP---------------IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
            SR                IG++ GH G ++ +  + +    AS  +D  +R+ H
Sbjct: 266 SSREGKFEARFYHKIFQDEIGRVKGHFGPLNYVAVSPQGTSYASGGEDGFVRLHH 320

 Score = 28.9 bits (63), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 344 YTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSI 394
           Y+++  R +G   GH+GTI  ++ +  T+   + + D +I++W   +G ++
Sbjct: 38  YSINGER-LGTFEGHQGTIWSIDVDQFTQYAVTGSADFSIKLWKVQDGTNV 87

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
           RPI  L GH  +++Q+++N E  L+ S A D+   VW+  NG  +  F GH  TI S+  
Sbjct: 2   RPI-MLKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDV 60

Query: 410 VN-NDMLISASMDGSVKLW 427
               +  ++ S D SVKLW
Sbjct: 61  DQFTEYAVTGSADFSVKLW 79

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 42/219 (19%), Positives = 86/219 (39%), Gaps = 23/219 (10%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNK-EGKLQNVFNFHKSPIIAIHWNSSNTHFISTDA 283
           LT + +  +GD I +  ++    +W    G+    F  H   I +I  +    + ++  A
Sbjct: 13  LTQVKYNREGDLIFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTEYAVTGSA 72

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLV 343
           D    LW V  G  +  +++K             ++  V    +D     + G  G++ V
Sbjct: 73  DFSVKLWKVCDGSNVYTWKTKTPVRRVEFSPAGDKILAV----LDG----VMGYAGSVTV 124

Query: 344 YTMS-----------DSRPIGKLVGHR--GTISQLEFNSETKLLASAADDNTIRVWHGGN 390
           Y +            +  P+ +++ H   G  S   +  E K + +   D  +  + G N
Sbjct: 125 YDVVRNTETNEIVNINEEPVFEILTHDDFGIASVASWGFEGKYIVAGHKDGKVSKYDGEN 184

Query: 391 GNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
           G  +     H Q++  +++  +    I++S D + KL D
Sbjct: 185 GEYLDSLELHEQSVSDIQFSPDRTYFITSSRDSASKLVD 223

>Kwal_23.5035
          Length = 744

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 62/133 (46%), Gaps = 7/133 (5%)

Query: 330 DKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHG 388
           D +VI G    ++ VY     + I +L GH G +  L++  +  +L S + D ++RVW+ 
Sbjct: 380 DDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGHD-GILVSGSTDRSVRVWNI 438

Query: 389 GNGNSIHCFYGHTQTIVSLKWVNND---MLISASMDGSVKLWDCGKKLQEITGNLIAETI 445
            +G   H F GHT T+  L  V ++    +++ S D ++ +W       E     + E  
Sbjct: 439 KSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVCEVF 498

Query: 446 --VDGVPIFAGAI 456
              D  P F G +
Sbjct: 499 NTTDANPYFVGVL 511

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/250 (21%), Positives = 97/250 (38%), Gaps = 43/250 (17%)

Query: 219 GKITNQLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTH 277
           G     +TCL +  + D + TG ++  +R+++ K  K     + H   + A+ +      
Sbjct: 367 GHTMKIVTCLQF--EDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGHDGI- 423

Query: 278 FISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGP 337
            +S   D    +W++ SG     F+                   +D V  +  KF++ G 
Sbjct: 424 LVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRC-----------LDIVEHNGKKFIVTGS 472

Query: 338 GGNLL-------------------VYTMSDSRP--IGKLVGHRGTISQLEFNSETKLLAS 376
             + L                   V+  +D+ P  +G L GH   +  +  +    ++ S
Sbjct: 473 RDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLRGHMAAVRTV--SGHGNIVVS 530

Query: 377 AADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWDCGKKLQE 435
            + D  + VW       ++   GHT  I S  +    +  ISA MD +VK+WD    L +
Sbjct: 531 GSYDFNLMVWDIAQMKCLYVLTGHTDRIYSTIYDYQRNRCISAGMDSTVKVWD----LAD 586

Query: 436 ITGNLIAETI 445
           ++ N    TI
Sbjct: 587 VSKNGPCTTI 596

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 100/252 (39%), Gaps = 44/252 (17%)

Query: 216 ATTGKITNQLT-------CLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPII 267
           A T K   QL+        L + HDG  + +G  +  +R+WN K GK  +VF  H S + 
Sbjct: 397 AKTEKFITQLSGHDGGVWALKYGHDG-ILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVR 455

Query: 268 AIHWNSSN-THFISTDADNITI-LW--------DVNSGVVLQHFESKAXXXXXXXXXXXX 317
            +     N   FI T + + T+ +W        D N  V      + A            
Sbjct: 456 CLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLRG-- 513

Query: 318 QMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASA 377
            M  V TV    +  V      NL+V+ ++  + +  L GH   I    ++ +     SA
Sbjct: 514 HMAAVRTVSGHGNIVVSGSYDFNLMVWDIAQMKCLYVLTGHTDRIYSTIYDYQRNRCISA 573

Query: 378 ADDNTIRVWHGGN---------------------GNSIHCFYGHTQTIVSLKWVNNDMLI 416
             D+T++VW   +                     G+SI    GHT  +V L  +++  L+
Sbjct: 574 GMDSTVKVWDLADVSKNGPCTTITSSNNPCTKVTGSSI-TLQGHT-ALVGLLGLSDKFLV 631

Query: 417 SASMDGSVKLWD 428
           SA  DG ++ WD
Sbjct: 632 SAGADGILRGWD 643

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 93/224 (41%), Gaps = 30/224 (13%)

Query: 233 DGDSIATGVENGELRLWNKE-GKLQNVFNFHKSPI--IAIHWNSSNTHFISTDADNITIL 289
           DG  + +G  +  +R+WN E GK  +VF  H S +  + +     + + ++   DN   +
Sbjct: 310 DGKILVSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHV 369

Query: 290 W------DVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGP-GGNLL 342
           W      +++ G     F                 M  V TV     + VI G    NL+
Sbjct: 370 WKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTV-SGHGRIVISGSYDHNLM 428

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH----GGNGN------ 392
           V+ +   + +  L GH   +    ++ +     SA+ D T+ +W       NG       
Sbjct: 429 VWDIISMKLLYILTGHTDRVYSTIYDYKRNRCISASMDTTVMIWDLENIENNGTTTTIND 488

Query: 393 --------SIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
                   S+ C YGHT  +V L  ++N  L+SA+ DGS++ WD
Sbjct: 489 GASIKVVGSMKCLYGHT-ALVGLLCLSNKFLVSAAADGSIRGWD 531

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 59/119 (49%), Gaps = 6/119 (5%)

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQ 402
           VY   +   + +L GH G +  L+F  + K+L S + D ++R+W+   G   H F GHT 
Sbjct: 284 VYDAENDLFLLELNGHEGGVWALKF-VDGKILVSGSTDRSVRIWNIETGKCTHVFKGHTS 342

Query: 403 TIVSLKWV---NNDMLISASMDGSVKLWDCG--KKLQEITGNLIAETIVDGVPIFAGAI 456
           T+  L+ V   ++  +++ S D ++ +W     K+L + +   I     +  P F G +
Sbjct: 343 TVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPYFVGVL 401

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 355 LVGHR-GTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND 413
           L GH    ++ L+F  E   + + ADD  I V+   N   +    GH   + +LK+V+  
Sbjct: 255 LDGHSTNVVTCLQF--ENNYIITGADDKKINVYDAENDLFLLELNGHEGGVWALKFVDGK 312

Query: 414 MLISASMDGSVKLWD 428
           +L+S S D SV++W+
Sbjct: 313 ILVSGSTDRSVRIWN 327

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 71/144 (49%), Gaps = 6/144 (4%)

Query: 321 GVDTVWVDTDKFVIPGPGGNLLVY--TMSDSRPIGKLVGHRGTISQLEFNSETKLLASAA 378
            VDT  +   +F++    G++ V     +  R I +   H   I++L+F    + L S++
Sbjct: 98  AVDTAKLQMRRFILGTTEGDIKVLDSNFNLQREIDQ--AHVSEITKLKFFPSGEALISSS 155

Query: 379 DDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDM-LISASMDGSVKLWDCGKKLQEIT 437
            D  +++W   +G++     GH  T+  +  ++    ++SAS+DG+++LW+CG      T
Sbjct: 156 QDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGTIRLWECGTGTTIHT 215

Query: 438 GNLIAETIVDGVPIFAGAISDDRE 461
            N   E   DGV   A  +  DR+
Sbjct: 216 FNR-KENPHDGVNSIALFVGTDRQ 238

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/82 (19%), Positives = 38/82 (46%), Gaps = 1/82 (1%)

Query: 224 QLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTD 282
           ++T L +   G+++ +  ++ +L++W+ K+G        H++ +  I       + +S  
Sbjct: 138 EITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSAS 197

Query: 283 ADNITILWDVNSGVVLQHFESK 304
            D    LW+  +G  +  F  K
Sbjct: 198 LDGTIRLWECGTGTTIHTFNRK 219

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 70/143 (48%), Gaps = 13/143 (9%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWV-NNDMLISASM 420
           I  + F+ + K LA+ A+D  IR+W       +    GH Q I SL +  + D L+S S 
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSG 617

Query: 421 DGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVF--NLA 478
           D +V++WD   K  + T  L   +I DGV   A +  D +   AAG +D  V V+  +  
Sbjct: 618 DRTVRIWDL--KTGQCTLTL---SIEDGVTTVAVSPGDGK-FIAAGSLDRAVRVWDSDTG 671

Query: 479 ALLKRYSK----GKKHKNHVMSI 497
            L++R       G  HK+ V S+
Sbjct: 672 FLVERLDSENELGTGHKDSVYSV 694

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/275 (21%), Positives = 108/275 (39%), Gaps = 54/275 (19%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDA 283
           +  + ++ DG  +ATG E+  +R+W+ ++ K+  V   H+  I ++ +  S    +S   
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSG 617

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDT--DKFVIPG----- 336
           D    +WD+ +G        +                GV TV V     KF+  G     
Sbjct: 618 DRTVRIWDLKTGQCTLTLSIED---------------GVTTVAVSPGDGKFIAAGSLDRA 662

Query: 337 -----PGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH---- 387
                     LV  +     +G   GH+ ++  + F  +   + S + D ++++W+    
Sbjct: 663 VRVWDSDTGFLVERLDSENELG--TGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNV 720

Query: 388 -----GGNGNSIHC---FYGHTQTIVSLKWVNND-MLISASMDGSVKLWD--CGKKLQEI 436
                 G   S  C   + GH   ++S+    +D  ++S S D  V  WD   G  L  +
Sbjct: 721 NHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLML 780

Query: 437 TG---NLIAETIVDGVP------IFAGAISDDRER 462
            G   ++I+  +  G P      IFA    D + R
Sbjct: 781 QGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKAR 815

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 78/182 (42%), Gaps = 25/182 (13%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGN-SIHCFYGHTQTIVSLKWVNND 413
           L GH   I  L++      L S + D T+R+W    G  ++        T V++   +  
Sbjct: 593 LKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGK 652

Query: 414 MLISASMDGSVKLW--DCGKKLQEI-TGNLIAETIVDGVPIFAGAISDDRERYAAGFMDG 470
            + + S+D +V++W  D G  ++ + + N +     D V  ++   + D     +G +D 
Sbjct: 653 FIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSV--YSVVFTRDGNGVVSGSLDR 710

Query: 471 QVTVFNLAALLKRYSKGKK-----------HKNHVMSIPICGDFQSAHSDDSVFDLSWKE 519
            V ++NL  +    + GK            HK+ V+S+        A ++D  + LS  +
Sbjct: 711 SVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSV--------ATTEDDEYILSGSK 762

Query: 520 DR 521
           DR
Sbjct: 763 DR 764

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 39/228 (17%), Positives = 87/228 (38%), Gaps = 17/228 (7%)

Query: 228 LSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDA-DN 285
           L +   GD + +G  +  +R+W+ K G+     +     +  +  +  +  FI+  + D 
Sbjct: 603 LDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDG-VTTVAVSPGDGKFIAAGSLDR 661

Query: 286 ITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNL--LV 343
              +WD ++G +++  +S+              +F  D   V +          NL  + 
Sbjct: 662 AVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVN 721

Query: 344 YTMSDSRPIG-----KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           +  +D +P          GH+  +  +    + + + S + D  +  W   +GN +    
Sbjct: 722 HNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQ 781

Query: 399 GHTQTIVSLK-------WVNNDMLISASMDGSVKLWDCGKKLQEITGN 439
           GH  +++S+          N  +  + S D   ++W   K   E+  N
Sbjct: 782 GHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIWKYIKTTTEVNSN 829

>Scas_720.83d
          Length = 915

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           G LLVY       I K  GH    + L ++ +   + +AA+D  I+VW   +G  +  F 
Sbjct: 323 GQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQ 382

Query: 399 GHTQTIVSLKWVNN-DMLISASMDGSVKLWD 428
            HT ++  +++     +L S+S+DG+V+ WD
Sbjct: 383 EHTSSVTQVQFAKRGQVLFSSSLDGTVRAWD 413

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 80/196 (40%), Gaps = 20/196 (10%)

Query: 228 LSWAHDGDSIATGVENGELRLWNK-EGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNI 286
           L+++ DG  + T  E+G++++W+   G     F  H S +  + +        S+  D  
Sbjct: 349 LTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDGT 408

Query: 287 TILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTM 346
              WD+   +  ++F +                 G        D F       ++ V+++
Sbjct: 409 VRAWDL---IRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSLDNF-------DIHVWSV 458

Query: 347 SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVS 406
              + +  L GH G +S L F+ E  +LASA+ D T+RVW           +G +Q +  
Sbjct: 459 QTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVW---------SIFGRSQQVEP 509

Query: 407 LKWVNNDMLISASMDG 422
               ++ + ++   DG
Sbjct: 510 FDVYSDVLALTIRPDG 525

 Score = 36.2 bits (82), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 69/184 (37%), Gaps = 27/184 (14%)

Query: 262 HKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFG 321
           H+  I  I  N   T  IS D D   IL +  +  VL HF  K               F 
Sbjct: 54  HRKNIATIDLNKQGTLLISVDEDGRAILTNFKAKTVLHHFNFKEKCYQVK--------FS 105

Query: 322 VDTVWVDTDKFVIPGPGGNLLVYTMSDS---RPIGKLV------GHRGTISQLEFNSETK 372
            D       K      G  L ++   D+   R     V      GH   I  L ++ +++
Sbjct: 106 PD------GKLFALATGRFLQIWKTPDATEDRQFAPFVRYRVHAGHFQDILSLTWSLDSR 159

Query: 373 LLASAADDNTIRVWHGGNGN---SIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
            + S + D T R+W   +     +   F GH   ++   +  + + + + S DG++ +W+
Sbjct: 160 FIISTSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAFFSADQEKIYTVSKDGALFVWE 219

Query: 429 CGKK 432
             KK
Sbjct: 220 FTKK 223

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 55/305 (18%), Positives = 107/305 (35%), Gaps = 73/305 (23%)

Query: 224 QLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSN--THFIS 280
           ++ C+++    + +  G  NGE RL+      L    +  ++PI  +  NSS     F S
Sbjct: 260 KVKCVTFHAPSNMLVVGFTNGEFRLYELPHFTLLQQLSMGQNPINTVAVNSSGEWLAFGS 319

Query: 281 TDADNITIL-WDVNSGVVLQ--HFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGP 337
           +    + +  W   S ++ Q  HF++                    T   D  + V    
Sbjct: 320 SKLGQLLVYEWQSESYILKQQGHFDATNSL----------------TYSPDGSRVVTAAE 363

Query: 338 GGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIR------------- 384
            G + V+ +     +     H  +++Q++F    ++L S++ D T+R             
Sbjct: 364 DGKIKVWDVVSGFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTF 423

Query: 385 -------------------------------VWHGGNGNSIHCFYGHTQTIVSLKWVN-N 412
                                          VW    G  +    GH   +  L +   N
Sbjct: 424 TAAERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQEN 483

Query: 413 DMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQV 472
            +L SAS D +V++W    + Q++      E       + A  I  D ++ A   + GQ+
Sbjct: 484 SVLASASWDKTVRVWSIFGRSQQV------EPFDVYSDVLALTIRPDGKQVAVSTLKGQI 537

Query: 473 TVFNL 477
            + ++
Sbjct: 538 LMIDI 542

>Kwal_23.6429
          Length = 750

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 68/143 (47%), Gaps = 13/143 (9%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWV-NNDMLISASM 420
           I  + F+ + K LA+ A+D  IR+W       +    GH Q I SL +  + D L+S S 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 532

Query: 421 DGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFN--LA 478
           D +V++WD       +T      +I DGV   A +  D +   AAG +D  V +++    
Sbjct: 533 DRTVRIWDLRTGQCSLT-----LSIEDGVTTVAVSPGDGK-LIAAGSLDRTVRIWDSETG 586

Query: 479 ALLKRYSK----GKKHKNHVMSI 497
            L++R       G  HK+ V S+
Sbjct: 587 FLVERLDSENELGTGHKDSVYSV 609

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/224 (17%), Positives = 85/224 (37%), Gaps = 31/224 (13%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDA 283
           +  + ++ DG  +ATG E+  +R+W+    ++      H+  I ++ +  S    +S   
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 532

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDT------VWVDTDKFVIPGP 337
           D    +WD+ +G        +             ++    +      +W     F     
Sbjct: 533 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGF----- 587

Query: 338 GGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH--GGNGNSIH 395
               LV  +     +G   GH+ ++  + F  +   + S + D ++++W+    NG +  
Sbjct: 588 ----LVERLDSENELG--TGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAE 641

Query: 396 ----------CFYGHTQTIVSLKWVNND-MLISASMDGSVKLWD 428
                      + GH   ++S+    ND  ++S S D  V  WD
Sbjct: 642 GKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWD 685

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/313 (20%), Positives = 121/313 (38%), Gaps = 52/313 (16%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDAD 284
           + C+ ++HDG+ +ATG             K   V+      +IA          +S DA 
Sbjct: 403 VCCVRFSHDGEFLATGCN-----------KTTQVYKVSTGELIA---------RLSEDAS 442

Query: 285 NITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLL-V 343
           +        SG         A             ++     +    KF+  G    L+ +
Sbjct: 443 S------APSGADASATSENAKASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRI 496

Query: 344 YTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGN-SIHCFYGHTQ 402
           + ++  R +  L GH   I  L++      L S + D T+R+W    G  S+        
Sbjct: 497 WDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGV 556

Query: 403 TIVSLKWVNNDMLISASMDGSVKLWDC--GKKLQEI-TGNLIAETIVDGVPIFAGAISDD 459
           T V++   +  ++ + S+D +V++WD   G  ++ + + N +     D V  ++   + D
Sbjct: 557 TTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSV--YSVVFTRD 614

Query: 460 RERYAAGFMDGQVTVFNLAALLKRYSKGKK-----------HKNHVMSIPICGDFQSAHS 508
                +G +D  V ++NL +     ++GK            HK+ V+S+        A +
Sbjct: 615 GHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSV--------ATT 666

Query: 509 DDSVFDLSWKEDR 521
            +  F LS  +DR
Sbjct: 667 QNDEFILSGSKDR 679

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/83 (19%), Positives = 34/83 (40%), Gaps = 7/83 (8%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDML- 415
           GH+  +  +      + + S + D  +  W   +GN +    GH  +++S+   N+  L 
Sbjct: 655 GHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLG 714

Query: 416 ------ISASMDGSVKLWDCGKK 432
                  + S D   ++W   K+
Sbjct: 715 PEYGVFATGSGDCKARIWKYSKQ 737

>Scas_680.11
          Length = 347

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
           RPI  L+GH   ++Q+++N E  LL S + DN   VW+  NG  +    GH  TI S+  
Sbjct: 2   RPI-VLMGHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDV 60

Query: 410 VN-NDMLISASMDGSVKLW 427
               +  ++ S D S+K+W
Sbjct: 61  DKFTEYCVTGSADYSIKMW 79

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 87/212 (41%), Gaps = 41/212 (19%)

Query: 194 TDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEG 253
           T++ I+ +E+ IH++      SA             W+ +G  I    + GE+  ++ + 
Sbjct: 133 TNEIIEFVEEPIHKIETQEGLSAAVSA--------DWSTEGKFIIAAHKEGEVSKYDVDN 184

Query: 254 KLQNV--FNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXX 311
            LQ V     HK+ I  + ++   T+FI++  D+   + DV +  VL+ FE         
Sbjct: 185 GLQFVESIKLHKALITDLQFSPDRTYFITSSRDSHAHIVDVETLAVLKDFEIDCP----- 239

Query: 312 XXXXXXQMFGVDTVWVDTDK-FVIPGPGGNLL-VYTMSDS--------------RPIGKL 355
                     ++T  +   K FVI G G +   V T S S                IG++
Sbjct: 240 ----------LNTACITPLKEFVILGGGQDARDVTTTSASEGKFEARFHHKIFEEEIGRV 289

Query: 356 VGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
            GH G ++ +  + +     S  +D  +R+ H
Sbjct: 290 KGHFGPLNCVAVSPQGTSYVSGGEDGLVRLHH 321

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 344 YTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIH 395
           Y+++  R +G L GH GTI  ++ +  T+   + + D +I++W    G +++
Sbjct: 38  YSVNGER-LGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVETGENVY 88

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 88/220 (40%), Gaps = 17/220 (7%)

Query: 212 FATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFN-FHKSPIIAIH 270
           F TS + G    ++T L     G  I T   +   RLW+ E + Q +    H   +  + 
Sbjct: 288 FITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLA 347

Query: 271 WNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVW-VDT 329
           + +      +   D   I+WD+ SG  +   +  A             ++ +D  W +D 
Sbjct: 348 FQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKT-----------IYCMD--WSIDG 394

Query: 330 DKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKL-LASAADDNTIRVWHG 388
                 G  G + ++ +  S  + K+  H+  ++ L+F+      L S+  D +I V+  
Sbjct: 395 HTLATGGGDGVITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIFVYSK 454

Query: 389 GNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLW 427
            N   +    GH   +++     NN  LIS   D SVK W
Sbjct: 455 DNYLKVSSLIGHADKVLTFDIDKNNKNLISGGWDRSVKHW 494

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDML 415
           GH   +  L F ++  L+++A  D T  +W   +G ++    GH +TI  + W ++   L
Sbjct: 338 GHSKELYCLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTL 397

Query: 416 ISASMDGSVKLWDCGK--KLQEIT 437
            +   DG + +WD  K  KL +IT
Sbjct: 398 ATGGGDGVITIWDLRKSDKLTKIT 421

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 83/204 (40%), Gaps = 21/204 (10%)

Query: 228 LSWAHDGDSIATGVENGELRLWNK-EGKL--QNVFNFHKSPIIAIHWNSSNTHFISTDAD 284
           ++W  +   + TG E+  + + N+ +G+    N    H+  I  +  + S     ++  D
Sbjct: 260 IAWTSNDSVLITGGEDHLITVSNRSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFD 319

Query: 285 NITILWDV--NSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLL 342
           +   LWD+     ++LQ   SK               F  D   V T      G     +
Sbjct: 320 STWRLWDIEKQKQLLLQEGHSKELYCL---------AFQADGALVST-----AGTDKTAI 365

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQ 402
           ++ +   + + +L GH  TI  ++++ +   LA+   D  I +W     + +     H  
Sbjct: 366 IWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDLRKSDKLTKITEHKS 425

Query: 403 TIVSLKW--VNNDMLISASMDGSV 424
            + SLK+   N+  LIS+  D S+
Sbjct: 426 IVTSLKFDKANDHNLISSGYDRSI 449

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 5/83 (6%)

Query: 205 IHELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWN--KEGKLQNVFNFH 262
           I +LR   A S   G     + C+ W+ DG ++ATG  +G + +W+  K  KL  +   H
Sbjct: 366 IWDLRSGKAVSQLQGH-AKTIYCMDWSIDGHTLATGGGDGVITIWDLRKSDKLTKITE-H 423

Query: 263 KSPIIAIHWNSSNTH-FISTDAD 284
           KS + ++ ++ +N H  IS+  D
Sbjct: 424 KSIVTSLKFDKANDHNLISSGYD 446

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 42/229 (18%), Positives = 82/229 (35%), Gaps = 35/229 (15%)

Query: 160 GKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTG 219
           G+   LQ +P S   +     DST +L ++E      Q +L+ +  H             
Sbjct: 299 GRITDLQVHP-SGKFIGTSSFDSTWRLWDIEK-----QKQLLLQEGH------------- 339

Query: 220 KITNQLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHF 278
             + +L CL++  DG  ++T   +    +W+ + GK  +    H   I  + W+      
Sbjct: 340 --SKELYCLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTL 397

Query: 279 ISTDADNITILWDVNSGVVLQHF-ESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGP 337
            +   D +  +WD+     L    E K+                           +  G 
Sbjct: 398 ATGGGDGVITIWDLRKSDKLTKITEHKSIVTSLKFDKANDH------------NLISSGY 445

Query: 338 GGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
             ++ VY+  +   +  L+GH   +   + +   K L S   D +++ W
Sbjct: 446 DRSIFVYSKDNYLKVSSLIGHADKVLTFDIDKNNKNLISGGWDRSVKHW 494

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 51/97 (52%), Gaps = 13/97 (13%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH----------GGNGNSIHCFYG 399
           R IG + GH  TIS ++ +    ++A+ + D T+++W+          G N  ++H    
Sbjct: 438 RQIGAMEGHVATISCMQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDA 497

Query: 400 HTQTIVSLKWVNNDMLISASMDGSVKLWD--CGKKLQ 434
           H   + SL +++   L++AS D +++ WD   GK +Q
Sbjct: 498 HLDEVSSL-YIDGANLMTASQDKTIRRWDLYSGKCIQ 533

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/277 (20%), Positives = 106/277 (38%), Gaps = 65/277 (23%)

Query: 163 VCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKIT 222
            CL ++P  S +   G  D   KL +    T   QI  +E  +          AT     
Sbjct: 408 TCLDFDPHFSTLCTAGYMDHIVKLWDY---TKKRQIGAMEGHV----------AT----- 449

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLWN--------KEG---KLQNVFNFHKSPIIAIHW 271
             ++C+    + + +ATG ++  ++LWN        +EG   +  +  + H   + +++ 
Sbjct: 450 --ISCMQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSSLYI 507

Query: 272 NSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDK 331
           + +N   ++   D     WD+ SG  +Q                   +F V+   +   K
Sbjct: 508 DGAN--LMTASQDKTIRRWDLYSGKCIQ-------------------VFDVNFPSLSAYK 546

Query: 332 FVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNG 391
                   + ++    ++  IG +                  LA+   D  IR+W    G
Sbjct: 547 SSFMKSNEDSMILKTVNTPIIGSIQSFDAA------------LATGTKDGLIRLWDMRTG 594

Query: 392 NSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
             +    GH   I SLK+ +   +IS S+DG+++LWD
Sbjct: 595 EVVRVLEGHMDAITSLKF-DATTIISGSLDGTIRLWD 630

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 10/104 (9%)

Query: 374 LASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKKL 433
           LA+   D  +R+W    G  +    GHT  I SLK+ +++ L++ SMD SV++WD     
Sbjct: 518 LATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKF-DSEKLVTGSMDNSVRIWD----- 571

Query: 434 QEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNL 477
             +  + I + I   +P+   ++  D +    G  +G V VFN+
Sbjct: 572 --LRTSSILDVIAYDLPV--SSLDFDGKLITVGANEGGVNVFNM 611

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 12/97 (12%)

Query: 358 HRGTISQLEFNSE-TKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTI--VSLKWVNNDM 414
           H  +I+ L+F++    L +S+  D  ++VW   +G  +    GH  T+  + +   N +M
Sbjct: 334 HGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNM 393

Query: 415 LISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPI 451
           LI+ S D ++KLWD          NL  E  +D  P+
Sbjct: 394 LITGSKDATLKLWDL---------NLSREIYLDHSPL 421

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 55/146 (37%), Gaps = 38/146 (26%)

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIH---------------------- 395
           H+  I+ L F+SE   L S + D  I  W    G  I                       
Sbjct: 439 HKDEITALSFDSEA--LVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNN 496

Query: 396 --CFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD--CGKKLQEITGNLIAETIVDGVPI 451
             C  G    ++      N  L + + DG V+LWD   GK ++ + G+       DG+  
Sbjct: 497 GACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGH------TDGI-- 548

Query: 452 FAGAISDDRERYAAGFMDGQVTVFNL 477
              ++  D E+   G MD  V +++L
Sbjct: 549 --TSLKFDSEKLVTGSMDNSVRIWDL 572

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/141 (20%), Positives = 55/141 (39%), Gaps = 19/141 (13%)

Query: 259 FNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFE-------------SKA 305
           F  HK  I A+ ++S     +S   D     WD+ +G  +Q  +             +++
Sbjct: 436 FELHKDEITALSFDSE--ALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARS 493

Query: 306 XXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQL 365
                        M G    +            G + ++ +   +P+  L GH   I+ L
Sbjct: 494 LNNGACLLGTEAPMIGALQCY--NSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSL 551

Query: 366 EFNSETKLLASAADDNTIRVW 386
           +F+SE   L + + DN++R+W
Sbjct: 552 KFDSEK--LVTGSMDNSVRIW 570

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 8/84 (9%)

Query: 216 ATTGKITNQLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSS 274
            T   +   L C + A     +ATG ++G +RLW+ + GK   +   H   I ++ ++S 
Sbjct: 502 GTEAPMIGALQCYNSA-----LATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSE 556

Query: 275 NTHFISTDADNITILWDVNSGVVL 298
               ++   DN   +WD+ +  +L
Sbjct: 557 K--LVTGSMDNSVRIWDLRTSSIL 578

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/277 (17%), Positives = 101/277 (36%), Gaps = 33/277 (11%)

Query: 183 TAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVE 242
           TA  ++LE     +    I+    +L  P     T       ++CL ++ D    A G +
Sbjct: 427 TALDLKLEIQKVKESRDAIKLDNLQLALPSVCMYTFQNTNKDMSCLDFSDDCRIAAAGFQ 486

Query: 243 NGELRLWNKEG------------------KLQNVFNFHKSPIIAIHWNSSNTHFISTDAD 284
           +  +++W+ +G                          H   + +  ++  N + +S   D
Sbjct: 487 DSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSED 546

Query: 285 NITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVY 344
               LW +++   L  ++                 F         D+           ++
Sbjct: 547 KTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFAT----ASHDQ--------TARLW 594

Query: 345 TMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTI 404
           +     P+    GH   +  + F+     + + + D T R+W    G+S+  F GHT  +
Sbjct: 595 SCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV 654

Query: 405 VSLKWVNNDM-LISASMDGSVKLWD--CGKKLQEITG 438
           +S+    +   L + S DG + +WD   GK+L+++ G
Sbjct: 655 ISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRG 691

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 86/212 (40%), Gaps = 19/212 (8%)

Query: 229 SWAHDGDSIATGVENGELRLWNKEGKLQNV-FNFHKSPIIAIHWNSSNTHFISTDADNIT 287
           S++ D   + +G E+  +RLW+ +     V +  H  P+  + ++    +F +   D   
Sbjct: 532 SFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTA 591

Query: 288 ILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDK-FVIPGPGGNLL-VYT 345
            LW  +    L+ F                 +  VD V    +  +V  G       ++ 
Sbjct: 592 RLWSCDHIYPLRIFAG--------------HLNDVDCVSFHPNGCYVFTGSSDKTCRMWD 637

Query: 346 MSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQ-TI 404
           +S    +   +GH   +  +    + + L++ ++D  I VW  G G  +    GH +  I
Sbjct: 638 VSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAI 697

Query: 405 VSLKWVN-NDMLISASMDGSVKLWDCGKKLQE 435
            SL +    ++LIS   D +V++WD  K   E
Sbjct: 698 YSLSYSKEGNVLISGGADHTVRVWDLKKATTE 729

 Score = 36.2 bits (82), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 76/184 (41%), Gaps = 27/184 (14%)

Query: 142 DHDEEEVFAKTLNEIFKLGKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIK-- 199
           D DE+    KTL  +   G      ++P +  +L+ G  D T +L  ++T T     K  
Sbjct: 511 DKDEDPT-CKTL--VGHSGTVYSTSFSPDNKYLLS-GSEDKTVRLWSMDTHTALVSYKGH 566

Query: 200 ---LIEKTIHELRHPFATSA--TTGKI---------------TNQLTCLSWAHDGDSIAT 239
              + + +   L H FAT++   T ++                N + C+S+  +G  + T
Sbjct: 567 NHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 626

Query: 240 GVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVL 298
           G  +   R+W+   G    +F  H +P+I+I          +   D I  +WD+ +G  L
Sbjct: 627 GSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRL 686

Query: 299 QHFE 302
           +   
Sbjct: 687 KQMR 690

>Scas_719.30
          Length = 940

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/234 (20%), Positives = 92/234 (39%), Gaps = 15/234 (6%)

Query: 240 GVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVL 298
           G  NG + ++N + G L+  +  HK  +  I  +  N   +S   D I   +D N    L
Sbjct: 479 GSSNGGISVFNMQSGILRKKYRLHKKTVTGIALDGMNRKMVSCGLDGIVGFYDFNKSTFL 538

Query: 299 QHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGH 358
              +  A                       +D F +     ++++      R + +  GH
Sbjct: 539 GKLQLDAPITKMVYHR-------------SSDLFALILDDLSIVLIDAVTQRVVRQFWGH 585

Query: 359 RGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISA 418
              I+ L+F+ + + + SA+ D+TIR W    G  I      +         N DML + 
Sbjct: 586 SNRITALDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGIKLESVATDVKFSPNGDMLATT 645

Query: 419 SMDGS-VKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQ 471
            + G+ + +W+   + + I+   I E   + + + +G++S +       F D +
Sbjct: 646 HVIGNGIYIWNNKAQFKAISTRAIDEEEFENLMLPSGSLSGNEAMLTGAFEDSK 699

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/196 (20%), Positives = 76/196 (38%), Gaps = 18/196 (9%)

Query: 237 IATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGV 296
           I +G  +  +++W+ E +       H   +  +  +  +    S   D    +WD+ +  
Sbjct: 427 IVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486

Query: 297 VLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVI----PGPGGNLLVYTMSDSRPI 352
            L+ F                    +    +D    V     PG   ++      +  P 
Sbjct: 487 CLRVFRGHVGQVQKV----------IPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPE 536

Query: 353 GKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN 412
             + G R    ++ + +    L S A DNTI++W   +G  I   +GH + +  +   +N
Sbjct: 537 NGVNGQRELDKKMPYPTH---LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA-ADN 592

Query: 413 DMLISASMDGSVKLWD 428
             +IS S DGS+K+WD
Sbjct: 593 FRIISGSHDGSIKIWD 608

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 3/76 (3%)

Query: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN 411
           I +L GH   +  L F+ +   L + + D TIRVW+   G  I  + GHT +++S+   +
Sbjct: 367 IRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-SH 423

Query: 412 NDMLISASMDGSVKLW 427
             +++S S D +VK+W
Sbjct: 424 KKIIVSGSADKTVKVW 439

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 69/177 (38%), Gaps = 32/177 (18%)

Query: 259 FNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQ 318
           F  H   ++ + +N       +   D    +WD+ +G +++     +             
Sbjct: 330 FKGHMDGVLTLQFNYR--LLFTGSYDTTVAIWDLFTGKLIRRLTGHSD------------ 375

Query: 319 MFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAA 378
             GV T++ D  K +       + V+       I    GH  T S +  +S  K++ S +
Sbjct: 376 --GVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGH--TDSVMSVDSHKKIIVSGS 431

Query: 379 DDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDML-------ISASMDGSVKLWD 428
            D T++VWH     + +   GHT+      WVN   L        S S D ++++WD
Sbjct: 432 ADKTVKVWH-VESRTCYTLKGHTE------WVNCVKLHPKSFSCYSCSDDTTIRMWD 481

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 40/90 (44%), Gaps = 3/90 (3%)

Query: 331 KFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGN 390
           K ++ G     +     +SR    L GH   ++ ++ + ++    S +DD TIR+W    
Sbjct: 425 KIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484

Query: 391 GNSIHCFYGH---TQTIVSLKWVNNDMLIS 417
              +  F GH    Q ++ L  ++   L++
Sbjct: 485 NTCLRVFRGHVGQVQKVIPLTIIDAQNLVT 514

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
           RPI  L+GH  +++Q+++N E  L+ ++  DN   VW+  NG  +    GH  +I S+  
Sbjct: 2   RPI-MLMGHERSLTQVKYNREGDLIFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDV 60

Query: 410 -VNNDMLISASMDGSVKLW 427
             + +  ++ S D SVK+W
Sbjct: 61  DQHTEYAVTGSADFSVKVW 79

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 73/175 (41%), Gaps = 30/175 (17%)

Query: 229 SWAHDGDSIATGVENGELRLWNK-EGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNIT 287
           SW++DG  I  G ++G++  +N   G+   + + HK  +  I ++   T+F++T  D+  
Sbjct: 159 SWSYDGKYIVAGHQDGKISKYNGVTGECLEIKDLHKQRVSDIQFSLDRTYFLTTSRDSYA 218

Query: 288 ILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMS 347
            L DV +  VL+ +E+                           +FVI G G +    T +
Sbjct: 219 NLVDVETFEVLKTYETDCPLNSGCITPLK--------------EFVILGGGQDARDVTTT 264

Query: 348 DSR---------------PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
            +R                IG++  H G ++ +  + +    AS  +D  +R+ H
Sbjct: 265 SAREGKFEAKFYHKLFQVEIGRVDDHFGPVNYIAVSPQGTSYASGGEDGFVRLHH 319

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 63/146 (43%), Gaps = 16/146 (10%)

Query: 344 YTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQT 403
           Y M+  R +G L GH G+I  ++ +  T+   + + D +++VW   +G+  H +   T+T
Sbjct: 38  YAMNGER-LGTLEGHNGSIWSIDVDQHTEYAVTGSADFSVKVWRVRDGSIAHSW--DTRT 94

Query: 404 IVS-----------LKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVD--GVP 450
            V            L  ++N M  + ++       D   ++      L  E +      P
Sbjct: 95  PVRRVEFSPTGDRVLAVLDNVMNYAGAIVVFSVTRDANNQITGFNSGLSCEILTQEGCAP 154

Query: 451 IFAGAISDDRERYAAGFMDGQVTVFN 476
           +   + S D +   AG  DG+++ +N
Sbjct: 155 VLVASWSYDGKYIVAGHQDGKISKYN 180

>Scas_707.22
          Length = 730

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 65/132 (49%), Gaps = 7/132 (5%)

Query: 330 DKFVIPGPGG-NLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHG 388
           D +VI G     L +Y     + + +L GH G +  L+++++  ++ S + D ++R+W  
Sbjct: 366 DDYVITGADDRQLRIYDARSKKFLKELSGHEGGVWALKYDAD-GIIVSGSTDRSVRIWDI 424

Query: 389 GNGNSIHCFYGHTQTIVSLKWV---NNDMLISASMDGSVKLWDCGKKLQEITGNL-IAET 444
             G   H F GHT T+  L+ V   N   +++ S D ++ +W   K+ ++  G L +   
Sbjct: 425 KRGCCTHVFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIKE-EKFDGELPMVYN 483

Query: 445 IVDGVPIFAGAI 456
             +  P F G +
Sbjct: 484 TPEENPYFVGVL 495

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/280 (21%), Positives = 109/280 (38%), Gaps = 73/280 (26%)

Query: 218 TGKITNQLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNT 276
           TG  T+ +TCL +  + D + TG ++ +LR+++ +  K     + H+  + A+ +++   
Sbjct: 352 TGHATSVVTCLQF--EDDYVITGADDRQLRIYDARSKKFLKELSGHEGGVWALKYDADGI 409

Query: 277 HFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDT--------VW-- 326
             +S   D    +WD+  G     F+                M  + T        VW  
Sbjct: 410 -IVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKL 468

Query: 327 VDTDKF-----------------------------VIPGPGG---------NLLVYTMSD 348
           +  +KF                              I G G          NL+V+ ++ 
Sbjct: 469 IKEEKFDGELPMVYNTPEENPYFVGVLRGHMASVRTISGHGNIVISGSYDNNLMVWDIAQ 528

Query: 349 SRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH----GGNGN------------ 392
            + +  L+GH   I    ++ + +   SA+ D+TI+VW       NGN            
Sbjct: 529 MKCLYVLIGHTDRIYSTIYDHKRQRCISASMDSTIKVWDLDNIWNNGNCTIITNSATPCT 588

Query: 393 ----SIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
               S+    GHT  +V L  +++  L+SA+ DGS++ WD
Sbjct: 589 KITGSMLTLQGHT-ALVGLLRLSDKYLVSAAADGSLRGWD 627

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 355 LVGH-RGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND 413
           L GH    ++ L+F  E   + + ADD  +R++   +   +    GH   + +LK+  + 
Sbjct: 351 LTGHATSVVTCLQF--EDDYVITGADDRQLRIYDARSKKFLKELSGHEGGVWALKYDADG 408

Query: 414 MLISASMDGSVKLWDCGK 431
           +++S S D SV++WD  +
Sbjct: 409 IIVSGSTDRSVRIWDIKR 426

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 90/197 (45%), Gaps = 18/197 (9%)

Query: 322 VDTVWVDTDKFVIPGPGGNLLVYTMSD-----SRPIGKLVGHRGTISQLEFNSETKLLAS 376
           V+++  D  + V+   G   ++Y +S        P+  LVGH G I  L  + E+  L S
Sbjct: 58  VNSLTYDAKQCVLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEGNICSLSGDFES--LVS 115

Query: 377 AADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEI 436
           ++ D T +VW   NG       GH+ ++   K +N+  +++AS D +VKLW  G   +  
Sbjct: 116 SSWDKTAKVWT--NGIVKWELKGHSASVWDAKLLNDGSVLTASADTTVKLWKNGTLAK-- 171

Query: 437 TGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNL-AALLKRYSKGKKHKNHVM 495
           T + +   +V  + I      DD + + +   DG + + NL   +L  +   +     V 
Sbjct: 172 TFDKLHSDVVRNICIL-----DDGKHFVSCSNDGTLKLSNLEGGILHEFIGHESFVYAVK 226

Query: 496 SIPICGDFQSAHSDDSV 512
            +P  GD  S   D +V
Sbjct: 227 QLP-SGDIVSCGEDRTV 242

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 45/94 (47%), Gaps = 2/94 (2%)

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLIS 417
           H   +  +    + K   S ++D T+++     G  +H F GH   + ++K + +  ++S
Sbjct: 177 HSDVVRNICILDDGKHFVSCSNDGTLKL-SNLEGGILHEFIGHESFVYAVKQLPSGDIVS 235

Query: 418 ASMDGSVKLWDC-GKKLQEITGNLIAETIVDGVP 450
              D +V++W+  G   Q IT   I+   VD +P
Sbjct: 236 CGEDRTVRIWNMDGTIKQVITLPAISIWTVDVLP 269

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 21/30 (70%)

Query: 399 GHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
           GHTQ + S+  ++   + SAS DG+V++W+
Sbjct: 10  GHTQDVRSVVSLSTTQVASASRDGTVRIWN 39

>Kwal_27.12053
          Length = 755

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN-ND 413
           LVGH GT+    F+ + + L SA++D T+R+W      S+  + GH   I  + +     
Sbjct: 478 LVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGH 537

Query: 414 MLISASMDGSVKLWDC 429
              +AS D + +LW C
Sbjct: 538 YFATASHDQTARLWSC 553

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 5/92 (5%)

Query: 351 PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWV 410
           P+    GH   +  + F+     + + + D T R+W   +G+S+  F GHT  + S   V
Sbjct: 558 PLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTA-V 616

Query: 411 NND--MLISASMDGSVKLWD--CGKKLQEITG 438
           + D   L + S DG + +WD   GK+L+++ G
Sbjct: 617 SPDGRWLSTGSEDGVINVWDIGTGKRLKQMRG 648

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 86/212 (40%), Gaps = 19/212 (8%)

Query: 229 SWAHDGDSIATGVENGELRLWNKEGKLQNV-FNFHKSPIIAIHWNSSNTHFISTDADNIT 287
           S++ D   + +  E+  +RLW+ +     V +  H  PI  + ++    +F +   D   
Sbjct: 489 SFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTA 548

Query: 288 ILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTD-KFVIPGPGGNLL-VYT 345
            LW  +    L+ F                 +  VDTV    +  +V  G       ++ 
Sbjct: 549 RLWSCDHIYPLRIFAG--------------HLNDVDTVSFHPNGTYVFTGSSDKTCRMWD 594

Query: 346 MSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIV 405
           ++    +   +GH   ++    + + + L++ ++D  I VW  G G  +    GH +  V
Sbjct: 595 ITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAV 654

Query: 406 -SLKWVNND-MLISASMDGSVKLWDCGKKLQE 435
            SL +     +LIS   D SV++WD  K   E
Sbjct: 655 YSLSYSKEGHVLISGGADHSVRVWDVKKSTAE 686

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 14/80 (17%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVW-------------HGGNGNSIHCFYGHTQTIVSLK 408
           ++ LEF+ + +L A+   D+ I++W               G   +     GH+ T+ S  
Sbjct: 430 MTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTS 489

Query: 409 W-VNNDMLISASMDGSVKLW 427
           +  +N  L+SAS D +V+LW
Sbjct: 490 FSPDNRYLLSASEDKTVRLW 509

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 222 TNQLTCLSWAHDGDSIATGVENGELRLWN--KEGKLQNVFNFHKSPIIAIHWNSSNTHFI 279
           T  +T  + + DG  ++TG E+G + +W+     +L+ +    K+ + ++ ++      I
Sbjct: 608 TAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLI 667

Query: 280 STDADNITILWDV 292
           S  AD+   +WDV
Sbjct: 668 SGGADHSVRVWDV 680

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 5/93 (5%)

Query: 351 PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWV 410
           P+    GH   +  + F+     + + + D T R+W    G+S+  F GHT  ++S + V
Sbjct: 609 PLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQ-V 667

Query: 411 NNDM--LISASMDGSVKLWD--CGKKLQEITGN 439
           + D   L + S DG + LWD   GK+++++ G+
Sbjct: 668 SPDGRWLATGSEDGVICLWDIGTGKRIKQMRGH 700

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 83/205 (40%), Gaps = 19/205 (9%)

Query: 229 SWAHDGDSIATGVENGELRLWNKEGKLQNV-FNFHKSPIIAIHWNSSNTHFISTDADNIT 287
           S++ D   + +G E+  ++LW+ +     V +  H  P+  + ++    +F S   D   
Sbjct: 540 SFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTA 599

Query: 288 ILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDK-FVIPGPGGNLL-VYT 345
            LW  +    L+ F                    VDTV    +  +V  G       ++ 
Sbjct: 600 RLWACDHIYPLRIFAGHTND--------------VDTVSFHPNGCYVFTGSSDKTCRMWD 645

Query: 346 MSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIV 405
           +S    +   +GH   +   + + + + LA+ ++D  I +W  G G  I    GH +  V
Sbjct: 646 VSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAV 705

Query: 406 SLKWVNND--MLISASMDGSVKLWD 428
                N +  +LIS   D SV++WD
Sbjct: 706 HSLSFNKEGNVLISGGADHSVRVWD 730

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN-ND 413
           LVGH GT+    F+ +   L S ++D T+++W      ++  + GH   +  +K+     
Sbjct: 529 LVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGH 588

Query: 414 MLISASMDGSVKLWDC 429
              SAS D + +LW C
Sbjct: 589 YFASASHDQTARLWAC 604

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 66/143 (46%), Gaps = 9/143 (6%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDML 415
           GH   +  ++F+      ASA+ D T R+W   +   +  F GHT  + ++ +  N   +
Sbjct: 573 GHNHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYV 632

Query: 416 ISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVF 475
            + S D + ++WD        TG+ +   +    P+ +  +S D    A G  DG + ++
Sbjct: 633 FTGSSDKTCRMWDVS------TGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLW 686

Query: 476 NLAALLKRYSKGKKH-KNHVMSI 497
           ++    KR  + + H KN V S+
Sbjct: 687 DIGT-GKRIKQMRGHGKNAVHSL 708

 Score = 36.2 bits (82), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 19/85 (22%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVW------------------HGGNGNSIHCFYGHTQT 403
           ++ LEF+ + +L A+   D+ I++W                       N+     GH+ T
Sbjct: 476 MTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGT 535

Query: 404 IVSLKWVNNDM-LISASMDGSVKLW 427
           + S  +  ++M L+S S D +VKLW
Sbjct: 536 VYSTSFSPDNMYLVSGSEDKTVKLW 560

 Score = 35.8 bits (81), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 45/228 (19%), Positives = 88/228 (38%), Gaps = 35/228 (15%)

Query: 234 GDSIATGVENGELRLWNKEGKLQ-NVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDV 292
           G   A+   +   RLW  +      +F  H + +  + ++ +  +  +  +D    +WDV
Sbjct: 587 GHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDV 646

Query: 293 NSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPI 352
           ++G  ++ F                     D  W+ T         G + ++ +   + I
Sbjct: 647 STGDSVRLF-------LGHTAPVLSTQVSPDGRWLATG-----SEDGVICLWDIGTGKRI 694

Query: 353 GKLVGH-RGTISQLEFNSETKLLASAADDNTIRVWHGGNGNS------IHCFYGHTQTIV 405
            ++ GH +  +  L FN E  +L S   D+++RVW   +G +         F  H     
Sbjct: 695 KQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGD-- 752

Query: 406 SLKWVNNDMLISASMDGSVKLWDCGKKLQEI-TGNLIAETIVDGVPIF 452
                     I+AS++  +K  D G++   I T +L+A       P+F
Sbjct: 753 ----------ITASINQDIK--DYGRRRTIIPTNDLVASFYTKRSPVF 788

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 233 DGDSIATGVENGELRLWN--KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILW 290
           DG  +ATG E+G + LW+     +++ +    K+ + ++ +N      IS  AD+   +W
Sbjct: 670 DGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVW 729

Query: 291 DVNSGVVLQHFE 302
           DV  G   Q  E
Sbjct: 730 DVKHGTTEQGPE 741

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 55/129 (42%), Gaps = 7/129 (5%)

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQ 402
           ++ + D      L  H+  +  + F    KLLA+ + D TI++W   +   +    GHT 
Sbjct: 521 IWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTN 580

Query: 403 TIVSLKWVN-NDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRE 461
            +    ++N N  LIS   DG V +WD        TG  +         I+A A+ +D E
Sbjct: 581 AVQRCSFINKNKQLISTGADGLVIIWDLS------TGESVKTLDAHNNRIWALAVMNDGE 634

Query: 462 RYAAGFMDG 470
            +     DG
Sbjct: 635 SFVTADADG 643

 Score = 35.8 bits (81), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 47/97 (48%), Gaps = 6/97 (6%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH 400
           L VY++   R I + +     +  +  +  + LLA    D ++ V    NG   H   GH
Sbjct: 84  LRVYSLKQERII-RSMKISSPVYVMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGH 142

Query: 401 TQTIVSLKW---VNNDM--LISASMDGSVKLWDCGKK 432
             TI S+K+   +N+++  L S   +G +K+WD  K+
Sbjct: 143 GATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKR 179

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 43/104 (41%), Gaps = 9/104 (8%)

Query: 332 FVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEF----NSETKLLASAADDNTIRVWH 387
             I G  G++ V  + +      L GH  TIS ++F    NSE   LAS   +  I+VW 
Sbjct: 116 LAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWD 175

Query: 388 GGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGK 431
               N       HT  +  L     D  ++    G+++L   G+
Sbjct: 176 LVKRNCQCTIQEHTTAVRGL-----DFRVTDEEKGTLQLLSGGR 214

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND-ML 415
            H   I+ +  +    L A+A+ D T ++W+  +G        H + +  + +   D +L
Sbjct: 493 AHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLL 552

Query: 416 ISASMDGSVKLW 427
            + S D ++K+W
Sbjct: 553 ATCSGDKTIKIW 564

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 237 IATGVENGELRLWNKEG-KLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295
           +AT   +  +++W+ E   +      H + +    + + N   IST AD + I+WD+++G
Sbjct: 552 LATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTG 611

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 68/150 (45%), Gaps = 13/150 (8%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN-NDMLISASM 420
           I  + F+ + K LA+ A+D  IR+W       +    GH Q I SL +    D L+S S 
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 414

Query: 421 DGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFN--LA 478
           D +V++WD       +T      +I DGV   A +  D +   AAG +D  V V++    
Sbjct: 415 DRTVRIWDLRTGQCSLT-----LSIEDGVTTVAVSPGDGK-YIAAGSLDRTVRVWDSETG 468

Query: 479 ALLKRYSK----GKKHKNHVMSIPICGDFQ 504
            L++R          HK+ V S+    D Q
Sbjct: 469 FLVERLDSENELSTGHKDSVYSVVFTRDGQ 498

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 58/274 (21%), Positives = 110/274 (40%), Gaps = 57/274 (20%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDA 283
           +  + ++ DG  +ATG E+  +R+W+    K+      H+  I ++ +  +    +S   
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 414

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLV 343
           D    +WD+ +G        +                GV TV V       PG G  +  
Sbjct: 415 DRTVRIWDLRTGQCSLTLSIED---------------GVTTVAVS------PGDGKYIAA 453

Query: 344 YTMSDSRPI-----GKLV-----------GHRGTISQLEFNSETKLLASAADDNTIRVW- 386
            ++  +  +     G LV           GH+ ++  + F  + + + S + D ++++W 
Sbjct: 454 GSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWD 513

Query: 387 -HGGNGNSIHC-----FYGHTQTIVSLKWVNND-MLISASMDGSVKLWD--CGKKLQEIT 437
             G NG   H      + GH   ++S+    +D  ++S S D  V  WD   G  L  + 
Sbjct: 514 LRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQ 573

Query: 438 G---NLIAETIVDGVP------IFAGAISDDRER 462
           G   ++I+  +V+G P      +FA    D + R
Sbjct: 574 GHRNSVISVAVVNGFPLGPDVGVFATGSGDCKAR 607

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 78/177 (44%), Gaps = 20/177 (11%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGN-SIHCFYGHTQTIVSLKWVNND 413
           L GH   I  L++      L S + D T+R+W    G  S+        T V++   +  
Sbjct: 390 LQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 449

Query: 414 MLISASMDGSVKLWDC--GKKLQEI-TGNLIAETIVDGVPIFAGAISDDRERYAAGFMDG 470
            + + S+D +V++WD   G  ++ + + N ++    D V  ++   + D +   +G +D 
Sbjct: 450 YIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSV--YSVVFTRDGQGVISGSLDR 507

Query: 471 QVTVFNLAALLKRYSKG------KKHKNHVMSIPICGDFQSAHSDDSVFDLSWKEDR 521
            V +++L  L  + S          HK+ V+S+        A + D  + LS  +DR
Sbjct: 508 SVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSV--------ATTQDDEYILSGSKDR 556

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/96 (20%), Positives = 39/96 (40%), Gaps = 16/96 (16%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN---- 412
           GH+  +  +    + + + S + D  +  W   +GN +    GH  +++S+  VN     
Sbjct: 532 GHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLG 591

Query: 413 ---DMLISASMDGSVKLWD---------CGKKLQEI 436
               +  + S D   ++W           G KLQE+
Sbjct: 592 PDVGVFATGSGDCKARIWKYTKKSNPTATGAKLQEL 627

>Kwal_27.11585
          Length = 823

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 7/119 (5%)

Query: 353 GKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN- 411
           G L  H+  +  + F    KLLA+ + D TI+VW   + + +    GHT  +    ++N 
Sbjct: 540 GTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINR 599

Query: 412 NDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDG 470
           N  ++S   DG +K+WD        TG  I         I+A ++  D + +     DG
Sbjct: 600 NKQIVSTGADGLIKVWDLS------TGECIRTLDAHSNRIWALSVLSDGKEFVTADADG 652

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 72/178 (40%), Gaps = 18/178 (10%)

Query: 262 HKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFG 321
           H+  I A+  + +++ F +   D    +W+V+SG +                       G
Sbjct: 503 HEKDINALSISPNDSVFATASYDKTCKIWNVDSGEL--------------EGTLANHKRG 548

Query: 322 V-DTVWVDTDKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAAD 379
           + D  +   DK +    G   + V+++     +  L GH   + +  F +  K + S   
Sbjct: 549 LWDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGA 608

Query: 380 DNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDM-LISASMDGSVKLW-DCGKKLQE 435
           D  I+VW    G  I     H+  I +L  +++    ++A  DG  + W DC ++ Q+
Sbjct: 609 DGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWKDCSEEEQK 666

 Score = 36.2 bits (82), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 6/97 (6%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH 400
           L +Y +S S+ I + +     +  ++ +S + L+A    D ++ V    NG   H F GH
Sbjct: 84  LRIYKLS-SKKIIRSMKVSSPVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGH 142

Query: 401 TQTIVSLKWVNND-----MLISASMDGSVKLWDCGKK 432
             TI S+K+          L S    G VK+WD  ++
Sbjct: 143 GATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRR 179

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 41/100 (41%), Gaps = 9/100 (9%)

Query: 336 GPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETK----LLASAADDNTIRVWHGGNG 391
           G  G++ V  + +        GH  TIS ++F+ E       LAS      ++VW     
Sbjct: 120 GTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRR 179

Query: 392 NSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGK 431
           N IH    H   +  L     D  +S + DG ++L   G+
Sbjct: 180 NCIHTIQEHAAAVRGL-----DFRLSPADDGVLELLTGGR 214

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 64/132 (48%), Gaps = 6/132 (4%)

Query: 351 PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW- 409
           P+    GH   +  +  +++     SA+ D T+R+W+   GNS   F GHT  ++S+   
Sbjct: 58  PVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAID 117

Query: 410 VNNDMLISASMDGSVKLW----DCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAA 465
            N+  +ISAS D ++++W    DC   L   T + + +  V    +  G + D R  + +
Sbjct: 118 ANSSKIISASRDKTIRVWNTVGDCAYVLLGHT-DWVTKVRVAPKNLEDGEVDDGRITFVS 176

Query: 466 GFMDGQVTVFNL 477
             MD  V  ++L
Sbjct: 177 AGMDKIVRSWSL 188

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 77/197 (39%), Gaps = 44/197 (22%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH 400
           L ++ ++      + VGH G +  +  ++ +  + SA+ D TIRVW+   G+  +   GH
Sbjct: 90  LRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWN-TVGDCAYVLLGH 148

Query: 401 TQTIVSLKWVNNDM-----------LISASMDGSVKLWDCGKKLQEITGNLIAE----TI 445
           T  +  ++    ++            +SA MD  V+ W   +    I  + I       +
Sbjct: 149 TDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDSYRIEADFIGHNNYINV 208

Query: 446 VDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAALLKRYSKGKKHKNHVMSIPICGDFQS 505
           V   P        D    A+   DGQ+ V+NL           KHK+  M+         
Sbjct: 209 VQPSP--------DGSLAASAGKDGQIYVWNL-----------KHKSAFMNF-------- 241

Query: 506 AHSDDSVFDLSWKEDRL 522
             + D VF L++   R 
Sbjct: 242 -DAKDEVFALAFSPSRF 257

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 64/143 (44%), Gaps = 25/143 (17%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGN-------------GNSIHCFYGHTQT 403
           GH G I  + + S T+L+ SA +D T+R+W   N             G ++    GH   
Sbjct: 140 GHSGPIRAVHYISSTRLV-SAGNDRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAP 198

Query: 404 IVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISD-DRER 462
           +VS+  V+ D ++SAS D +V LW         + N    T++D +    G +S   ++R
Sbjct: 199 VVSID-VSKDRILSASCDNTVSLW---------STNYKEMTVIDPMEDLGGNVSTAAKKR 248

Query: 463 YAAGFMDGQVTVFNLAALLKRYS 485
                 DG +      AL + +S
Sbjct: 249 RKLTLKDGSIRRRAPLALFESHS 271

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 237 IATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILW 290
           I +G  +G +R +N  GK++  ++ H  PI A+H+ SS T  +S   D    LW
Sbjct: 116 IYSGSYDGIVRTYNLSGKVEKQYSGHSGPIRAVHYISS-TRLVSAGNDRTLRLW 168

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 40/82 (48%), Gaps = 9/82 (10%)

Query: 354 KLVGHRGTISQLEFNSETK-LLASAADDNTIRVWHGGNGNSIHCFYGHTQTIV------- 405
           +LVGH+  +  L+   E + ++ SA+ D T++VW   +  +++      + +V       
Sbjct: 354 QLVGHKNFVVALDTCPENEYMICSASHDGTVKVWDVRSNTAMYTITREDKNVVKGVNDKV 413

Query: 406 -SLKWVNNDMLISASMDGSVKL 426
            ++KW     +IS   D  +++
Sbjct: 414 FAVKWAKGVGIISGGQDKKIQI 435

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 4/59 (6%)

Query: 399 GHTQTIVSLKWV--NNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGV--PIFA 453
           GH   +V+L     N  M+ SAS DG+VK+WD        T     + +V GV   +FA
Sbjct: 357 GHKNFVVALDTCPENEYMICSASHDGTVKVWDVRSNTAMYTITREDKNVVKGVNDKVFA 415

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 80/182 (43%), Gaps = 18/182 (9%)

Query: 262 HKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFG 321
           H+  I AI    +++ F +   D    LW+V++G  +    +                  
Sbjct: 494 HEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLW------------ 541

Query: 322 VDTVWVDTDKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADD 380
            D  + +++K++    G   + ++++     +  L GH   + +  F ++ K L SA  D
Sbjct: 542 -DVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGAD 600

Query: 381 NTIRVWHGGNGNSIHCFYGHTQTIVSLKWV-NNDMLISASMDGSVKLW-DCGKKLQEITG 438
             I+VW   +G+ I    GH+  I +L  + + D++ISA  D   + W DC +   EI G
Sbjct: 601 GLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEA--EIQG 658

Query: 439 NL 440
            L
Sbjct: 659 AL 660

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 51/119 (42%), Gaps = 21/119 (17%)

Query: 337 PGGNLLVYTMSDSRPIGKLVGHRGTISQ----------LEFNSETKLLASAADDNTIRVW 386
           P G  L+Y +S S+ +  +    G I++          +  +  + L+A    D +I V 
Sbjct: 72  PDGKYLIY-VSQSQLVKIVNVETGVITRSLKVSSPSYVMTCDPTSTLVAIGGTDGSITVI 130

Query: 387 HGGNGNSIHCFYGHTQTIVSLKW-----VNNDMLISASMDGSVKLWD-----CGKKLQE 435
              NG   H F GH  TI SLK+      N  +L S   +G  K+WD     C   +QE
Sbjct: 131 DIENGYIAHSFKGHGGTISSLKFYGELGTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQE 189

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 10/82 (12%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNS----IHCFYGHTQTIVSLKWVN- 411
           GH   ++ L    + + LA+A+ D T  +WH  N +        F GH  ++ ++   N 
Sbjct: 388 GHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNV 447

Query: 412 -----NDMLISASMDGSVKLWD 428
                   +I+AS D +VK W+
Sbjct: 448 MEKNYPKYIITASNDLTVKKWE 469

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 39/103 (37%), Gaps = 9/103 (8%)

Query: 334 IPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETK----LLASAADDNTIRVWHGG 389
           I G  G++ V  + +        GH GTIS L+F  E      LL S   +   +VW   
Sbjct: 120 IGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLLGSGDTNGMAKVWDLV 179

Query: 390 NGNSIHCFYGHTQTIVSLKWVNND-----MLISASMDGSVKLW 427
                     H+  I  + +  ND      LI+   D  + LW
Sbjct: 180 TRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLW 222

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 83/208 (39%), Gaps = 17/208 (8%)

Query: 240 GVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVL 298
           G  NG + ++N + G L+  +  HK  +  I  +  N   +S   D I   +D N   +L
Sbjct: 478 GSSNGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKSTLL 537

Query: 299 QHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGH 358
              +  A                       +D F +     +++V      R + +L GH
Sbjct: 538 GKLKLDAPITAMVYHRS-------------SDLFALALDDLSIVVIDAVTQRVVRQLWGH 584

Query: 359 RGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIH-CFYGHTQTIVSLKWVNNDMLIS 417
              I+  +F+ E + + SA+ D+TIR W    G  I      +  T V     N D+L +
Sbjct: 585 SNRITAFDFSPEGRWIVSASLDSTIRTWDLPTGGCIDGIIVDNVATNVKFS-PNGDLLAT 643

Query: 418 ASMDGS-VKLWDCGKKLQEITGNLIAET 444
             + G+ + +W    + + ++   I E+
Sbjct: 644 THVTGNGICIWTNRAQFKTVSTRTIDES 671

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/262 (18%), Positives = 103/262 (39%), Gaps = 30/262 (11%)

Query: 233 DGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWD 291
           D +  ATG  +  +++WN   GKL+     H   +  +  ++ + +  S   D     WD
Sbjct: 127 DNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWD 186

Query: 292 VNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWV--DTDKFVIPGPGGNLLVYTMSDS 349
           +     ++++                 + GV TV +    D  V  G    + V+ +   
Sbjct: 187 LEKNTAIRNYHG--------------HLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTR 232

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
            P+  L GH+G I+++        + S++ D +IR+W    G S+     H +T+  +  
Sbjct: 233 LPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDISV 292

Query: 410 VNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMD 469
             ++   +++    ++ W   K      G L+   +   + +      +  +   AG  +
Sbjct: 293 HPSEFSFASACTNDIRSWLLPK------GELLTNFVSQDLDVINTVSINQDDVLFAGSDN 346

Query: 470 GQVTVFNLAALLKRYSKGKKHK 491
           G +T F+       Y  G K++
Sbjct: 347 GSLTFFD-------YKSGHKYQ 361

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 68/156 (43%), Gaps = 11/156 (7%)

Query: 327 VDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
           VD + F        + ++ ++  +    L  H  T+  L  ++    + S ++D T++ W
Sbjct: 126 VDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCW 185

Query: 387 HGGNGNSIHCFYGHTQTIVSLK-WVNNDMLISASMDGSVKLWDCGKKLQEIT--GNLIAE 443
                 +I  ++GH   + ++      D++++A  D  VK+WD   +L  +T  G+    
Sbjct: 186 DLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPI 245

Query: 444 TIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAA 479
           T V  +P+    IS          +D  + +++L A
Sbjct: 246 TKVRCLPVDPQVISSS--------VDASIRLWDLVA 273

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 87/220 (39%), Gaps = 36/220 (16%)

Query: 325 VWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIR 384
           +W   D  V   P  +         +P+  +  H G+++ L+F+ + K LAS +DD  + 
Sbjct: 43  IWSVADILVFAKPKVSWPAREEQLRKPLANMSRHTGSVTALKFSPDNKYLASGSDDKILL 102

Query: 385 VWHGGNG---------------NSIHCFYGHTQTIVSLKWV-NNDMLISASMDGSVKLWD 428
           +W    G               N       H   I  + W  ++ +L++  +D S+ +W+
Sbjct: 103 IWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSIIVWN 162

Query: 429 CGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAALLKRYSKGK 488
            G   ++I    + ++ V GV +F  A     + +A    D  V VF       RY KG 
Sbjct: 163 -GSTFEKIKRFDVHQSHVKGV-VFDPA----NKYFATASDDRTVKVF-------RYHKGT 209

Query: 489 KHK---NHVMSIPICGDFQSAHSDDSVFDLSWKEDRLAIA 525
                  H+++ P    FQ +        LSW  D   IA
Sbjct: 210 DLSFTIEHIITEP----FQGSPLTTYFRRLSWSPDGQHIA 245

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/214 (19%), Positives = 84/214 (39%), Gaps = 36/214 (16%)

Query: 219 GKITNQLTCLSWAHDGDSIATGVENGELRLWN----------------KEGKLQNVF--- 259
           G+   ++  +  + DG  +ATG  +G++R+W+                +E +L+      
Sbjct: 14  GQRNYEIYTVDVSSDGQRVATGGLDGKIRIWSVADILVFAKPKVSWPAREEQLRKPLANM 73

Query: 260 NFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVV---------LQHFESKAXXXXX 310
           + H   + A+ ++  N +  S   D I ++W+   G V         L+H+  +      
Sbjct: 74  SRHTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAH 133

Query: 311 XXXXXXXQMFGVDTVWV-DTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNS 369
                       D  W  D+   V  G   +++V+  S    I +   H+  +  + F+ 
Sbjct: 134 DNDIQ-------DICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHVKGVVFDP 186

Query: 370 ETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQT 403
             K  A+A+DD T++V+    G  +     H  T
Sbjct: 187 ANKYFATASDDRTVKVFRYHKGTDLSFTIEHIIT 220

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 95/235 (40%), Gaps = 19/235 (8%)

Query: 240 GVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVL 298
           G  NG + ++N + G L+  +  HK  +  +  +  N   +S   D I   +D N    L
Sbjct: 476 GSSNGGIGVYNMQSGMLRKKYRLHKRAVTGVAVDGMNRKMVSCGLDGIIGFYDFNESKYL 535

Query: 299 QHFESKAXXXXXXX-XXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVG 357
              +  A               F +D +              +++V      + + +L G
Sbjct: 536 GKLQMDAPITSMVYHRSSDLCAFALDDL--------------SIVVVDTVTQKVVRQLWG 581

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDMLI 416
           H   I+  +F+ + + L SA+ D+TIR W    G+ I      +    +LK+  N DML 
Sbjct: 582 HGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCIDGVKIES-VATNLKFSPNGDMLA 640

Query: 417 SASMDGS-VKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDG 470
           +  + G+ + +W    + ++I+   I E     + +   ++S + +     F DG
Sbjct: 641 TTHVIGNGIFIWTNRAQFKQISTKAIDEDAFQKIMLPNASVSGNSQFLEGAFQDG 695

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 57/119 (47%), Gaps = 5/119 (4%)

Query: 318 QMFGVDTVWVDTDKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLAS 376
            M  V T     D +VI G    ++ VY   + + + +L GH G +  L++ +   +L S
Sbjct: 380 HMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKY-AHGGILVS 438

Query: 377 AADDNTIRVWHGGNGNSIHCFYGHTQTIVSL---KWVNNDMLISASMDGSVKLWDCGKK 432
            + D T+RVW    G   H F GH  T+  L   ++ N   +++ S D ++ +W   K+
Sbjct: 439 GSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKE 497

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 96/235 (40%), Gaps = 34/235 (14%)

Query: 227 CLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHW-NSSNTHFISTDA- 283
            L +AH G  + +G  +  +R+W+ K+G   +VF  H S +  +      N  +I T + 
Sbjct: 427 ALKYAHGG-ILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSR 485

Query: 284 DNITILWDV-NSGVVLQHFESKAXXXXXXXXXXXXQMFGV---DTVWVDT----DKFVIP 335
           DN   +W +     V  H E                  GV       V T       V+ 
Sbjct: 486 DNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGNIVVS 545

Query: 336 GPGGN-LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGN-GNS 393
           G   N L+V+ ++  + +  L GH   I    ++ E K   SA+ D TIR+W   N  N+
Sbjct: 546 GSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIWNN 605

Query: 394 IHCFY-------------------GHTQTIVSLKWVNNDMLISASMDGSVKLWDC 429
             C Y                   GHT  +V L  +++  L+SA+ DGS++ WD 
Sbjct: 606 GECSYATNSASPCAKILGAMYTLQGHT-ALVGLLRLSDKFLVSAAADGSIRGWDA 659

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 355 LVGHR-GTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND 413
           L GH    I+ L+F  E   + + ADD  IRV+   N   +    GH   + +LK+ +  
Sbjct: 377 LRGHMTSVITCLQF--EDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAHGG 434

Query: 414 MLISASMDGSVKLWDCGK 431
           +L+S S D +V++WD  K
Sbjct: 435 ILVSGSTDRTVRVWDIKK 452

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 11/84 (13%)

Query: 344 YTMSDSRPIGKLVG-------HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHC 396
           Y  + + P  K++G       H   +  L  +   K L SAA D +IR W   N  S   
Sbjct: 610 YATNSASPCAKILGAMYTLQGHTALVGLLRLSD--KFLVSAAADGSIRGW-DANDYSRKF 666

Query: 397 FYGHTQ-TIVSLKWVNNDMLISAS 419
            Y HT  + ++  +V++++L+S S
Sbjct: 667 SYHHTNLSAITTFYVSDNILVSGS 690

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 75/151 (49%), Gaps = 14/151 (9%)

Query: 347 SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVS 406
           S + P+  LVGH G +  L F  +  LL S++ D T ++W   N    +    H  ++  
Sbjct: 90  SSADPMYTLVGHTGNVCGLRF--QNGLLLSSSWDKTAKIWD--NNKLKYDLRNHEASVWD 145

Query: 407 LKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAG 466
              V++D++++AS D S+ +W  GK +++++       I D V      IS+D   +A+ 
Sbjct: 146 STMVSDDIILTASADKSIGVWMEGKLIKKLSN------IHDDVIRHLEYISND--IFASC 197

Query: 467 FMDGQVTVFNLAALLKRYSKGKKHKNHVMSI 497
             DG + + NL   +K   +G  H++ V  +
Sbjct: 198 SNDGTIKLLNLEGEIKNVFEG--HESFVYCV 226

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 235 DSIATGVENGELRLWNKEGKLQNVFNFHKSPIIAI-HWNSSNTHFISTDADNITILWDVN 293
           D  A+   +G ++L N EG+++NVF  H+S +  + H N  NT F S   D+   +W +N
Sbjct: 192 DIFASCSNDGTIKLLNLEGEIKNVFEGHESFVYCVKHMN--NTLF-SCGEDSTVRIWSIN 248

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 20/29 (68%)

Query: 399 GHTQTIVSLKWVNNDMLISASMDGSVKLW 427
           GH+Q +  +  VN++ + S S DGS+++W
Sbjct: 10  GHSQDVKDITAVNDNKIASVSRDGSLRVW 38

>Scas_679.28
          Length = 815

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 50/100 (50%), Gaps = 3/100 (3%)

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQ 402
           ++ + +      L  H+  +  + F    KL+A+ + D TI++W     + +    GHT 
Sbjct: 517 IWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSVMKTLEGHTN 576

Query: 403 TIVSLKWVNNDM-LISASMDGSVKLWDC--GKKLQEITGN 439
            +    ++N  + L+S+  DG +K+WDC  G  L+ + G+
Sbjct: 577 AVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGH 616

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 323 DTVWVDTDKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDN 381
           D  +   DK +    G   + ++++     +  L GH   + +  F ++   L S+  D 
Sbjct: 538 DVAFCQYDKLIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADG 597

Query: 382 TIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN-DMLISASMDGSVKLW-DC 429
            I++W    G+ +    GH   I +L  +N+ DM++SA  DG  + W DC
Sbjct: 598 LIKIWDCSTGDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFWKDC 647

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 7/100 (7%)

Query: 336 GPGGNLLVYTMSDSRPIGKLVGHRGTISQLEF----NSETKLLASAADDNTIRVWHGGNG 391
           G  G++ V  + +      L GH  TIS L+F    NS   LL S   +  ++VW     
Sbjct: 125 GTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKR 184

Query: 392 NSIHCFYGHTQTI--VSLKWVNND-MLISASMDGSVKLWD 428
             +H    H+  +  + ++ V ++  LIS   D    LW+
Sbjct: 185 KCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWN 224

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 94/236 (39%), Gaps = 45/236 (19%)

Query: 159 LGKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATT 218
           L +  CL WN    +IL+ G  D                 K++ + +    H F T+ T 
Sbjct: 329 LDRVACLSWN---QHILSSGSKDH----------------KILHRDVRMPEHYFETANTH 369

Query: 219 GKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNF--HKSPIIAIHWNSSNT 276
            +   ++  L W  D + +A+G  +  + +++   K + V  F  H + + A+ W+    
Sbjct: 370 SQ---EVCGLKWNVDENRLASGGNDNVVYVYDGPSK-KPVLKFTEHNAAVKAMAWSPHRR 425

Query: 277 HFIST---DADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFV 333
             ++T    AD    +W+VNSGV L   ++ +                 + VW      +
Sbjct: 426 ATLATGGGTADRRLKIWNVNSGVRLNDVDTGSQV--------------CNMVWSKNTDEI 471

Query: 334 IPGPGG---NLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
           +   G    NL ++      P+  L GH   +  L  +++   + S A D T+R W
Sbjct: 472 VTSHGYSKFNLTLWDCPTLEPLAVLKGHSFRVLHLTLSTDGTTIVSGAGDETLRYW 527

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 45/95 (47%), Gaps = 7/95 (7%)

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLIS 417
           H   +  L++N +   LAS  +DN + V+ G +   +  F  H   + ++ W  +     
Sbjct: 369 HSQEVCGLKWNVDENRLASGGNDNVVYVYDGPSKKPVLKFTEHNAAVKAMAWSPHRRATL 428

Query: 418 ASMDGS----VKLWDC--GKKLQEI-TGNLIAETI 445
           A+  G+    +K+W+   G +L ++ TG+ +   +
Sbjct: 429 ATGGGTADRRLKIWNVNSGVRLNDVDTGSQVCNMV 463

>Scas_704.40
          Length = 608

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 48/85 (56%), Gaps = 3/85 (3%)

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQ 402
           ++ +  ++ I +L GH   +  L F+ E KL+  + D  TIRVW+   G  I  + GHT 
Sbjct: 277 IWDLCSNKLIRRLSGHTDGVKTLYFD-EAKLVTGSLD-KTIRVWNYKTGECISTYRGHTD 334

Query: 403 TIVSLKWVNNDMLISASMDGSVKLW 427
           +++S+      +++S S D +VK+W
Sbjct: 335 SVMSVD-AFKKIIVSGSADKTVKIW 358

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 11/71 (15%)

Query: 374 LASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD----- 428
           L S + DNTI++W    G  I   +GH + +  +   +N  +IS S DGS+K+WD     
Sbjct: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA-ADNFRIISGSHDGSIKIWDLQSGK 538

Query: 429 C-----GKKLQ 434
           C     GK+LQ
Sbjct: 539 CMHTFHGKRLQ 549

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 84/228 (36%), Gaps = 40/228 (17%)

Query: 249 WNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXX 308
           W K       F  H   ++ + +N       +   D+   +WD+ S  +++         
Sbjct: 239 WRKGNCQVQEFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTD-- 294

Query: 309 XXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFN 368
                       GV T++ D  K V       + V+       I    GH  T S +  +
Sbjct: 295 ------------GVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGH--TDSVMSVD 340

Query: 369 SETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDML-------ISASMD 421
           +  K++ S + D T+++WH     + +   GHT+      WVN   L        S S D
Sbjct: 341 AFKKIIVSGSADKTVKIWH-VESRTCYTLRGHTE------WVNCVKLHPKSFTCFSGSDD 393

Query: 422 GSVKLWD-----CGKKLQEITGN---LIAETIVDGVPIFAGAISDDRE 461
            ++++WD     C K  +   G    +I  TI+D   +    IS   E
Sbjct: 394 TTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNE 441

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 56/112 (50%), Gaps = 12/112 (10%)

Query: 329 TDKFVIPGPGG-NLLVYTMSDSRPIGKLVGHRGTISQLEFNSE----------TKLLASA 377
           + ++++ G    N+ +Y +   + +G L+GH+G+I+ L F+             K L SA
Sbjct: 50  SKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFSRGKDADGQDIQLNKWLLSA 109

Query: 378 ADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
           ++D+ I VW   +  +     GHT  I       +N + +S S D S++LW+
Sbjct: 110 SEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRVAVSVSEDHSIRLWN 161

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 68/144 (47%), Gaps = 13/144 (9%)

Query: 340 NLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYG 399
            L ++ +   + I + VGH+  +  +  +     + SA+ D T++VW+   G+ +    G
Sbjct: 104 TLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWN-TVGDCVVTLLG 162

Query: 400 HTQTIVSLKWVNND------MLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFA 453
           H   + +++   ++       +ISA MD  VK+WD    LQ  T  + A+ I     +  
Sbjct: 163 HNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWD----LQSFT--IEADFIGHNNYVTT 216

Query: 454 GAISDDRERYAAGFMDGQVTVFNL 477
              S D   +A+   DGQ+ ++NL
Sbjct: 217 VTPSPDGSIFASAGKDGQIILWNL 240

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 81/193 (41%), Gaps = 20/193 (10%)

Query: 351 PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW- 409
           P+    GH   +       + K   SA+ D T+R+W   +G  I  F GH   ++S+   
Sbjct: 73  PVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSID 132

Query: 410 VNNDMLISASMDGSVKLWD-CGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFM 468
                ++SAS D +VK+W+  G  +  + G+      V  V I     SDD     +  M
Sbjct: 133 PRATQIVSASRDKTVKVWNTVGDCVVTLLGH---NDWVSNVRIAPSEKSDDAVTVISAGM 189

Query: 469 DGQVTVFNLAALLKRYSKGKKHKNHVMSIPICGD---FQSAHSDDSV-----------FD 514
           D  V V++L +     +    H N+V ++    D   F SA  D  +           + 
Sbjct: 190 DKVVKVWDLQSFTIE-ADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYT 248

Query: 515 LSWKEDRLAIAYS 527
           L  K++  A+A+S
Sbjct: 249 LDAKDEVFAVAFS 261

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 67/332 (20%), Positives = 119/332 (35%), Gaps = 49/332 (14%)

Query: 160 GKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTG 219
           G    L  +P   N+L  G  D T  LI  + T  D Q  +  ++     H       T 
Sbjct: 34  GWVTSLSTSPAQPNMLLSGSRDKT--LITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVT- 90

Query: 220 KITNQLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHF 278
                       HDG    +   +  LRLW+ + GK    F  HKS ++++  +   T  
Sbjct: 91  ------------HDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQI 138

Query: 279 ISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPG 338
           +S   D    +W+     V+                       V  +    DK V     
Sbjct: 139 VSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVV----- 193

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
               V+ +         +GH   ++ +  + +  + ASA  D  I +W+     +++   
Sbjct: 194 ---KVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTLD 250

Query: 399 GHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGV-PIFAG--- 454
              + + ++ +  N   ++A+    +K++D    L+E        TIVD + P FAG   
Sbjct: 251 AKDE-VFAVAFSPNRYWLTAATASGIKIFD----LEE-------RTIVDDLKPEFAGYNK 298

Query: 455 ---------AISDDRERYAAGFMDGQVTVFNL 477
                    A S D +   AG+ D  + V+ +
Sbjct: 299 AQDPHAVSLAWSADGQTLFAGYTDNIIRVWQV 330

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 44/101 (43%)

Query: 328 DTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
           DTD   +    G + V+ +     +    GH+  I+ L+F+     L S + D+ I VW 
Sbjct: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149

Query: 388 GGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
                 ++    H  +I        D LIS S DG +KLWD
Sbjct: 150 LVGEVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWD 190

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 90/220 (40%), Gaps = 11/220 (5%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWN--KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTD 282
           LTC  +   G  +  G  NGEL+L++      L  + + H + I ++   S     ++  
Sbjct: 434 LTC-KFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGS 492

Query: 283 ADNITILWDV---NSGV--VLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGP 337
           AD     WD    NS V      F                 +  V  V  D     I   
Sbjct: 493 ADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCV-RVSPDDRYLAISLL 551

Query: 338 GGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCF 397
              + V+ +   +    L GH+  +  ++ + ++K++ +++ D  I++W    G+     
Sbjct: 552 DNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSL 611

Query: 398 YGHTQTIVSLKWV-NNDMLISASMDGSVKLWDCGKKLQEI 436
           + H  +I+++K++  +    S S D  VK WD G+K + I
Sbjct: 612 FAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWD-GEKFECI 650

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 71/179 (39%), Gaps = 20/179 (11%)

Query: 211 PFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGK--LQNVFNFHKSPIIA 268
           P   S   G    + T L    D D +A G  +G +++W+   K  L N FN HK+ I  
Sbjct: 68  PPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLN-FNGHKAAITL 126

Query: 269 IHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVD 328
           + ++ + T  IS   D+  I+WD+   V L    S                  +   W  
Sbjct: 127 LQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKD--------------SITGFWCQ 172

Query: 329 TDKFVIP-GPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
            + ++I     G + ++ +   + I   + H G    L    +  LL +   D+ +++W
Sbjct: 173 GEDWLISTSKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDD--LLITTGTDSQVKIW 229

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 57/145 (39%), Gaps = 14/145 (9%)

Query: 283 ADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLL 342
           AD +  +WD+ S  VL +F                Q  G  T      + +      N++
Sbjct: 99  ADGVIKVWDLMSKTVLLNFNGHKAAITLL------QFDGTGT------RLISGSKDSNII 146

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQ 402
           V+ +     + KL  H+ +I+      E  L+ S + D  I++W       I     HT 
Sbjct: 147 VWDLVGEVGLYKLRSHKDSITGFWCQGEDWLI-STSKDGMIKLWDLKTHQCIETHIAHTG 205

Query: 403 TIVSLKWVNNDMLISASMDGSVKLW 427
               L  V +D+LI+   D  VK+W
Sbjct: 206 ECWGLA-VKDDLLITTGTDSQVKIW 229

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

Query: 342 LVYTMSDSRPIGKLVGHRGT----ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCF 397
           LV  +SD  P G     RG      + LE + +T LLA    D  I+VW   +   +  F
Sbjct: 59  LVSKLSDGLPPGA-SDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNF 117

Query: 398 YGHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
            GH   I  L++      LIS S D ++ +WD
Sbjct: 118 NGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN-D 413
           L  H+ +I  ++F  ++    S + D  ++ W G     I   Y H   + +L    +  
Sbjct: 611 LFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGG 670

Query: 414 MLISASMDGSVKLWD 428
            ++S+S D S+++W+
Sbjct: 671 FVVSSSHDHSIRIWE 685

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/318 (21%), Positives = 118/318 (37%), Gaps = 42/318 (13%)

Query: 171 SSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSW 230
           S N LA+  +  T ++I     + D ++  IE  ++E              T+ L  L  
Sbjct: 343 SLNRLALATNSPTLRIIPTPQASEDKEVMEIETEMYEGH------------TDLLNSLDA 390

Query: 231 AHDGDSIATGVENGELRLWNKEGKLQNVFNF-----HKSPIIAIH----WNSSNTHFIST 281
             DG  +AT  ++  + LW       +   F     H  P+ AI      N +   F+ T
Sbjct: 391 TSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLT 450

Query: 282 DADNITI-LWDV-----NSGVVLQHF--ESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFV 333
            ++++TI  W V        + L H    S+              M   D++      F 
Sbjct: 451 ASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPNDSI------FA 504

Query: 334 IPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNS 393
                    ++ +        L  H+  +  + F     LLA+ + D +I +W   +   
Sbjct: 505 TASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLESFTV 564

Query: 394 IHCFYGHTQTIVSLKWVN-NDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIF 452
           +    GHT  +  + ++N N  L+S   DG VK+WDC       TG  +         I+
Sbjct: 565 LKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCS------TGECVRTLDAHNNRIW 618

Query: 453 AGAISDDRERYAAGFMDG 470
           A A+++D +       DG
Sbjct: 619 ALAVANDGQLIITADADG 636

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/169 (19%), Positives = 69/169 (40%), Gaps = 15/169 (8%)

Query: 262 HKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFG 321
           H+  I AI  + +++ F +   D    +W+V++G V                     ++G
Sbjct: 487 HEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEV-----------EATLANHKRGLWG 535

Query: 322 VDTVWVDTDKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADD 380
           V   + + D  +    G   + ++++     +  L GH   + ++ F +  K L S   D
Sbjct: 536 V--AFCEYDWLLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGAD 593

Query: 381 NTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN-DMLISASMDGSVKLWD 428
             +++W    G  +     H   I +L   N+  ++I+A  DG  + W+
Sbjct: 594 GLVKIWDCSTGECVRTLDAHNNRIWALAVANDGQLIITADADGVFQFWE 642

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 5/73 (6%)

Query: 365 LEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW---VNNDMLISASMD 421
           L+ +  + LLA    D ++ V+   NG   H   GH  TI S+K+   V++ M + AS D
Sbjct: 107 LDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGD 166

Query: 422 --GSVKLWDCGKK 432
             G VK+WD  K+
Sbjct: 167 TNGMVKIWDLVKR 179

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 4/80 (5%)

Query: 332 FVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETK----LLASAADDNTIRVWH 387
             + G  G++ V+ +++      L GH  TIS ++F  E      LLAS   +  +++W 
Sbjct: 116 LAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWD 175

Query: 388 GGNGNSIHCFYGHTQTIVSL 407
                 IH    HT  +  L
Sbjct: 176 LVKRRCIHTVQEHTAAVRGL 195

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 68/145 (46%), Gaps = 8/145 (5%)

Query: 329 TDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHG 388
           TDK VI   GG++ VY       +  +  H   ++ ++      +L S + D  ++VW  
Sbjct: 111 TDKIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSL 170

Query: 389 GNGNSIHCFYGH----TQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAET 444
            +G++     GH    T TI+  +  N   ++S+S+DGSV+LW+ G   + I+     E 
Sbjct: 171 EDGSNPRTLKGHSAGITDTIIIERGRN---VLSSSLDGSVRLWELGSG-KTISKFCRKEN 226

Query: 445 IVDGVPIFAGAISDDRERYAAGFMD 469
             DGV   +  + ++    +A   D
Sbjct: 227 TTDGVTSMSLLVGEESTSMSAQVTD 251

>Scas_692.29
          Length = 456

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 69/163 (42%), Gaps = 39/163 (23%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDAD 284
           ++ +  + D  +I T   +G +R WN  GK+Q  ++ H  PI A+ +  S+T  +S   D
Sbjct: 106 ISSIDVSQDKKAIITASYDGVIRTWNLSGKVQKQYSGHSGPIRAVKF-ISDTRLVSAGND 164

Query: 285 NITILWDV-NSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLV 343
               LW   N+  V+QHF+ +                                       
Sbjct: 165 RTLRLWKTKNNDSVVQHFDEEDEEA----------------------------------- 189

Query: 344 YTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
             + D + +  L GH+  +  L+ ++ +++L+S+  DN+I +W
Sbjct: 190 -NIEDGKTLAILEGHKAPVVSLDVSNTSRILSSSY-DNSIGLW 230

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 20/90 (22%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGN-------------------GNSIHCF 397
           GH G I  ++F S+T+L+ SA +D T+R+W   N                   G ++   
Sbjct: 142 GHSGPIRAVKFISDTRLV-SAGNDRTLRLWKTKNNDSVVQHFDEEDEEANIEDGKTLAIL 200

Query: 398 YGHTQTIVSLKWVNNDMLISASMDGSVKLW 427
            GH   +VSL   N   ++S+S D S+ LW
Sbjct: 201 EGHKAPVVSLDVSNTSRILSSSYDNSIGLW 230

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 2/37 (5%)

Query: 395 HCFYGHTQTIVSLKWV--NNDMLISASMDGSVKLWDC 429
           H   GH   +VSL     N  +L S S DG+VK+WD 
Sbjct: 365 HQLIGHKNFVVSLDTCPENEYILCSGSHDGTVKVWDV 401

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 4/77 (5%)

Query: 354 KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN- 412
           +LVGH G +  L++  + ++L S + D T+R+W+   G   H F GHT T+  L  V + 
Sbjct: 402 ELVGHEGGVWALKYAGD-EILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHG 460

Query: 413 --DMLISASMDGSVKLW 427
               +++ S D ++ +W
Sbjct: 461 GIKYVVTGSRDNTLHVW 477

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 97/230 (42%), Gaps = 33/230 (14%)

Query: 230 WA--HDGDSI-ATGVENGELRLWN-KEGKLQNVFNFHKSPI--IAIHWNSSNTHFISTDA 283
           WA  + GD I  +G  +  +R+WN K GK  +VF  H S +  + +  +    + ++   
Sbjct: 411 WALKYAGDEILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSR 470

Query: 284 DNITILW---DVNSG----VVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPG 336
           DN   +W   D NS       ++ F S               M  V TV    +  V   
Sbjct: 471 DNTLHVWKLPDPNSPDYNPNAMRQFNS-IEDNPFFVGVLRGHMASVRTVSGHGNIVVSGS 529

Query: 337 PGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH----GGNG- 391
              NL+V+ ++  + +  L GH   I    ++ + K   SA+ D T++VW       NG 
Sbjct: 530 YDHNLMVWDIAKMKLLYVLTGHTDRIYSTLYDHKRKRCISASMDTTVKVWDLSDINNNGP 589

Query: 392 -------------NSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
                         S+    GHT  +V L  +++  L+SA+ DGS++ WD
Sbjct: 590 VSQINSTSALKVSGSVRTLCGHT-ALVGLLGLSDKYLVSAAADGSLRGWD 638

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDM 414
           L GHR  +    F  E   + + ADD  I V+            GH   + +LK+  +++
Sbjct: 362 LDGHRTKVVTC-FQFEGNYIITGADDKRINVYDADREQFKLELVGHEGGVWALKYAGDEI 420

Query: 415 LISASMDGSVKLWD 428
           L+S S D +V++W+
Sbjct: 421 LVSGSTDRTVRIWN 434

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN 411
           +  L GH   +  L  +   K L SAA D ++R W   + +    F+   Q+ ++  +V+
Sbjct: 605 VRTLCGHTALVGLLGLSD--KYLVSAAADGSLRGWDASDYSKRFSFHHTNQSAITTFFVS 662

Query: 412 NDMLISAS 419
           +++L+S S
Sbjct: 663 DNILVSGS 670

>KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces
           cerevisiae YMR146c TIF34 translation initiation factor
           eIF3, p39 subunit singleton, start by similarity
          Length = 347

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 78/187 (41%), Gaps = 30/187 (16%)

Query: 217 TTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKE-GKLQNVFNFHKSPIIAIHWNSSN 275
           TT +   ++   SW+++G  I  G E+G++  +  E G+       H+  I  I ++   
Sbjct: 147 TTIEQATKVFVASWSYNGKYIIAGHEDGQISAYYGENGEFVQAKKIHEKSIKDIQFSPDR 206

Query: 276 THFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIP 335
           T+FI++  D++  L DV++  VL+ +++                           +FVI 
Sbjct: 207 TYFITSSRDSVASLVDVDTFEVLKTYKADCPLNSASITPLK--------------EFVIL 252

Query: 336 GPGGNLLVYTMSDSR---------------PIGKLVGHRGTISQLEFNSETKLLASAADD 380
           G G +    T + +R                IG++ GH G ++ +  +      AS  +D
Sbjct: 253 GGGQDAKDVTTTSAREGKFEARIYHKVFQDEIGRVKGHFGPLNYVAVSPTGTSYASGGED 312

Query: 381 NTIRVWH 387
             IR+ H
Sbjct: 313 GYIRLHH 319

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
           RPI  L GH   ++Q++FN +  L+ + + D+   +W+  NG  +     H+ TI S+  
Sbjct: 2   RPI-VLKGHERPLTQVKFNRDGDLVFACSKDSVASIWYAINGERLGTLDDHSGTIWSIDV 60

Query: 410 -VNNDMLISASMDGSVKLW 427
             +    ++   D   K+W
Sbjct: 61  DESTTYALTGGADFCFKIW 79

>Kwal_56.23920
          Length = 937

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/217 (20%), Positives = 84/217 (38%), Gaps = 22/217 (10%)

Query: 234 GDSIATGVENGELRLWNKEGK--LQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWD 291
           G  +  G + G+L L++      L  +   H   I ++   +     ++  AD     WD
Sbjct: 436 GALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWD 495

Query: 292 VNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIP-GPGGNLL-------- 342
                     E +             +MF   T+ ++ D   +   P   LL        
Sbjct: 496 F-------QVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNT 548

Query: 343 --VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH 400
             V+ M   +    L GH+  +  ++ + ++KLL +++ D  I++W    G+     + H
Sbjct: 549 VKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAH 608

Query: 401 TQTIVSLKWV-NNDMLISASMDGSVKLWDCGKKLQEI 436
             +I+ + +V  +    S S D  VK WD G K + I
Sbjct: 609 NDSIMKVVFVPESHNFFSCSKDALVKYWD-GDKFECI 644

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

Query: 342 LVYTMSDSRPIGKLVGHR---GTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           L+ T++D  P G +          S L+++ ET+LLA   +D  I++W   + + +  F 
Sbjct: 55  LIGTLTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFN 114

Query: 399 GHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
           GH   I  L +      LIS S D  + +WD
Sbjct: 115 GHKSAITILTFDQTGTRLISGSRDSDIIVWD 145

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 68/153 (44%), Gaps = 18/153 (11%)

Query: 237 IATGVENGELRLWNKEGKLQNV-FNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295
           +A G  +G +++W+   K   + FN HKS I  + ++ + T  IS   D+  I+WD+   
Sbjct: 90  LAVGYNDGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGE 149

Query: 296 VVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLL-VYTMSDSRPIGK 354
           V L    S                  +  +W + ++++I      L+ V+ +   + +  
Sbjct: 150 VGLYKLRSHKD--------------SITGLWCEGEEWLISTSKDGLIKVWDLKVQQCVET 195

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
            V H G    +  + +  L+ +A  DN I++W+
Sbjct: 196 HVAHVGECWSMGVHED--LVITAGADNQIKLWN 226

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLI 416
           GH+  I+ L F+     L S + D+ I VW       ++    H  +I  L     + LI
Sbjct: 115 GHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLI 174

Query: 417 SASMDGSVKLWDCGKKLQEITGNLIA 442
           S S DG +K+WD   K+Q+     +A
Sbjct: 175 STSKDGLIKVWDL--KVQQCVETHVA 198

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 63/145 (43%), Gaps = 11/145 (7%)

Query: 340 NLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYG 399
           +++V+ +     + KL  H+ +I+ L    E + L S + D  I+VW       +     
Sbjct: 140 DIIVWDLVGEVGLYKLRSHKDSITGLWCEGE-EWLISTSKDGLIKVWDLKVQQCVETHVA 198

Query: 400 HTQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAE-------TIVDGVPIF 452
           H     S+  V+ D++I+A  D  +KLW+     +E  G+++ E       +   GV I 
Sbjct: 199 HVGECWSMG-VHEDLVITAGADNQIKLWNLN--FEESAGSMLIEKGTHEKQSRQRGVAIQ 255

Query: 453 AGAISDDRERYAAGFMDGQVTVFNL 477
              +SD+   +     D  V  F L
Sbjct: 256 FTTVSDETTFFFIQNADRSVETFRL 280

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 73/198 (36%), Gaps = 54/198 (27%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY------------------ 398
           GHR  +  ++ + + KLLA+A+ + T+++W+    + I  F                   
Sbjct: 383 GHRSDVRAIDISGDNKLLATAS-NGTLKIWNIKTNSCIRTFECGYALACKFLPGGALVVL 441

Query: 399 -----------------------GHTQTIVSLKWVNN-DMLISASMDGSVKLWDCGKKLQ 434
                                   H+  I SL    +   L++ S D +V  WD   + +
Sbjct: 442 GTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQE 501

Query: 435 EITG---------NLIAETIVD-GVPIFAGAISDDRERYAAGFMDGQVTVFNLAALLKRY 484
            + G          +  +T ++    + A  IS D    A   +D  V VF + + +K +
Sbjct: 502 PVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDS-MKFF 560

Query: 485 SKGKKHKNHVMSIPICGD 502
                HK  V+SI I  D
Sbjct: 561 LSLYGHKLPVLSIDISFD 578

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 58/111 (52%), Gaps = 11/111 (9%)

Query: 329 TDKFVIPGPGG-NLLVYTMSDSRPIGKLVGHRGTISQLEF---------NSETKLLASAA 378
           + ++++ G    ++ +Y +   + +G L+ H+G+I+ L+F         ++  K L SA+
Sbjct: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVSDQEPKSTSGKWLLSAS 109

Query: 379 DDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
           +DN I VW   +  +     GHT  I  +    +N ++ S S D S++LW+
Sbjct: 110 EDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRLWN 160

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/198 (17%), Positives = 80/198 (40%), Gaps = 17/198 (8%)

Query: 233 DGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWD 291
           D +   TG  +  +++W+   GKL+     H   +  +  +  + +  S   D     WD
Sbjct: 151 DNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWD 210

Query: 292 VNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDT--DKFVIPGPGGNLLVYTMSDS 349
           +    +++ +                 + GV TV +    D     G    + ++ M   
Sbjct: 211 LEKNQIIRDYYG--------------HLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTR 256

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
            P+  LVGH+G I+Q++       + S++ D T+R+W    G ++     H +++ +   
Sbjct: 257 IPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATAL 316

Query: 410 VNNDMLISASMDGSVKLW 427
              +  ++++    ++ W
Sbjct: 317 HPKEFSVASACTDDIRSW 334

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 65/164 (39%), Gaps = 23/164 (14%)

Query: 159 LGKAVCLQWNPVSSNILAIGEHDSTAKLIELET----TTTDDQIKLIEKTIHELRHPFAT 214
           LG   C+  +PV +     G +D+T K+ +L T    TT    +  +       RHP+  
Sbjct: 139 LGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLF 198

Query: 215 SATTGKIT-------NQLTCLSWAHDG-----------DSIATGVENGELRLWNKEGKLQ 256
           S +  K         NQ+    + H             D IAT   +  ++LW+   ++ 
Sbjct: 199 SVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIP 258

Query: 257 NV-FNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQ 299
            +    HK PI  +     +   +S+  D    LWDV +G  ++
Sbjct: 259 VITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMK 302

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 50/112 (44%), Gaps = 1/112 (0%)

Query: 327 VDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
           VD + F+       + V+ ++  +    L GH  T+  +  +     L S ++D T++ W
Sbjct: 150 VDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCW 209

Query: 387 HGGNGNSIHCFYGHTQTIVSLKWVNN-DMLISASMDGSVKLWDCGKKLQEIT 437
                  I  +YGH   + ++      D++ +A  D  +KLWD   ++  IT
Sbjct: 210 DLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVIT 261

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 323 DTVWVDTDKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDN 381
           D  +   DK +    G   + ++++     +  L GH   + +  F ++ K L S   D 
Sbjct: 538 DVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADG 597

Query: 382 TIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN-DMLISASMDGSVKLW-DC 429
            I++W   +G  +    GH   + +L  +N+ DM++SA  DG  + W DC
Sbjct: 598 LIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKDC 647

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 48/108 (44%), Gaps = 11/108 (10%)

Query: 332 FVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEF----NSETKLLASAADDNTIRVWH 387
             + G  G+++V  + +        GH GTIS L+F    NS+  LLAS   +  ++VW 
Sbjct: 117 LAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWD 176

Query: 388 GGNGNSIHCFYGHTQTIVSLKWV---NNDM----LISASMDGSVKLWD 428
                 +H    HT  +  L  +   +ND     L+S   D  + LWD
Sbjct: 177 LVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWD 224

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 49/96 (51%), Gaps = 11/96 (11%)

Query: 365 LEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW---VNNDMLISASMD 421
           L+ +S + LLA    D +I V    NG   H F GH  TI SLK+   +N+ + + AS D
Sbjct: 108 LDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGD 167

Query: 422 --GSVKLWD-----CGKKLQEITGNLIAETIVDGVP 450
             G VK+WD     C   LQE T  +    I++ VP
Sbjct: 168 TNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIE-VP 202

>Scas_721.32
          Length = 822

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 69/335 (20%), Positives = 129/335 (38%), Gaps = 33/335 (9%)

Query: 160 GKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTG 219
           G    LQ++   S ++A G  DS  KL  L+ ++     +    +I+       TS T  
Sbjct: 488 GGMTSLQFS-EDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLI 546

Query: 220 KITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNV-FNFHKSPIIAIHWNSSNTHF 278
             +  +   S++ D   + +G E+  +RLW+ +     V +  H  P+  + ++    +F
Sbjct: 547 GHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYF 606

Query: 279 ISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDK-FVIPGP 337
            +   D    LW  +    L+ F                 +  VD V    +  +V  G 
Sbjct: 607 ATASHDQTARLWSCDHIYPLRIFAG--------------HLSDVDCVSFHPNGCYVFTGS 652

Query: 338 GGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHC 396
                 ++ +S    +   +GH   +     + + + LA+ ++D  I +W  G    +  
Sbjct: 653 SDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRLKV 712

Query: 397 FYGHTQTIV-SLKWVN-NDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAG 454
             GH +  + SL +    ++L+S   D SV++WD  K   E  G    E  V  +     
Sbjct: 713 MRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLKKSTAE-PGPEPEEQFVGYIGNLTA 771

Query: 455 AISDD-----RER-------YAAGFMDGQVTVFNL 477
           +I+ D     R R         A F   +  +FN+
Sbjct: 772 SINQDIKDFGRRRTIIPSNDLVASFYTKKTPIFNV 806

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 64/146 (43%), Gaps = 9/146 (6%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDML 415
           GH   +  ++F+      A+A+ D T R+W   +   +  F GH   +  + +  N   +
Sbjct: 589 GHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYV 648

Query: 416 ISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVF 475
            + S D + ++WD        TG+ +   +    P+   A+S D    A G  DG + ++
Sbjct: 649 FTGSSDKTCRMWDIS------TGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLW 702

Query: 476 NLAALLKRYSKGKKH-KNHVMSIPIC 500
           ++    KR    + H KN + S+  C
Sbjct: 703 DIGT-AKRLKVMRGHGKNAIHSLSYC 727

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 97/235 (41%), Gaps = 43/235 (18%)

Query: 159 LGKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATT 218
           L +  CL WN   ++IL+ G  D T  ++  +    D   + IE   HE           
Sbjct: 418 LDRVACLSWN---NHILSSGSRDRT--ILHRDVRMADPFFEKIE--THE----------- 459

Query: 219 GKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNV-FNFHKSPIIAIHWNSSNTH 277
                ++  L W  + + +A+G  +  + +++   +   +  N HK+ + A+ W+     
Sbjct: 460 ----QEICGLKWNTNDNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHKQG 515

Query: 278 FIST---DADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVW-VDTDKFV 333
            ++T    AD    +W+VN+ V L   ++ +                 + VW  +TD+ V
Sbjct: 516 ILATGGGTADRTLKMWNVNTSVKLNDVDTGSQV--------------CNMVWSTNTDEIV 561

Query: 334 IPG--PGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
                   NL ++  S+  P+  L GH   +  L  +++   + S A D T+R W
Sbjct: 562 TSHGYSKYNLTIWEASNLEPLAILKGHSFRVLHLTLSADGTTIVSGAGDETLRYW 616

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query: 354 KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND 413
           K+  H   I  L++N+    LAS  +DN + V+ G +         H   + ++ W  + 
Sbjct: 454 KIETHEQEICGLKWNTNDNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHK 513

Query: 414 MLISA----SMDGSVKLWDCGK--KLQEI-TGNLIAETI 445
             I A    + D ++K+W+     KL ++ TG+ +   +
Sbjct: 514 QGILATGGGTADRTLKMWNVNTSVKLNDVDTGSQVCNMV 552

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDM-L 415
            H   I++ +F        S++ D  +++W    G  +  F GHT+++     V+     
Sbjct: 156 AHASHITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNF 215

Query: 416 ISASMDGSVKLWDC 429
           +SAS DGS+KLW+C
Sbjct: 216 VSASSDGSLKLWEC 229

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 11/102 (10%)

Query: 374 LASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD----- 428
           L S   DNTI++W    G  I   +GH + +  +   +N  +IS S DGS+K+WD     
Sbjct: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA-ADNFRIISGSHDGSIKVWDLQSGK 583

Query: 429 C-----GKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAA 465
           C     G++LQ  T +   +++ D V   A     D E ++ 
Sbjct: 584 CMHTFNGRRLQRETQHTQTQSLGDKVAPIACVCIGDSECFSG 625

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 9/91 (9%)

Query: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN 411
           I +  GH   +  L+FN   +LL + + D+TI +W    G  I    GH+  + +L + +
Sbjct: 295 IQEFKGHMDGVLTLQFN--YRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-YFD 351

Query: 412 NDMLISASMDGSVKLWDCGKKLQEITGNLIA 442
           +  LI+ S+D ++++W+       ITG  I+
Sbjct: 352 DRKLITGSLDKTIRVWN------YITGECIS 376

 Score = 32.3 bits (72), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 33/175 (18%), Positives = 70/175 (40%), Gaps = 21/175 (12%)

Query: 237 IATGVENGELRLWNK-EGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295
           + TG  +  + +W+   GKL    + H   +  ++++  +   I+   D    +W+  +G
Sbjct: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWNYITG 372

Query: 296 VVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKL 355
             +  +   +             +  VD+      K ++ G     +     +SR    L
Sbjct: 373 ECISTYRGHSD-----------SVLSVDSY----QKVIVSGSADKTVKVWHVESRTCYTL 417

Query: 356 VGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH---TQTIVSL 407
            GH   ++ ++ + ++    S +DD TIR+W     + +  F GH    Q I+ L
Sbjct: 418 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL 472

>Scas_685.11
          Length = 384

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 57/113 (50%), Gaps = 13/113 (11%)

Query: 329 TDKFVIPGPGG-NLLVYTMSDSRPIGKLVGHRGTISQLEFN-----------SETKLLAS 376
           + ++++ G    ++ +Y +   + +G L+ H+G+I+ L+F+           S  K L S
Sbjct: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLS 109

Query: 377 AADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
           A++DN I +W   +  +     GH   I  +    +N + IS S D S++LW+
Sbjct: 110 ASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/287 (22%), Positives = 99/287 (34%), Gaps = 77/287 (26%)

Query: 163 VCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKIT 222
            CL ++     +   G  D T K+ +L            +  I EL    AT        
Sbjct: 402 TCLDFDAPFGTLCTAGYLDHTVKIWDLSK----------QNKIGELAGHLAT-------- 443

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLWNKE------GKLQNV--------------FNFH 262
             + C+    D  ++ TG  +  L+LWN         + QN+              F  H
Sbjct: 444 --INCMQINRDYGTLVTGGRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAH 501

Query: 263 KSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGV 322
              + A+  + S    +S   D     WD+ SG  LQ  +                    
Sbjct: 502 TDEVTALSLDPS--FLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTT----------- 548

Query: 323 DTVWVDTDKFVIPGPGGNLLVYTMSDSRP-IGKLVGHRGTISQLEFNSETKLLASAADDN 381
            +  VD  K  +          T  + RP IG L             S    LA+   D 
Sbjct: 549 -STNVDLSKSTL---------LTQRNERPSIGAL------------QSFDAALATGTKDG 586

Query: 382 TIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
            +R+W   +G  I    GHT  I SLK+ ++  L++ S D +V++WD
Sbjct: 587 VVRLWDLRSGKVIRTLKGHTDAITSLKF-DSACLVTGSYDRTVRIWD 632

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 82/213 (38%), Gaps = 45/213 (21%)

Query: 268 AIHWNSSNTHFISTDADNITI-----LWDVNSGVVLQHFESKAXXXXXXXXXXXXQMF-- 320
           AI      T  IS++A N+       L D NS   L  F SK+            Q++  
Sbjct: 327 AIRNEGVTTESISSEASNLPPRRRQQLRDDNSLNRLGAFYSKSKKRHRKSFPTFQQLYEP 386

Query: 321 --GVDTVWVDTDKFV----IPGPGGNLL----------VYTMSDSRPIGKLVGHRGTISQ 364
              + ++    D F+       P G L           ++ +S    IG+L GH  TI+ 
Sbjct: 387 GTKIGSIMSTHDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINC 446

Query: 365 LEFNSETKLLASAADDNTIRVWHGG-------------------NGNSIHCFYGHTQTIV 405
           ++ N +   L +   D  +++W+                     +   +H F  HT  + 
Sbjct: 447 MQINRDYGTLVTGGRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVT 506

Query: 406 SLKWVNNDMLISASMDGSVKLWD--CGKKLQEI 436
           +L  ++   L+S S D +++ WD   GK LQ I
Sbjct: 507 ALS-LDPSFLVSGSQDRTIRQWDLRSGKCLQTI 538

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 52/99 (52%), Gaps = 7/99 (7%)

Query: 352 IGKLVG-HRGTISQLEFNSETKLLASAAD-DNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
           IG ++  H   ++ L+F++    L +A   D+T+++W     N I    GH  TI  ++ 
Sbjct: 390 IGSIMSTHDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQ- 448

Query: 410 VNND--MLISASMDGSVKLW--DCGKKLQEITGNLIAET 444
           +N D   L++   D ++KLW  +  ++L + T NL + T
Sbjct: 449 INRDYGTLVTGGRDAALKLWNLNLAQQLYQETQNLTSPT 487

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 236 SIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNS 294
           ++ATG ++G +RLW+ + GK+      H   I ++ ++S+    ++   D    +WD+ +
Sbjct: 578 ALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSA--CLVTGSYDRTVRIWDLRT 635

Query: 295 GVV 297
           G++
Sbjct: 636 GLL 638

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 54/109 (49%), Gaps = 11/109 (10%)

Query: 331 KFVIPGPGG-NLLVYTMSDSRPIGKLVGHRGTISQLEFNSET----------KLLASAAD 379
           ++++ G    ++ +Y +   + +G L+ H G+I+ L F+  T          K L SA++
Sbjct: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSLRFSRATTDKDGKQQGNKWLLSASE 111

Query: 380 DNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
           D+TI +W   +  +     GH   I  L    ++ + S S D S++LW+
Sbjct: 112 DHTIIIWRVKDWENFGKLKGHNARINDLDIHPSNRVASVSEDHSIRLWN 160

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 3/39 (7%)

Query: 399 GHTQTIVSLKWVNNDM---LISASMDGSVKLWDCGKKLQ 434
           GHT  +   ++  N M   L+SA  DG + +WD  K+ Q
Sbjct: 270 GHTNRVKDFRFYKNSMGHYLVSAGSDGKIVVWDIVKQEQ 308

>Kwal_27.12667
          Length = 721

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 73/343 (21%), Positives = 123/343 (35%), Gaps = 96/343 (27%)

Query: 211 PFATSATTGKITNQL---------------------TCLSWAHDGDSIATGVENGELRLW 249
           PF T  T GK+ + +                     +C+    D  S+ TG  +  L+LW
Sbjct: 415 PFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQM-EDSHSLITGGRDALLKLW 473

Query: 250 N--KEGKLQN-------------VFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNS 294
           +  K  +L N              F+ H   I A+H+  ++   +S   D     WD+ +
Sbjct: 474 DIEKAEELYNDGATEGEEELCVHTFDAHVDEITALHFEGNS--LVSGSQDRTIRQWDLTT 531

Query: 295 GVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGK 354
           G  LQ  +                 F          K     P  ++L+ T +D   IG 
Sbjct: 532 GKCLQTIDIN---------------FANRGTSGGFSKISSNNPRSSILL-THNDPPVIGA 575

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW--VNN 412
           L  +               +A+   D  +R+W   +G  I    GHT  +  L++  VN 
Sbjct: 576 LQCYDAA------------MATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQFDSVN- 622

Query: 413 DMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQV 472
             L++ S+D S+++WD       +   L+A+      PI   ++  D E       +  V
Sbjct: 623 --LVTGSLDRSIRIWD-------LRTGLLADAFAYNSPI--SSLQFDLEHILVSNNESVV 671

Query: 473 TVFNLAALLKRYSKGKKHKNHVMSIPICGDFQSAHSDDSVFDL 515
            V+N           +K   H      CGD  SA S++ + + 
Sbjct: 672 QVYN-----------RKEDQHW----TCGDASSASSENDLVEF 699

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 357 GHRGTISQLEFNSETKLLASAAD-DNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDML 415
            H  +I+ L+F+     + +A   D+++++W+      I    GH  ++  ++  ++  L
Sbjct: 402 AHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQMEDSHSL 461

Query: 416 ISASMDGSVKLWDCGK 431
           I+   D  +KLWD  K
Sbjct: 462 ITGGRDALLKLWDIEK 477

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 93/234 (39%), Gaps = 39/234 (16%)

Query: 231 AHDGDSIATGVENGELRLW---NKEGKLQNVFNF---HKSPIIAIHWNSSNTH-FISTDA 283
           A++  S+ +G ++  + LW   N E  ++    F   H   I  + W+SS  H F S   
Sbjct: 189 ANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSE 248

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLV 343
           D+   L+D  S  ++ +  +K              +F        TD  V         +
Sbjct: 249 DSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAA----AGTDNLV--------YL 296

Query: 344 YTMSD-SRPIGKLVGHRGTISQLEF--NSETKLLASAADDNTIRVW-------------- 386
           Y + D S P+  + GH   ++ +EF  N++  L +S +D  TI VW              
Sbjct: 297 YDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQDEI 355

Query: 387 HGGNGNSIHCFYGHTQTI--VSLKWVNNDMLISASMDGSVKLWDCGKKLQEITG 438
             G    +    GH  +I  +++    N ++ SA  D  V++W C   +  I G
Sbjct: 356 EDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIPRIGG 409

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 3/76 (3%)

Query: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN 411
           I +L GH   +  + F+ +  + AS   D TIRVW+   G+ I  + GH  +++S+    
Sbjct: 345 IRRLTGHTDGVKGIYFDDQKMITASL--DKTIRVWNYITGSCISTYRGHQDSVLSVD-SY 401

Query: 412 NDMLISASMDGSVKLW 427
             +++SAS D +VK+W
Sbjct: 402 KKIIVSASADKTVKVW 417

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 13/106 (12%)

Query: 374 LASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDC--GK 431
           L S + DNTI++W   +G  I   +GH + +  +   +N  ++S S D S+K+WD   GK
Sbjct: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFRIVSGSHDKSIKVWDLQNGK 584

Query: 432 KLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNL 477
            +Q  TG+          PI    I D    + +G   G+V +++ 
Sbjct: 585 CIQTFTGH--------KAPIVCVGIGD--SSFVSGDELGEVKMWHF 620

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 49/86 (56%), Gaps = 9/86 (10%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLI 416
           GH   +  L+FN   +LL + + D+T+ +W   +GN I    GHT  +  + + ++  +I
Sbjct: 310 GHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDDQKMI 366

Query: 417 SASMDGSVKLWDCGKKLQEITGNLIA 442
           +AS+D ++++W+       ITG+ I+
Sbjct: 367 TASLDKTIRVWN------YITGSCIS 386

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 50/153 (32%), Gaps = 59/153 (38%)

Query: 276 THFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVW-VDTDKFVI 334
           TH +S   DN   LW+V+SG  ++                  Q   V+ VW +  D F I
Sbjct: 524 THLLSCSLDNTIKLWEVSSGRCIR-----------------TQFGHVEGVWDIAADNFRI 566

Query: 335 PGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSI 394
                                                    S + D +I+VW   NG  I
Sbjct: 567 ----------------------------------------VSGSHDKSIKVWDLQNGKCI 586

Query: 395 HCFYGHTQTIVSLKWVNNDMLISASMDGSVKLW 427
             F GH   IV +  + +   +S    G VK+W
Sbjct: 587 QTFTGHKAPIVCVG-IGDSSFVSGDELGEVKMW 618

 Score = 32.7 bits (73), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 32/175 (18%), Positives = 68/175 (38%), Gaps = 21/175 (12%)

Query: 237 IATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295
           + TG  +  + +W+ K G L      H   +  I+++  +   I+   D    +W+  +G
Sbjct: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYITG 382

Query: 296 VVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKL 355
             +  +                 +  VD+      K ++       +     +SR    L
Sbjct: 383 SCISTYRGHQDS-----------VLSVDSY----KKIIVSASADKTVKVWHVESRTCYTL 427

Query: 356 VGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH---TQTIVSL 407
            GH   ++ ++ + ++    S++DD T+R+W     + I  F GH    Q ++ L
Sbjct: 428 RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPL 482

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 231 AHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITIL 289
           A D   I +G  +  +++W+ + GK    F  HK+PI+ +     ++ F+S D      +
Sbjct: 560 AADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV--GIGDSSFVSGDELGEVKM 617

Query: 290 W 290
           W
Sbjct: 618 W 618

>Scas_713.50
          Length = 983

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 90/221 (40%), Gaps = 13/221 (5%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKEGKLQ--NVFNFHKSPIIAIHWNSSNTHFISTD 282
           LTC  +   G  +  G   GEL+L++     Q  N+   H + I ++   S     I+  
Sbjct: 472 LTC-KFLPGGMLVIIGTRAGELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGS 530

Query: 283 ADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDT---DKFVIPGPGG 339
           AD     W+      L    S                   D + V     DKF+      
Sbjct: 531 ADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVRVSPEDKFLAVSLLD 590

Query: 340 NLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           N + V+ +   +    L GH+  +  ++ + ++K++ +++ D  I++W    G+     +
Sbjct: 591 NTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLF 650

Query: 399 GHTQTIVSLKWV-NNDMLISASMDGSVKLWD-----CGKKL 433
            H  +I+++K+V  +    S S DG +K WD     C +KL
Sbjct: 651 AHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQKL 691

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 51/117 (43%), Gaps = 14/117 (11%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY 398
           G + V+ +     +  L GH   I+ L+F++    L S + D+ I VW   +   ++   
Sbjct: 128 GVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLR 187

Query: 399 GHTQTIVSLKWVNN-----------DMLISASMDGSVKLWDCGKKLQEITGNLIAET 444
            H   I  + W N            D LIS S DG +K+WD   K+Q+     IA T
Sbjct: 188 SHKDAITGI-WCNEVTNNNQEENELDWLISTSKDGLIKIWDL--KIQQCVETHIAHT 241

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 237 IATGVENGELRLWNKEGK--LQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNS 294
           +A G  +G +++W+   K  L N+ N H S I A+ +++S T  IS   D+  I+WD+ S
Sbjct: 121 LAVGYNDGVVKVWDLYSKTVLCNL-NGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVS 179

Query: 295 GVVLQHFES 303
            V L    S
Sbjct: 180 EVGLYKLRS 188

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 42/98 (42%), Gaps = 10/98 (10%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFN---------SETKLLASAADDNTIRVWHGG 389
            N++V+ +     + KL  H+  I+ +  N         +E   L S + D  I++W   
Sbjct: 170 SNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKDGLIKIWDLK 229

Query: 390 NGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLW 427
               +     HT    SL  V ND++I+ S D  VK W
Sbjct: 230 IQQCVETHIAHTGECWSLA-VRNDLVITTSSDSQVKFW 266

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 76/163 (46%), Gaps = 15/163 (9%)

Query: 318 QMFGVDTVWVDTDKFVIPGPGGNLL-VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLAS 376
            M  V T     D +VI G    ++ +Y     + + +L GH G +  L++ +   +L S
Sbjct: 367 HMTSVVTCLQFEDNYVITGADDKMIRIYDSITKKFLIELSGHDGGVWALKY-AGNGILVS 425

Query: 377 AADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND---MLISASMDGSVKLWDCGKKL 433
            + D ++R+W+   G   H F GHT T+  L  V ++    +++ S D ++ +W    KL
Sbjct: 426 GSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGVKYIVTGSRDNTLHIW----KL 481

Query: 434 QEITGNLIAETIV----DGVPIFAGAISDDRERYAAGFMDGQV 472
            +++ + I E +     +  P+F    S +   Y  G + G +
Sbjct: 482 PQMSDSNIDEGMPNVYSNNGPLFFH--SPEENPYFVGVLRGHI 522

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 22/119 (18%)

Query: 331 KFVIPGP-GGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGG 389
           + VI G    NL+V+ +   + +  L+GH   I    ++ +     SA+ D+TI++W   
Sbjct: 533 RIVISGSYDNNLIVWDIIQMKCLYILMGHTDRIYSTIYDYKRNRCISASMDSTIKIWDLQ 592

Query: 390 N-----------GNSIHC---------FYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
           N             ++ C           GHT  +V L  +++  L+SA+ DGS++ WD
Sbjct: 593 NIWNNGECVNVTNATVPCTKITGPMMTLQGHT-ALVGLLKLSDKFLVSAAADGSLRGWD 650

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 48/97 (49%), Gaps = 9/97 (9%)

Query: 351 PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWV 410
           P+  L GH   +  L+ +   K L SAA D ++R W   + +    ++ +  + ++  ++
Sbjct: 616 PMMTLQGHTALVGLLKLSD--KFLVSAAADGSLRGWDSSDYSRKFAYHHNNLSAITTFYM 673

Query: 411 NNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVD 447
            +++L+S S +G   +++        TG LI   I++
Sbjct: 674 TDNILVSGS-EGQFNIYNLR------TGKLIHSNILN 703

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 53/100 (53%), Gaps = 4/100 (4%)

Query: 329 TDKFVIPGP-GGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
           T+K ++ G     + ++ ++  + I +L GH   +  L F+ +   L + + D TIRVW+
Sbjct: 268 TNKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWN 325

Query: 388 GGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLW 427
              G  +  + GH  +++S+      +++S S D +VK+W
Sbjct: 326 YVTGACVSTYRGHQDSVLSVDSFRK-LIVSGSADKTVKVW 364

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 71/332 (21%), Positives = 125/332 (37%), Gaps = 56/332 (16%)

Query: 170 VSSNILAIGEHDST--------AKLIELETTTTD-------DQIKLI----EKTIHELRH 210
           +++ +L  G +DST         KLI   +  TD       D  KLI    +KTI    +
Sbjct: 267 LTNKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNY 326

Query: 211 PFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPIIAIH 270
                 +T +  +Q + LS       I +G  +  +++W+ E +       H   +  + 
Sbjct: 327 VTGACVSTYR-GHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVK 385

Query: 271 WNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTD 330
            +  +    S   D    +WD+ +   ++ F                         V   
Sbjct: 386 LHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH----------------------VGQV 423

Query: 331 KFVIPGPGGNLLVYTMSDS--RPIGKLVGHRGTISQLEFNSETKL---LASAADDNTIRV 385
           + VIP   G+ L+    D+   P      H  ++    F+        L S + DNTI++
Sbjct: 424 QKVIPLTLGSDLIEDPKDAVVPPDATAPAHDPSVQAANFDHSLPYPTHLLSCSLDNTIKL 483

Query: 386 WHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETI 445
           W+   G  I   +GH + +  +   +N  ++S S D S K+WD    LQ  TG  +   +
Sbjct: 484 WNVKTGACIRTQFGHVEGVWDIA-ADNFRIVSGSHDRSCKVWD----LQ--TGKCMHTFV 536

Query: 446 VDGVPIFAGAISDDRERYAAGFMDGQVTVFNL 477
               P+    I D    + +G   G V ++N 
Sbjct: 537 GIHAPVACVGIGD--SEFVSGDELGCVKLYNF 566

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN 411
           I +  GH   +  L+  +  KLL + + D+T+ +W    G  I    GHT  + +L++ +
Sbjct: 252 IQEFKGHMDGVLSLQLTN--KLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-D 308

Query: 412 NDMLISASMDGSVKLWD 428
           +  LI+ S+D ++++W+
Sbjct: 309 DQKLITGSLDKTIRVWN 325

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
           RPI  L+GH   ++Q+++N E  LL + + D +  VW+  NG  +    GH  +I S+  
Sbjct: 2   RPI-VLMGHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDS 60

Query: 410 VNNDM-LISASMDGSVKLW 427
            +  +  ++ S D ++K+W
Sbjct: 61  DHTSLYCVTGSADYTIKVW 79

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 45/238 (18%), Positives = 100/238 (42%), Gaps = 30/238 (12%)

Query: 165 LQWNPVSSNILAIGEH----DSTAKLIELETTTTDDQI-KLIEKTIHELRHPFATSATTG 219
           ++++P    ILAI ++      + ++ E++     ++I + +E+ IH        S  T 
Sbjct: 99  VEFSPCGKYILAILDNVMKKPGSIEIYEVKRNPETNEITEFVEEPIH--------SIVTH 150

Query: 220 KITNQLTCLSWAHDGDSIATGVENGELRLWNKEG--KLQNVFNFHKSPIIAIHWNSSNTH 277
           +  +  +   W+ +G  I  G ++G++  ++ +   KL      HK  +  + ++   T+
Sbjct: 151 EGLDAASVAGWSGEGKYIIAGHKDGKISKYDTQDGYKLVESQQVHKDSVSDLQFSPDRTY 210

Query: 278 FISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMF---GVDTVWVDT----- 329
           FI+   D+   + D+ +  VL+ +E+ +             +    G D   V T     
Sbjct: 211 FITCSRDSNAHIIDIETFKVLKTYETDSPLNSAAITPLKEFVILGGGQDASEVTTTSASE 270

Query: 330 DKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
            KF          +Y       IG++VGH G ++ +  + +     S  ++  +R+ H
Sbjct: 271 GKF-------EARIYHKVFEEEIGRVVGHFGPLNSIAVSPQGTSYTSGGEEGLVRLHH 321

>Scas_397.2
          Length = 410

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 50/104 (48%), Gaps = 1/104 (0%)

Query: 328 DTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
           D   +++    G++ +Y    S    +   H   I+ L+F    +++ S + D  +++W 
Sbjct: 108 DVASYIVGNEEGSISLYDSQFSHEWTQEDAHCSEITTLKFFPSGEVVLSGSSDMQLKLWS 167

Query: 388 GGNGNSIHCFYGHTQTIVSLKWVNNDM-LISASMDGSVKLWDCG 430
             + +    F GHT  I     +      +S+S+DG++KLW+CG
Sbjct: 168 IKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKLWECG 211

 Score = 35.8 bits (81), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFIST 281
           +++T L +   G+ + +G  + +L+LW+ K+     +F  H S I           F+S+
Sbjct: 140 SEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSS 199

Query: 282 DADNITILWDVNSGVVLQHF 301
             D    LW+  SG  ++ F
Sbjct: 200 SLDGTMKLWECGSGSTVRTF 219

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 97/267 (36%), Gaps = 53/267 (19%)

Query: 252 EGKLQNVFNFHKSPIIAIH-WNSSNTHFISTDADNITI-LWDVNSGVVLQHFESKAXXXX 309
           E KL   FN H S + +   W   N   +++ + + T+ +W VN    LQ F   +    
Sbjct: 210 ELKLIRSFNAHDSTVSSQKTWQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVK 269

Query: 310 XXXXXXXXQMFGVDTVWVDTDKFVIPGPGGN--------------LLVYTMSDSR----P 351
                    + G     +D+   +   P GN              +L+   SDS+    P
Sbjct: 270 SIDVLDEYILSGS----LDSTLRLTHWPSGNGLSVGTGHEFPIERVLIIPFSDSKICTSP 325

Query: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH--------------GGNGNSIHC- 396
                 H    + L F    K  ASAA DNTI++W                    +  C 
Sbjct: 326 YRDQNEHSA-FAPLRF----KYCASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCV 380

Query: 397 --FYGHTQTIVSLKWVNNDMLISASMDGSVKLWD-----CGKKLQEITGNLIAETIVDG- 448
               GHT  +  LK +  D L S S D ++K WD     C K    I  N I    +D  
Sbjct: 381 MTLRGHTSWVKDLK-LRGDHLFSCSDDETIKCWDLNTGNCVKTWSSIHNNFINCIDIDRE 439

Query: 449 VPIFAGAISDDRERYAAGFMDGQVTVF 475
             I   + S  RE   +G MD +V + 
Sbjct: 440 ATIEQFSPSLQREILVSGDMDNKVKII 466

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 94/252 (37%), Gaps = 64/252 (25%)

Query: 237 IATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295
            ATG  +  +R+W+   GKL+     H   +  I  ++ + +  S   D +   WD+   
Sbjct: 129 FATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISARHPYMFSASQDKLVKCWDLERN 188

Query: 296 VVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKL 355
            V++ F                                                   G L
Sbjct: 189 TVVRDFH--------------------------------------------------GTL 198

Query: 356 VGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND-M 414
            G    +  ++ +    L+ SA  D+ +RVW   + + +    GH   I  ++ +  D  
Sbjct: 199 SG----VHSVDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDPQ 254

Query: 415 LISASMDGSVKLWD--CGKKLQEITGNLIAETIVDGVPI---FAGAISDDRERYAAGFMD 469
           ++S S D +VKLWD   GK ++ +T +      +   P    FA A +DD   +    +D
Sbjct: 255 IVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFSFASACTDDIRSWK--LVD 312

Query: 470 GQ-VTVFNLAAL 480
           GQ +T FN  AL
Sbjct: 313 GQLLTNFNSEAL 324

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/287 (21%), Positives = 106/287 (36%), Gaps = 49/287 (17%)

Query: 160 GKAVCLQWNPVSSNILAIGEHDSTAKLIELET----TTTDDQIKLIEKTIHELRHPFATS 215
           G   C+  +PV +   A G +DST ++ +L T     T    I  +       RHP+  S
Sbjct: 114 GWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISARHPYMFS 173

Query: 216 ATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHK--SPIIAIHWNS 273
           A+  K+                        ++ W+ E +   V +FH   S + ++  + 
Sbjct: 174 ASQDKL------------------------VKCWDLE-RNTVVRDFHGTLSGVHSVDLHP 208

Query: 274 SNTHFISTDADNITILWDVNS-GVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKF 332
           S    +S   D++  +WD+ S   VL     +             Q+    T        
Sbjct: 209 SLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDPQIVSCST-------- 260

Query: 333 VIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGN 392
                   + ++ +   +P+  L  H+  +  L FN      ASA  D+ IR W   +G 
Sbjct: 261 -----DATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFSFASACTDD-IRSWKLVDGQ 314

Query: 393 SIHCFYGHTQTIVSLKWVNNDMLISASMD-GSVKLWD--CGKKLQEI 436
            +  F      IV+    N D ++ A  D G +  +D   G K Q++
Sbjct: 315 LLTNFNSEALGIVNTLACNQDGVLFAGGDTGELSFFDYKTGHKFQKL 361

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN 411
           I +L+GH   +  + +N++  +L S++ D +I+ WH  +G ++     H+  +VS+    
Sbjct: 103 IRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLSGTALKTMSAHSDAVVSIDIPK 162

Query: 412 ND--MLISASMDGSVKLWD 428
            D  +L S S DG ++++D
Sbjct: 163 FDSSILSSGSYDGLIRIFD 181

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/224 (20%), Positives = 91/224 (40%), Gaps = 32/224 (14%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNK-EGKLQNVFNFHKSPIIAIHWNSSNTHFISTDA 283
           + CL W+ D   IA+G E+  + + +   G+++ +   H +P+I+I +N+      S+  
Sbjct: 72  INCLCWSPDSKCIASGSEDFTVEITHIIYGRIRRLMG-HTAPVISICYNNKGNILCSSSM 130

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLV 343
           D     W V SG  L+   + +             +  +D    D+         G + +
Sbjct: 131 DESIKEWHVLSGTALKTMSAHS-----------DAVVSIDIPKFDSSILSSGSYDGLIRI 179

Query: 344 YTMSDSRPIGKL------VGHRGT--ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIH 395
           +       +  L      +   G   IS ++F+   K L   + DN +++W    G  + 
Sbjct: 180 FDTESGHCLKTLTYDKDWIAEDGVVPISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVR 239

Query: 396 CF-YGHTQTIVSLKW----------VNNDMLISASMDGSVKLWD 428
            F + H +T   LK+            + ++IS +  GS+ +W+
Sbjct: 240 TFLWPHQETKAKLKYNCGLELIYPQGKDPLVISGNDSGSMCVWN 283

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNND 413
           L GH+  +  ++F+ ++K+L +++ D  I++W    G+     + H  +I+S+++  +  
Sbjct: 560 LYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEADTH 619

Query: 414 MLISASMDGSVKLW-----DCGKKL 433
              S   DG+VK W     DC +KL
Sbjct: 620 NFFSCGKDGAVKRWDGDKFDCIQKL 644

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 69/163 (42%), Gaps = 20/163 (12%)

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTD--KFVIPGPGGNL 341
           D +  +WD+ S  VL  F                   GV  + +D++  + V      +L
Sbjct: 94  DGVIKVWDLLSKSVLMQFNGHKS--------------GVTVLRLDSEGTRLVSGSKDSDL 139

Query: 342 LVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH-GGNGNSIHCFYGH 400
           +++ +     + KL  H+  I+ +  +     L S A D  I+VW     G  +     H
Sbjct: 140 IIWDLVGEVGLMKLRSHKDAITGIWIDHNMDWLISVAKDGLIKVWDLKAGGQCVETHMAH 199

Query: 401 TQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAE 443
           T    S+  ++ +++I+ SMD   K+W+    L++  G  I+E
Sbjct: 200 TGQCWSMA-IDEEVIITTSMDSQAKIWEL--DLEKSNGEKISE 239

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 45/78 (57%), Gaps = 6/78 (7%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASM 420
           I  ++ +SE + LA +  DNT++V+   +       YGH   ++S+ + V++ MLI++S 
Sbjct: 525 ILAVKISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSA 584

Query: 421 DGSVKLW-----DCGKKL 433
           D ++K+W     DC K +
Sbjct: 585 DKNIKIWGVDFGDCHKSI 602

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 4/90 (4%)

Query: 343 VYTMSDSRPIGKL---VGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYG 399
           V  ++D  PIG +   +     ++ + F+ ET+LL    +D  I+VW   + + +  F G
Sbjct: 54  VEVLTDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNG 113

Query: 400 HTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
           H   +  L+       L+S S D  + +WD
Sbjct: 114 HKSGVTVLRLDSEGTRLVSGSKDSDLIIWD 143

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 49/103 (47%), Gaps = 3/103 (2%)

Query: 328 DTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
           +T+   +    G + V+ +     + +  GH+  ++ L  +SE   L S + D+ + +W 
Sbjct: 84  ETELLCVGYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWD 143

Query: 388 GGNGNSIHCFYGHTQTIVSLKWVNNDM--LISASMDGSVKLWD 428
                 +     H   I  + W++++M  LIS + DG +K+WD
Sbjct: 144 LVGEVGLMKLRSHKDAITGI-WIDHNMDWLISVAKDGLIKVWD 185

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 21/103 (20%), Positives = 44/103 (42%), Gaps = 3/103 (2%)

Query: 327 VDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
           VD+   +      N+ ++ +        +  H+ +I  + F ++T    S   D  ++ W
Sbjct: 574 VDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRW 633

Query: 387 HGGNGNSIHCFYGHTQTIVSLKWVNND--MLISASMDGSVKLW 427
            G   + I    GH   +  +  V+ D   ++S S D S+++W
Sbjct: 634 DGDKFDCIQKLNGHQSEVWCIA-VSPDGRTVVSTSHDHSIRVW 675

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 57/115 (49%), Gaps = 17/115 (14%)

Query: 331 KFVIPGPGG-NLLVYTMSDSRPIGKLVGHRGTISQLEF---------------NSETKLL 374
           ++++ G    ++ +Y +   + +G L+ H+G+I+ L+F               +  +K L
Sbjct: 117 RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPASSSEDAAVSKGSKNSKWL 176

Query: 375 ASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428
            SA++D+ I VW   +  ++    GHT  +  +     N + IS S D S++LW+
Sbjct: 177 LSASEDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTNRIAISVSDDHSIRLWN 231

>Kwal_33.15591
          Length = 714

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 77/169 (45%), Gaps = 18/169 (10%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN-D 413
           L+GH   +  L  NS    + S + D T +VW    G   H   GHT ++  +K +    
Sbjct: 101 LIGHENNVCVL--NSSQGYVLSGSWDTTAKVWF--QGALKHELKGHTASVWDVKMLPEVG 156

Query: 414 MLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVT 473
             ++AS DG++KLW+  K L+  TG  +   ++  + I A       E++A+   DG V 
Sbjct: 157 FYMTASADGTIKLWEGEKVLKTFTG--LHTDVIRHIDIDASG-----EKFASCSNDGTVK 209

Query: 474 VFNLAALLKRYSKGKKHKNHVMSIPIC--GDFQSAHSDDSVFDLSWKED 520
           + ++     +   G  H++ V S+     GD  S   D +V    WK D
Sbjct: 210 INDMEGKTLKTLVG--HESFVYSVKFAPNGDVISCGEDRTV--RIWKAD 254

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLIS 417
           H   I  ++ ++  +  AS ++D T+++ +   G ++    GH   + S+K+  N  +IS
Sbjct: 183 HTDVIRHIDIDASGEKFASCSNDGTVKI-NDMEGKTLKTLVGHESFVYSVKFAPNGDVIS 241

Query: 418 ASMDGSVKLWDCGKKLQEI 436
              D +V++W     ++++
Sbjct: 242 CGEDRTVRIWKADGTVKQV 260

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 399 GHTQTIVSLKWVNNDMLISASMDGSVKLWDCG 430
           GH Q + S+  +NND + + S DGSV+LW  G
Sbjct: 14  GHEQDVKSVAVLNNDTVATCSRDGSVRLWKKG 45

 Score = 33.1 bits (74), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 5/88 (5%)

Query: 354 KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYG-HTQTIVSLKW-VN 411
           +L GH  ++  ++   E     +A+ D TI++W G     +  F G HT  I  +    +
Sbjct: 138 ELKGHTASVWDVKMLPEVGFYMTASADGTIKLWEG--EKVLKTFTGLHTDVIRHIDIDAS 195

Query: 412 NDMLISASMDGSVKLWDC-GKKLQEITG 438
            +   S S DG+VK+ D  GK L+ + G
Sbjct: 196 GEKFASCSNDGTVKINDMEGKTLKTLVG 223

>Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement
          Length = 411

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 6/103 (5%)

Query: 331 KFVIPGPGGNLLVYTMSDSRPIGKLV--GHRGTISQLEFNSETKLLASAADDNTIRVWHG 388
           KF I    G++   T+ DS    KL   GH   I+ L+F   +++L S++ D  +++W  
Sbjct: 114 KFAIGDTMGSI---TLHDSSLKTKLSLDGHDAEITDLKFFPSSQVLLSSSLDMRLKIWSA 170

Query: 389 GNGNSIHCFYGHTQTIVSLKWVNNDM-LISASMDGSVKLWDCG 430
            +G++     GH   I   + +     ++S S DG+VKLW+CG
Sbjct: 171 LDGSNPRTIMGHKSIITGTEIIERGRNILSCSKDGTVKLWECG 213

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 30/57 (52%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCF 397
           L +++  D      ++GH+  I+  E     + + S + D T+++W  G+G +I+ F
Sbjct: 165 LKIWSALDGSNPRTIMGHKSIITGTEIIERGRNILSCSKDGTVKLWECGSGKNIYTF 221

>Kwal_27.11126
          Length = 996

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH 400
           ++V+ +   + +     H G I  +  +   K  AS +DD +I++W   +G  +   +GH
Sbjct: 163 VIVWDLESEQNLHHFTDHEGAIFFVTASKNGKYAASCSDDRSIKLWDLKSGQLLSTAWGH 222

Query: 401 TQTIVSLKWVNND-MLISASMDGSVKLWD 428
           T  I +L + +ND  +IS S D + ++WD
Sbjct: 223 TARIWNLLFFDNDSKVISVSEDCTCRVWD 251

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 361 TISQLEFNSETKLLASAADDNTIRV----WHGGNGNSIHCFYGHTQTIVSLKWVNNDMLI 416
           +I +  + S   L  SA++D T+++       G+ N+I  F  HT  +   K++NN+++I
Sbjct: 652 SIRKTPYLSNKYLFCSASEDTTVKLNALNKDTGDCNTIWTFRKHTSGLQRCKFLNNNLMI 711

Query: 417 SASMDGSVKLW 427
           +++    + LW
Sbjct: 712 TSAAREELFLW 722

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW---VNND 413
           GH   I  L F      + S ++D T RVW     N++     H   ++   W   V+N+
Sbjct: 221 GHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQASVHEGHLLKSVWGLDVDNE 280

Query: 414 MLISASM--DGSVKLWDCGKK 432
            +I+A+   DG +KL D   K
Sbjct: 281 RMIAATSGNDGRIKLTDLKAK 301

>Kwal_27.12239
          Length = 316

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 354 KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVS--LKWVN 411
           +LVGH   ++ +++  +  LL S + D +I++W   +G  +     H++ +VS  L   +
Sbjct: 94  RLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDLPPFD 153

Query: 412 NDMLISASMDGSVKLWD 428
             +L S S DG ++++D
Sbjct: 154 PSILSSGSYDGLIRIFD 170

 Score = 29.3 bits (64), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 36/79 (45%), Gaps = 2/79 (2%)

Query: 228 LSWAHDGDSIATGVENGELRLWNKE-GKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNI 286
           L W+ D   IAT  ++  + + +   G+L  +   H +P+ ++ +        S   D  
Sbjct: 64  LCWSPDSQCIATASDDFTIIITHIVFGELHRLVG-HTAPVTSVKYTMKGNLLCSCSMDES 122

Query: 287 TILWDVNSGVVLQHFESKA 305
             +WD+ SG +L+   + +
Sbjct: 123 IKIWDILSGTLLRTLSAHS 141

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 44/86 (51%), Gaps = 5/86 (5%)

Query: 352 IGKLVGHRGTISQLEF--NSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
           I  L GH  T+S  +F       LLA+ + D  +++W   NG  I  F  HTQ I SL  
Sbjct: 194 IKTLAGHEHTVSDCQFFERGADLLLATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLH- 252

Query: 410 VNNDMLISASMDGSVKL--WDCGKKL 433
           V+ + +++ S D +++L  W  G  L
Sbjct: 253 VHGEFVLTGSNDSAIRLTHWPSGNGL 278

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 65/162 (40%), Gaps = 31/162 (19%)

Query: 289 LWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSD 348
           +WD+++G  ++ F+                + G +    D+   +   P GN L   +  
Sbjct: 229 IWDISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSN----DSAIRLTHWPSGNGLSMGIGH 284

Query: 349 SRPIGKLVGHRGTISQLEFNSET---KLLASAADDNTIRVWHGGNGNSIHCFYGH----- 400
             P+ K++        L+   +    + +ASA+ D TIR+W      S+  F  H     
Sbjct: 285 DFPVEKVLILIPDPQHLQPQYQPLGFQHVASASRDGTIRLWKV----SLPKFIPHRPPRP 340

Query: 401 -----TQTIVSL-----KWVN-----NDMLISASMDGSVKLW 427
                T  ++++      WV      NDML S S DGSVK W
Sbjct: 341 NPLDTTFKVIAVLTDHNSWVRDLRQFNDMLFSCSDDGSVKCW 382

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (66%)

Query: 397 FYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKK 432
           F GH Q I+ + W  N+ +++ SMD +VKLW C +K
Sbjct: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRK 427

>Kwal_47.17465
          Length = 800

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 80/195 (41%), Gaps = 36/195 (18%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH----------GGNGNSIH---- 395
           RP+  +  H G+++ + F+ +   LAS +DD  + +W           G   +  H    
Sbjct: 13  RPLASMSRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVR 72

Query: 396 -CFYGHTQTIVSLKWV-NNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFA 453
                H   I  + W  ++ +L++  +D SV +W+ G   ++I    + +++V GV IF 
Sbjct: 73  RRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWN-GSTFEKIKRFDVHQSLVKGV-IFD 130

Query: 454 GAISDDRERYAAGFMDGQVTVFNLAALLKRYSKGKKHK---NHVMSIPICGDFQSAHSDD 510
            A     + +A    D  V +F       RY K         HV+S P  G   + +   
Sbjct: 131 PA----NKYFATASDDRTVRIF-------RYHKAGDMSFSIEHVVSEPFKGSPITTY--- 176

Query: 511 SVFDLSWKEDRLAIA 525
               LSW  D   IA
Sbjct: 177 -FRRLSWSPDGQHIA 190

 Score = 37.0 bits (84), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 69/173 (39%), Gaps = 40/173 (23%)

Query: 216 ATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNK-EGKLQNVFNFHKSPIIAIHWNSS 274
           A+  + T  +T + ++ DG+ +A+G ++  L +W K E + Q +F          HWN  
Sbjct: 16  ASMSRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAEND---KEHWNVR 72

Query: 275 NTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVI 334
               ++ D D   I W  +S ++                           V V  D+ VI
Sbjct: 73  R-RLVAHDNDIQDICWAPDSSIL---------------------------VTVGLDRSVI 104

Query: 335 PGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
                   V+  S    I +   H+  +  + F+   K  A+A+DD T+R++ 
Sbjct: 105 --------VWNGSTFEKIKRFDVHQSLVKGVIFDPANKYFATASDDRTVRIFR 149

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 373 LLASAADDNTIRVWHGGNGNSIHCFYG-HTQTIVSLKW-VNNDMLISASMDGSVKLWDCG 430
           ++A+A  D T+ VW  G    I   Y   +++I  + W  N D+L   S+DGS+  +  G
Sbjct: 290 VIATAGQDKTLVVWSTGKARPIFVAYDIASKSITDMVWNPNGDLLFLTSLDGSIITFHFG 349

Query: 431 KK 432
           +K
Sbjct: 350 EK 351

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 21/91 (23%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGN--------------------GNSIHC 396
           GH G +  +++ S T+++ SA +D ++R+W   N                    G ++  
Sbjct: 142 GHTGAVKAVKYISNTRIV-SAGNDRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAI 200

Query: 397 FYGHTQTIVSLKWVNNDMLISASMDGSVKLW 427
             GH   +VSL   +N  ++SAS D +V LW
Sbjct: 201 LEGHKAPVVSLDVASNSRILSASYDNTVALW 231

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 39/66 (59%), Gaps = 1/66 (1%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMD 421
           +S L+ + + + + S + D  +R W+  +G     + GHT  + ++K+++N  ++SA  D
Sbjct: 106 VSALDVSDDFRHIYSGSYDGVVRTWNM-SGKVEKQYSGHTGAVKAVKYISNTRIVSAGND 164

Query: 422 GSVKLW 427
            S++LW
Sbjct: 165 RSLRLW 170

 Score = 36.2 bits (82), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 62/162 (38%), Gaps = 36/162 (22%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDAD 284
           ++ L  + D   I +G  +G +R WN  GK++  ++ H   + A+ +  SNT  +S   D
Sbjct: 106 VSALDVSDDFRHIYSGSYDGVVRTWNMSGKVEKQYSGHTGAVKAVKY-ISNTRIVSAGND 164

Query: 285 NITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVY 344
               LW                                     + D  V    G      
Sbjct: 165 RSLRLWKTK----------------------------------NDDGSVSNNTGDENDEE 190

Query: 345 TMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
            + D + +  L GH+  +  L+  S +++L SA+ DNT+ +W
Sbjct: 191 NIEDGKTLAILEGHKAPVVSLDVASNSRIL-SASYDNTVALW 231

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 9/82 (10%)

Query: 354 KLVGHRGTISQLEFNSETK-LLASAADDNTIRVWHGGNGNSIHCFY--------GHTQTI 404
           +LVGH+  +  L+  SE + LL SA+ D T++VW   + + ++           G    +
Sbjct: 367 QLVGHKNFVVGLDTCSENEYLLCSASHDGTVKVWDVRSTSPMYTITRQDPTVEKGVNDKV 426

Query: 405 VSLKWVNNDMLISASMDGSVKL 426
            ++KW  +  +IS   D  +++
Sbjct: 427 FAVKWAKSIGIISGGQDKKIQI 448

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 79/193 (40%), Gaps = 21/193 (10%)

Query: 240 GVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVL 298
           G  NG + + N + G+ + V+  HK  +  I  +  N   +S   D I   +D +    L
Sbjct: 480 GSSNGGISVHNLQSGQKRKVYRLHKKAVTGIAMDGMNRKMVSCGLDGIVGFYDFSKSTFL 539

Query: 299 QHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGH 358
              +  +                       +D F +     +++V      + + +L GH
Sbjct: 540 GKLKLDSPITSMVYHRS-------------SDLFALALDDLSIVVVDSVTQKVVRQLWGH 586

Query: 359 RGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHT--QTIVSLKW-VNNDML 415
              IS  +F+ + + + S++ D+TIR W    G    C  G      I ++K+  N D+L
Sbjct: 587 SNRISSFDFSPDGRWIVSSSLDSTIRTWDLPTGG---CIDGMKVENVITNIKFSPNGDLL 643

Query: 416 ISASMDGS-VKLW 427
            + S+ G+ + LW
Sbjct: 644 ATTSVSGNGISLW 656

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 91/231 (39%), Gaps = 36/231 (15%)

Query: 250 NKEGKLQNVFNFHKSPIIAIHWNSSNTHF----ISTD------------ADNITILWDVN 293
           N++G+ +N+   HK    A  WNS         I T+              N  ++   N
Sbjct: 424 NRQGQWENILTVHKGEKFARTWNSRTKRVGRWTIPTNDEGFAKSVAISQCGNFGLVGSSN 483

Query: 294 SGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIG 353
            G+ + + +S                  +D +     K V  G  G +  Y  S S  +G
Sbjct: 484 GGISVHNLQSGQKRKVYRLHKKAVTGIAMDGM---NRKMVSCGLDGIVGFYDFSKSTFLG 540

Query: 354 KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND 413
           KL      I+ + ++  + L A A DD +I V        +   +GH+  I S  +  + 
Sbjct: 541 KL-KLDSPITSMVYHRSSDLFALALDDLSIVVVDSVTQKVVRQLWGHSNRISSFDFSPDG 599

Query: 414 M-LISASMDGSVKLWD-----C--GKKLQEI--------TGNLIAETIVDG 448
             ++S+S+D +++ WD     C  G K++ +         G+L+A T V G
Sbjct: 600 RWIVSSSLDSTIRTWDLPTGGCIDGMKVENVITNIKFSPNGDLLATTSVSG 650

>Kwal_33.15136
          Length = 473

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 74/179 (41%), Gaps = 30/179 (16%)

Query: 265 PIIAIHWNSSNTH-----------FISTDADNITILWDVNSGVVLQHFESKAXXXXXXXX 313
           PI  + W + N             F S  +DN  +L+D+ +    Q F  K         
Sbjct: 206 PITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKFVQK--------- 256

Query: 314 XXXXQMFGVDTVW--VDTDKFVIPGPGGNLLVYTMSD-SRPIGKLVGHRGTISQLEFNSE 370
                M      W  ++   FV+     N   Y M + SR +     H   +  ++F+  
Sbjct: 257 -----MRTNALCWNPMEAYNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPT 311

Query: 371 TKLLASAADDNTIRVWHGGNGNSIHCFY-GHTQTIVSLKW-VNNDMLISASMDGSVKLW 427
              + + + D TIR++   +G+S   ++    Q +  +K+ +++  ++S S DG+V++W
Sbjct: 312 GDEIVTGSYDKTIRIYQVKHGHSREIYHTKRMQHVFQVKYTMDSRYIVSGSDDGNVRMW 370

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 76/195 (38%), Gaps = 28/195 (14%)

Query: 211 PFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPIIAIH 270
           PF      G      T     H  + +AT   +G ++ WN   + + V +F K+    IH
Sbjct: 57  PFVGQLGYGHRDGVYTIAKNYHVLNKLATASADGVVKYWNMSTR-EEVCSF-KAHYGLIH 114

Query: 271 ----------WNSSNTHFISTDADNITILWDVNSGVVLQHFES--------KAXXXXXXX 312
                      N +  + +S   D    LW VN+      F S        K+       
Sbjct: 115 GLCVTPQHLSQNKNENYMLSCGDDRTVKLWSVNT----DDFSSERGDEEVIKSGNGLIKT 170

Query: 313 XXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFN-SET 371
                   G+D    +++ FV  G   NL  +  + SRPI  L      +S ++FN +ET
Sbjct: 171 FHGEHAFLGIDHHRSNSN-FVTGGAEINL--WDSTRSRPITNLSWGADNVSTVKFNQNET 227

Query: 372 KLLASAADDNTIRVW 386
            + ASA  DN++ ++
Sbjct: 228 DIFASAGSDNSVVLY 242

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 65/158 (41%), Gaps = 29/158 (18%)

Query: 168 NPVSSNILAIGEHDSTAKLIELET----TTTDDQIKLIEKTIHELRHPFATSATTGKITN 223
           +P+ +   A G +D+T K+ +L T     T    I  ++      RHP+  SA+  K+  
Sbjct: 138 DPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISKRHPYMFSASEDKL-- 195

Query: 224 QLTC---------------LSWAHDGDS------IATGVENGELRLWNKEGKLQNV-FNF 261
            + C               LS  H  D       IAT   +  +RLW+   KL  +    
Sbjct: 196 -VKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTMAG 254

Query: 262 HKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQ 299
           HKSPI  +     +   +S  AD    LWD+ +G  L+
Sbjct: 255 HKSPINRVKCLPVDPQVVSCSADATVRLWDITAGKTLK 292

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/198 (18%), Positives = 82/198 (41%), Gaps = 17/198 (8%)

Query: 233 DGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWD 291
           D +  ATG  +  +++W+   GKL+   + H   +  I  +  + +  S   D +   WD
Sbjct: 141 DNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISKRHPYMFSASEDKLVKCWD 200

Query: 292 VNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLV--YTMSDS 349
           +    V++ +                 + GV TV +     +I   G + +V  + +   
Sbjct: 201 LEKNRVIRDYHG--------------HLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTK 246

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
            P+  + GH+  I++++       + S + D T+R+W    G ++     H +++  +  
Sbjct: 247 LPVMTMAGHKSPINRVKCLPVDPQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGI 306

Query: 410 VNNDMLISASMDGSVKLW 427
              +  IS++    ++ W
Sbjct: 307 HPGEFSISSACTDDIRSW 324

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN-D 413
           L GH  T+  +  +     + SA++D  ++ W       I  ++GH   + ++      +
Sbjct: 168 LSGHIMTVKDICISKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLN 227

Query: 414 MLISASMDGSVKLWDCGKKLQEIT 437
           ++ +A  D  V+LWD   KL  +T
Sbjct: 228 LIATAGRDSVVRLWDIRTKLPVMT 251

>Kwal_14.884
          Length = 395

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 57/121 (47%), Gaps = 21/121 (17%)

Query: 329 TDKFVIPGPGG-NLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKL-------------- 373
           + ++++ G    ++ +Y +   + +G L+ H+G+I+ L+F+  TK+              
Sbjct: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGR 109

Query: 374 -----LASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLW 427
                L SA+DD+ + +W   +  +     GH   I       +N + IS S D S++LW
Sbjct: 110 GNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169

Query: 428 D 428
           +
Sbjct: 170 N 170

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLI 416
           GH+  I+ L F+     L S + D+ I +W       ++    H  +I  +   N D LI
Sbjct: 115 GHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLI 174

Query: 417 SASMDGSVKLWD 428
           S S DG +K+WD
Sbjct: 175 STSKDGLIKIWD 186

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/232 (19%), Positives = 84/232 (36%), Gaps = 64/232 (27%)

Query: 211 PFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNV-FNFHKSPIIAI 269
           P A  A + K+    T L +  + + +A G  +G +++W+   K   + FN HKS I  +
Sbjct: 65  PGAVDAKSTKLAES-TYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVL 123

Query: 270 HWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDT 329
            ++ + T  IS   D+  I+WD+   V L    S                  +  +W + 
Sbjct: 124 RFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKD--------------SITGIWCEN 169

Query: 330 DKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGG 389
           + ++I                                         S + D  I++W   
Sbjct: 170 EDWLI-----------------------------------------STSKDGLIKIWDLK 188

Query: 390 NGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLW------DCGKKLQE 435
               +     HT     L  ++ND++I+ S +  +K+W      D G KL +
Sbjct: 189 TQQCVETHMAHTSECWGLA-IHNDLVITTSTESQIKIWNLDLDKDMGSKLMK 239

>Scas_603.5
          Length = 589

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 74/158 (46%), Gaps = 29/158 (18%)

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNG----------- 391
           V+ +  +  +  L  H  +++ ++ + ++K L + + D T+++W  G             
Sbjct: 321 VWDLETNDQVMDLDDHIASVTCMQLHPDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNI 380

Query: 392 -NSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD-----CGKKLQEI----TGNLI 441
            + I+ F  HT  I S+ + +N+ L+SAS D S++ WD     C + L+      +G  I
Sbjct: 381 DSCINTFEAHTAEITSVSY-DNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNI 439

Query: 442 AETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAA 479
            ++ V+ +     A+       A G  DG + +++L +
Sbjct: 440 KDSTVEALQSVGAAL-------ATGSKDGIIRLWDLRS 470

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 45/73 (61%), Gaps = 3/73 (4%)

Query: 234 GDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDV 292
           G ++ATG ++G +RLW+ + GK+      H+ PI ++ ++S+     STDA NI++  D+
Sbjct: 451 GAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFDSTKIITGSTDA-NISV-SDL 508

Query: 293 NSGVVLQHFESKA 305
            +G +L+ +   A
Sbjct: 509 RTGNILETYHCDA 521

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 60/328 (18%), Positives = 120/328 (36%), Gaps = 80/328 (24%)

Query: 152 TLNEIFKLGKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHP 211
           TL+ ++      CL ++  +  +   G+++++ K+ +LET   +DQ+  ++  I  +   
Sbjct: 288 TLDSVYT-DTVTCLDFDLSTKMLYTAGKYNTSIKVWDLET---NDQVMDLDDHIASV--- 340

Query: 212 FATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQ-------------NV 258
                         TC+    D  ++ TG ++  L+LW+     Q             N 
Sbjct: 341 --------------TCMQLHPDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINT 386

Query: 259 FNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQ 318
           F  H + I ++ ++  N + +S   D     WD+ +G  +Q  E+               
Sbjct: 387 FEAHTAEITSVSYD--NEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDST- 443

Query: 319 MFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNS--------- 369
              V+ +             G + ++ +   + +  L+ H+G I+ L+F+S         
Sbjct: 444 ---VEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFDSTKIITGSTD 500

Query: 370 ----------------------------ETKLLASAADDNTIRVWHGGNGNSIHC--FYG 399
                                       E   L  AAD   +RV +  NG+  +C     
Sbjct: 501 ANISVSDLRTGNILETYHCDAPINTFDFENDKLVVAADTKDVRVINRNNGSHWNCDIKVP 560

Query: 400 HTQTIVSLKWVNNDMLISASMDGSVKLW 427
              T VS+K +   ++I    +G + LW
Sbjct: 561 DESTTVSVK-LKKKLMIEGRSNGVINLW 587

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 361 TISQLEFNSETKLLASAADDNT-IRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISA 418
           T++ L+F+  TK+L +A   NT I+VW     + +     H  ++  ++   ++  LI+ 
Sbjct: 296 TVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHPDSKTLITG 355

Query: 419 SMDGSVKLWDCG 430
           S D ++KLWD G
Sbjct: 356 SKDATLKLWDLG 367

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 11/98 (11%)

Query: 337 PGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAAD-DNTIRVWHGGNGNSIH 395
           PG N+L +   DS        H   ++ L+FN     L SA   D TI+VW+      + 
Sbjct: 399 PGANILSF---DS-------AHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVA 448

Query: 396 CFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKKL 433
              GH  T+  ++    + LI+   D  +K+WD  K +
Sbjct: 449 SITGHLATVSCMQMDQYNTLITGGRDALLKMWDIQKAI 486

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/272 (19%), Positives = 103/272 (37%), Gaps = 57/272 (20%)

Query: 235 DSIATGVENGELRLWNKEGKLQN-----------VFNFHKSPIIAIHWNSSNTHFISTDA 283
           +++ TG  +  L++W+ +  + N            F+ H   I A+ + ++N   +S   
Sbjct: 466 NTLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEANN--LVSGSQ 523

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLV 343
           D     WD+N+G  +Q  +                M G   +  + D  +I    G +  
Sbjct: 524 DRTIRQWDLNNGKCVQTLD----INFATGGNLSRSMIGSGFLNTNNDHPII----GAIQC 575

Query: 344 YTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQT 403
           Y  +                          LA+   D  +R+W   +G  +    GH+  
Sbjct: 576 YDAA--------------------------LATGTKDGIVRLWDLRSGRVVRTLEGHSDA 609

Query: 404 IVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERY 463
           + SL++ ++  L++ S+D S+++WD        TG L A+T     P+    +  D  + 
Sbjct: 610 VTSLQF-DSLNLVTGSLDNSIRIWDLR------TGTL-ADTFSYEHPV--TCLQFDLNKI 659

Query: 464 AAGFMDGQVTVFNLAALLKRYSKGKKHKNHVM 495
                +G V V+N       +  G +H  + +
Sbjct: 660 VVANQEGTVKVYNRQEKKHWFCGGDEHSENAV 691

>Kwal_26.7570
          Length = 218

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 351 PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW- 409
           P+    GH   +       + +   SA+ D T+R+W    G  I  F GH   ++S+   
Sbjct: 57  PVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTID 116

Query: 410 VNNDMLISASMDGSVKLWD 428
                ++SAS D +VK+W+
Sbjct: 117 RRASQIVSASRDKTVKVWN 135

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 43/91 (47%), Gaps = 8/91 (8%)

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQ 402
           ++ ++  + I + VGH+  +  +  +     + SA+ D T++VW+   G  +    GH  
Sbjct: 91  LWELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWN-TLGECMVTLLGHND 149

Query: 403 TIVSLKWVNND-------MLISASMDGSVKL 426
            +  ++   N+        +ISA MD  VK+
Sbjct: 150 WVSQVRVAPNESPEDETVTVISAGMDKVVKV 180

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 62/148 (41%), Gaps = 14/148 (9%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDM 414
           L GH G +  LE  +    L S++ D T RVW    G       GH  T+     +  D 
Sbjct: 104 LAGHSGNVCALE--ARDGQLVSSSWDQTARVWR--EGTEERALSGHNATVWHALALGYDR 159

Query: 415 LISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTV 474
            ++AS D ++KLWD  + L   T N+  + +         A++ D   +A+   DG V V
Sbjct: 160 FLTASADKTIKLWDGARDLA--TYNVHTDVVRH------LALAPDGHHFASCSNDGSVKV 211

Query: 475 FNLAALLKRYSKGKKHKNHVMSIPICGD 502
             L     R   G  H++ V  +    D
Sbjct: 212 HTLDGKTVRTFDG--HESFVYCVKYLPD 237

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLIS 417
           H   +  L    +    AS ++D +++V H  +G ++  F GH   +  +K++ +  L+S
Sbjct: 184 HTDVVRHLALAPDGHHFASCSNDGSVKV-HTLDGKTVRTFDGHESFVYCVKYLPDGGLVS 242

Query: 418 ASMDGSVKLWDCGKKLQEI 436
              D +V++WD    ++++
Sbjct: 243 CGEDKTVRVWDMSGHVRQV 261

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 24/94 (25%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGN-----------------------GNS 393
           GH G I  +++ S T+L+ SA +D T+R+W   N                       G +
Sbjct: 142 GHSGPIRAVKYISNTRLV-SAGNDRTLRLWKTKNDDLKLTSQQQAQEDDDDEVNIEDGKT 200

Query: 394 IHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLW 427
           +    GH   +VS+   +N  ++SAS D S+  W
Sbjct: 201 LAILEGHKAPVVSIDVSDNSRILSASYDNSIGFW 234

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMD 421
           +S L+    +K + S + D  +R W   +GN    + GH+  I ++K+++N  L+SA  D
Sbjct: 106 VSSLDVGDGSKHIISGSYDGIVRTWDL-SGNVQKQYSGHSGPIRAVKYISNTRLVSAGND 164

Query: 422 GSVKLW 427
            +++LW
Sbjct: 165 RTLRLW 170

 Score = 35.8 bits (81), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 237 IATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILW 290
           I +G  +G +R W+  G +Q  ++ H  PI A+ +  SNT  +S   D    LW
Sbjct: 118 IISGSYDGIVRTWDLSGNVQKQYSGHSGPIRAVKY-ISNTRLVSAGNDRTLRLW 170

 Score = 32.3 bits (72), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 9/82 (10%)

Query: 354 KLVGHRGTISQLEFNSETK-LLASAADDNTIRVWHGGNGNSIHCFY--------GHTQTI 404
           +L+GH+  +S L+   E + +L S + D T++VW   + + ++           G    +
Sbjct: 370 QLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVWDVRSTSPMYTITREDKSVQKGVNDKV 429

Query: 405 VSLKWVNNDMLISASMDGSVKL 426
            ++KW     +ISA  D  +++
Sbjct: 430 FAVKWAEKVGIISAGQDKKIQI 451

>Scas_711.11
          Length = 695

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 8/88 (9%)

Query: 211 PFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAI 269
           PF T+     I   L C   A     +ATG  +G +RLW+ + GK+      H   I  +
Sbjct: 531 PFLTTTKATAIIGALQCFDAA-----LATGTRDGIVRLWDLRAGKVVRALEGHSGSITCL 585

Query: 270 HWNSSNTHFISTDADNITILWDVNSGVV 297
            ++  N + ++   D    +WD+ SG++
Sbjct: 586 KFD--NKNIVTGSIDKTVRIWDLRSGIL 611

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 56/124 (45%), Gaps = 27/124 (21%)

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH--------------- 387
           ++ +S S+ IG++ GH  T++ ++  +   +L S   D  +++W+               
Sbjct: 399 IWDLSRSKQIGRMTGHVATVNCMQITN--NMLVSGGKDALLKLWNLNVGVQSFRNVLPTN 456

Query: 388 -------GGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD--CGKKLQEITG 438
                    + + IH F  H   I S+  V  + LIS S D +++ WD   GK LQ I  
Sbjct: 457 NSNLEPISSSASCIHTFDSHVDEITSVT-VAGENLISGSQDRTIRQWDIPSGKCLQTIDL 515

Query: 439 NLIA 442
           + +A
Sbjct: 516 SFVA 519

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 374 LASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
           LA+   D  +R+W    G  +    GH+ +I  LK+ +N  +++ S+D +V++WD
Sbjct: 552 LATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKF-DNKNIVTGSIDKTVRIWD 605

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 2/79 (2%)

Query: 357 GHRGTISQLEFNSETKLLASAAD-DNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDML 415
            H   I+ L+F+     L +A   D+ I++W       I    GH  T+  ++  NN ML
Sbjct: 370 AHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVNCMQITNN-ML 428

Query: 416 ISASMDGSVKLWDCGKKLQ 434
           +S   D  +KLW+    +Q
Sbjct: 429 VSGGKDALLKLWNLNVGVQ 447

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 52/245 (21%), Positives = 97/245 (39%), Gaps = 34/245 (13%)

Query: 237 IATGVENGELRLWNKEGKLQ---NVFNFHKSPIIAIHWNSSNTHFISTDADNITIL---- 289
           + +G ++  L+LWN    +Q   NV   + S +  I  ++S  H   +  D IT +    
Sbjct: 428 LVSGGKDALLKLWNLNVGVQSFRNVLPTNNSNLEPISSSASCIHTFDSHVDEITSVTVAG 487

Query: 290 --------------WDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDT------ 329
                         WD+ SG  LQ  +                 F   T           
Sbjct: 488 ENLISGSQDRTIRQWDIPSGKCLQTIDLSFVAIASPPIQVTDSPFLTTTKATAIIGALQC 547

Query: 330 -DKFVIPGP-GGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
            D  +  G   G + ++ +   + +  L GH G+I+ L+F++  K + + + D T+R+W 
Sbjct: 548 FDAALATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKFDN--KNIVTGSIDKTVRIWD 605

Query: 388 GGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCG-KKLQEITGNLIAETIV 446
             +G  +       + ++S+ +  N + I A+ D + K++D     LQ  T    A T  
Sbjct: 606 LRSG-ILSDMLTFEKPVLSVDFDKNKIAI-ATHDEACKVYDRQLNNLQTCTSTDEASTSD 663

Query: 447 DGVPI 451
             +P+
Sbjct: 664 PTIPV 668

>Scas_677.32
          Length = 543

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 55/98 (56%), Gaps = 4/98 (4%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNT-IRVWHGGNGNSIHCF 397
           G+++++ ++  +P+  +  H+G I+ L+ +S+  LLA+A++  T IRV++   G  ++ F
Sbjct: 249 GDIIIFNLTTLQPLMVIEAHQGDIAALQISSDGTLLATASEKGTIIRVFNVETGVKLYQF 308

Query: 398 YGHT--QTIVSLKW-VNNDMLISASMDGSVKLWDCGKK 432
              T   TI S+ +  NND L       +V ++  G K
Sbjct: 309 RRGTYPTTIYSMCFDENNDFLAVTCSSKTVHVFKLGAK 346

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 63/133 (47%), Gaps = 24/133 (18%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW------HGGN----GNSIH---- 395
           RP+  +  H G+++ ++F+ +   LAS +DD  + +W      HGG+    G   H    
Sbjct: 65  RPLASMSRHTGSVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVR 124

Query: 396 -CFYGHTQTIVSLKWV-NNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGV---- 449
                H   I  + W  ++ +L++  +D SV +W+ G   + +    + +++V GV    
Sbjct: 125 KRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWN-GLNFERLKRFDVHQSLVKGVIFDP 183

Query: 450 --PIFAGAISDDR 460
               FA A SDDR
Sbjct: 184 ANKYFATA-SDDR 195

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 31/179 (17%), Positives = 68/179 (37%), Gaps = 25/179 (13%)

Query: 231 AHDGDSIATGVENGELRLWNKEGKLQNV----------------FNFHKSPIIAIHWNSS 274
           + DG  +ATG  +G++R+W+ +  +                    + H   +  + ++  
Sbjct: 26  SPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLASMSRHTGSVTCVKFSPD 85

Query: 275 NTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFG-----VDTVWV-D 328
             +  S   D I ++W ++      H  S              ++        D  W  D
Sbjct: 86  GNYLASGSDDRILLIWAMDEE---NHGGSFGSEGEKEHWTVRKRLVAHDNDIQDICWAPD 142

Query: 329 TDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
           +   V  G   +++V+   +   + +   H+  +  + F+   K  A+A+DD T+RV+ 
Sbjct: 143 SSILVTVGLDRSVIVWNGLNFERLKRFDVHQSLVKGVIFDPANKYFATASDDRTMRVFR 201

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 16/90 (17%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHC--------------FYGHTQ 402
           GH G +  ++F S T+L+ S  +D T+R+W   N +  H                 GH  
Sbjct: 140 GHTGAVRAVKFISSTRLV-SGGNDRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQA 198

Query: 403 TIVSLKWVNNDMLISASMDGSVKLWDCGKK 432
            +VS+  V  D ++SAS D S+  W    K
Sbjct: 199 PVVSVD-VQGDRILSASYDNSIGFWSTNHK 227

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 55/107 (51%), Gaps = 11/107 (10%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMD 421
           +S L+  +E   + S + D  +R W+  +G     + GHT  + ++K++++  L+S   D
Sbjct: 106 VSALDVGAER--IVSGSYDGVVRTWNL-SGKIEKQYSGHTGAVRAVKFISSTRLVSGGND 162

Query: 422 GSVKLW----DCGKKLQEITGNLIAET--IVDG--VPIFAGAISDDR 460
            +++LW    D  K + E+ G   A T  I++G   P+ +  +  DR
Sbjct: 163 RTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGDR 209

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 234 GDSIATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILW 290
            + I +G  +G +R WN  GK++  ++ H   + A+ + SS T  +S   D    LW
Sbjct: 113 AERIVSGSYDGVVRTWNLSGKIEKQYSGHTGAVRAVKFISS-TRLVSGGNDRTLRLW 168

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 40/82 (48%), Gaps = 9/82 (10%)

Query: 354 KLVGHRGTISQLEFNSETK-LLASAADDNTIRVWHGGNGNSIHCFYGHTQT--------I 404
           +L+GH+  +  L+   E + +L SA+ D T++VW   + +SI+      Q+        +
Sbjct: 355 QLLGHKNFVVALDTCPENEYMLCSASHDGTVKVWDIRSSSSIYTITREDQSVEKGINDKV 414

Query: 405 VSLKWVNNDMLISASMDGSVKL 426
            ++KW     +IS   D  ++ 
Sbjct: 415 FAVKWAKGVGIISGGQDKKIQF 436

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 397 FYGHTQTIVSLKWV--NNDMLISASMDGSVKLWD 428
             GH   +V+L     N  ML SAS DG+VK+WD
Sbjct: 356 LLGHKNFVVALDTCPENEYMLCSASHDGTVKVWD 389

>Kwal_26.8776
          Length = 433

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/258 (17%), Positives = 99/258 (38%), Gaps = 30/258 (11%)

Query: 237 IATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295
            ATG  +  +++W+   GKL+     H   + ++  +  +    S   D +   WD+   
Sbjct: 137 FATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERN 196

Query: 296 VVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLV--YTMSDSRPIG 353
             ++ +                   GV+TV V     +I   G + +V  + +    P+ 
Sbjct: 197 AAIRDYHG--------------HFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVM 242

Query: 354 KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND 413
            L GH+  I+Q++       + S + D T+R+W    G +      H++++ ++     +
Sbjct: 243 TLAGHKSPINQVKCFPVDPQIMSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAAHPAE 302

Query: 414 MLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVT 473
             ++ +    V+ W      +   G L+     +G+ I      +       G  DG ++
Sbjct: 303 SSVATASTSDVRSW------RHSDGQLLTNYHSEGIGIINSLSVNADGVLFGGGDDGNLS 356

Query: 474 VFNLAALLKRYSKGKKHK 491
            F+       Y  G K++
Sbjct: 357 FFD-------YKSGHKYQ 367

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 1/112 (0%)

Query: 327 VDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
           VD   F        + V+ M+  +    L GH  T+  +  +    L+ SA++D  ++ W
Sbjct: 132 VDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCW 191

Query: 387 HGGNGNSIHCFYGHTQTIVSLKWVNN-DMLISASMDGSVKLWDCGKKLQEIT 437
                 +I  ++GH   + ++      D++ SA  D  V+LWD   +L  +T
Sbjct: 192 DLERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVMT 243

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 63/124 (50%), Gaps = 11/124 (8%)

Query: 322 VDTVWVDTDKFVIPGPGGNLLV-----YTMSDSRPIGKLVGHRGTISQLEFNSETKLLAS 376
           +++V  D++K ++   G + ++     +  S   P+  L+GH+G +  L F  +  ++ S
Sbjct: 57  LNSVCYDSEKELLLFGGKDTMINGVPLFATSGEDPLYTLIGHQGNVCSLSF--QDGVVIS 114

Query: 377 AADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWV--NNDMLISASMDGSVKLWDCGKKLQ 434
            + D T +VW    G+ ++    H  ++   K V  + +  ++AS D ++KLW   K ++
Sbjct: 115 GSWDKTAKVWK--EGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQNDKVIK 172

Query: 435 EITG 438
             +G
Sbjct: 173 TFSG 176

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 7/93 (7%)

Query: 352 IGKLVGHRGTISQLEF---NSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLK 408
           I  L+GH   +S ++    N++  + AS + D T+++W   NG S+  F  H+Q + S+ 
Sbjct: 246 IRSLLGHEHIVSAVKIWQKNNDVHI-ASCSRDQTVKIWDFHNGWSLKTFQPHSQWVRSID 304

Query: 409 WVNNDMLISASMDGSVKL--WDCGKKLQEITGN 439
            V  D +IS S D +++L  W  G  L   TG+
Sbjct: 305 -VLGDYIISGSHDTTLRLTHWPSGNGLSVGTGH 336

>YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing
           five WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has a region of low
           similarity to a region of S. cerevisiae Sec27p, which a
           coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles [3447 bp, 1148 aa]
          Length = 1148

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 66/175 (37%), Gaps = 13/175 (7%)

Query: 347 SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHC-FYGHTQTIV 405
           S  RP       R   SQ+++N +   + +++  N I VW    G++  C   GH  ++ 
Sbjct: 146 SPHRPFYSTSSWRSAASQVKWNYKDPNVLASSHGNDIFVWDLRKGSTPLCSLKGHVSSVN 205

Query: 406 SLKW--VNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERY 463
           S+ +       ++S+S DG+VK WD  K   E        T+    PI+ G      E Y
Sbjct: 206 SIDFNRFKYSEIMSSSNDGTVKFWDYSKSTTE-----SKRTVTTNFPIWRGRYLPFGEGY 260

Query: 464 AAGFMDGQVTVFNLAALLKRYSKGKKHKNHVMSIPICGDFQSAHSDDSVFDLSWK 518
               M G      L  L       +  K  +  I     +      D V D  W+
Sbjct: 261 CIMPMVGGNNAVYLINLCDDDDSEQNKKTKLQPI-----YAFKGHSDRVIDFLWR 310

>Kwal_33.13515
          Length = 398

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 3/75 (4%)

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLWNKEG---KLQNVFNFHKSPIIAIHWNSSNTHFI 279
           N++T L W+HDG  +  G E+GE+ L+  E    KL+     H   I  +  +  N   +
Sbjct: 193 NKVTALQWSHDGKWLYAGFESGEIVLFEVEMAAVKLKVRACGHTGAITCMKLDPDNRFLV 252

Query: 280 STDADNITILWDVNS 294
           +   D I   WD++S
Sbjct: 253 AGSLDTICSFWDLSS 267

 Score = 36.2 bits (82), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 64/319 (20%), Positives = 127/319 (39%), Gaps = 33/319 (10%)

Query: 212 FATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSP------ 265
           F +SA+T    N++  L + +  + +A   E+G L ++  +     V++  K        
Sbjct: 41  FGSSASTAIEPNRVLSLEFNNRANYLAYSREDGTLNVFRLKSDRSQVYSVIKGAQCSDVK 100

Query: 266 IIAIHWNSSNTHFISTDADNIT--ILWDVNSGVVLQHFESK-AXXXXXXXXXXXXQMFGV 322
           I +I W+   T+FI    D  +   +WD ++G +++ FE+  +            + FG 
Sbjct: 101 IRSISWHPV-TNFIMATVDRTSRISIWDASTGALIKSFETGLSSGNYKCYYSPNGKWFG- 158

Query: 323 DTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNT 382
               V+  +F +     N  + ++S     G+ +     ++ L+++ + K L +  +   
Sbjct: 159 --ALVENGEFCLFDVDKNYELCSVS-QLCAGENLASLNKVTALQWSHDGKWLYAGFESGE 215

Query: 383 IRVWH----GGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWDCGKKLQEIT 437
           I ++             C  GHT  I  +K   +N  L++ S+D     WD         
Sbjct: 216 IVLFEVEMAAVKLKVRAC--GHTGAITCMKLDPDNRFLVAGSLDTICSFWD--------L 265

Query: 438 GNLIAETIVDGVPIFAGAISDDRERYAAGFM-DGQVTVFNL---AALLKRYSKGKKHKNH 493
            ++  E +++G       +   R+  A G   D Q  ++ +   A L +  SK K  K  
Sbjct: 266 SSMCCERVINGFDTSILDLDLSRDGVAVGLCSDNQTRIYLIESGACLYEFESKNKIEKQK 325

Query: 494 VMSIPICGDFQSAHSDDSV 512
               P    F +   +D V
Sbjct: 326 FRFYPGKMSFLAVSDNDGV 344

>KLLA0D04664g 397818..399320 similar to sp|P43601 Saccharomyces
           cerevisiae YFR021w, start by similarity
          Length = 500

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 54/97 (55%), Gaps = 4/97 (4%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNT-IRVWHGGNGNSIHCF 397
           G+++V+ +   +P   +  H+G I+ L+ +++  LLA+A++  T IRV++  NG+ ++ F
Sbjct: 220 GDVIVFNLQTLQPTMVIEAHKGEIAALKLSADGTLLATASEKGTIIRVFNVENGSKVYQF 279

Query: 398 YGHT--QTIVSLKWV-NNDMLISASMDGSVKLWDCGK 431
              T    I SL +  +N  L   S   +V ++  GK
Sbjct: 280 RRGTYPTKISSLSFSKDNQFLAVCSSSKTVHIFKLGK 316

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 374 LASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW--VNNDMLISASMDGSVKLWD 428
           LA+   D  +R+W   +G  +    GHT  I SL++  VN   L++ +MD S+++WD
Sbjct: 570 LATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSVN---LVTGAMDRSIRIWD 623

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 357 GHRGTISQLEFNSETKLLASAAD-DNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDML 415
            H   I+ L+F+     + SA   D++++VW       I   +GH  +I  ++      L
Sbjct: 395 AHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYSTL 454

Query: 416 ISASMDGSVKLWDCGKKLQEITGN 439
           I+   D  +KLWD  K + +   N
Sbjct: 455 ITGGRDAVLKLWDIDKAMADEASN 478

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 8/78 (10%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDA 283
           L C   A     +ATG ++G +RLW+ + GK+  +   H   I ++ ++S N   ++   
Sbjct: 563 LQCFDAA-----LATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSVN--LVTGAM 615

Query: 284 DNITILWDVNSGVVLQHF 301
           D    +WD+ +G++   F
Sbjct: 616 DRSIRIWDLRTGILSDVF 633

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 45/227 (19%), Positives = 88/227 (38%), Gaps = 37/227 (16%)

Query: 236 SIATGVENGELRLWNKEGKLQN--------------VFNFHKSPIIAIHWNSSNTHFIST 281
           ++ TG  +  L+LW+ +  + +               F+ H   I AI ++  N   +S 
Sbjct: 453 TLITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAISFDGDN--LVSG 510

Query: 282 DADNITILWDVNSGVVLQHFE---------SKAXXXXXXXXXXXXQMFGVDTVWVDTDKF 332
             D     WD+NSG   Q  +         S+             +   +  +       
Sbjct: 511 SQDRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRNSVLLTKEPPAIGALQCFDAAL 570

Query: 333 VIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGN 392
                 G + ++ +   + +  L GH   I+ L+F+S    L + A D +IR+W    G 
Sbjct: 571 ATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSVN--LVTGAMDRSIRIWDLRTG- 627

Query: 393 SIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKL--------WDCGK 431
            +   + + Q I SL + + D ++ ++ + +VK+        W CG+
Sbjct: 628 ILSDVFAYEQPITSLHF-DLDKIVISNNEPTVKIYNRKDGNHWFCGE 673

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 70/165 (42%), Gaps = 30/165 (18%)

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW-------------HGG 389
           V+ +S  + I  L GH  +IS ++ +  + L+ +   D  +++W                
Sbjct: 424 VWDLSKKKQIATLHGHLASISCMQIDQYSTLI-TGGRDAVLKLWDIDKAMADEASNSSED 482

Query: 390 NGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD--CGKKLQEI-----TGNLIA 442
           N   ++ F  H   I ++ + + D L+S S D +V+ WD   GK  Q I     TG + +
Sbjct: 483 NDACLYTFDSHVDEITAISF-DGDNLVSGSQDRTVRQWDLNSGKCTQTIDISFATGPMRS 541

Query: 443 E--------TIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAA 479
           +         ++   P   GA+       A G  DG V +++L +
Sbjct: 542 QRNIPLRNSVLLTKEPPAIGALQCFDAALATGTKDGIVRLWDLRS 586

>YER066W (YER066W) [1497] chr5 (290240..290797) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has high similarity to a
           region of S. cerevisiae Cdc4p, which is a component of
           the SCF-Cdc4p complex involved in ubiquitin-dependent
           degradation [558 bp, 185 aa]
          Length = 185

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 44/94 (46%), Gaps = 21/94 (22%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGN-GNSIHCFY--------------- 398
           L GH   I    ++ E K   SA+ D TIR+W   N  N+  C Y               
Sbjct: 7   LSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILGAM 66

Query: 399 ----GHTQTIVSLKWVNNDMLISASMDGSVKLWD 428
               GH + +V L  +++  L+SAS+DGS++ WD
Sbjct: 67  YTLRGH-RALVGLLGLSDKFLVSASVDGSIRCWD 99

 Score = 35.0 bits (79), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 50/99 (50%), Gaps = 14/99 (14%)

Query: 344 YTMSDSRPIGKLVG-------HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHC 396
           Y  + + P  K++G       HR  +  L  +   K L SA+ D +IR W   N   +  
Sbjct: 51  YATNSASPCAKILGAMYTLRGHRALVGLLGLSD--KFLVSASVDGSIRCW-DANTYFLKH 107

Query: 397 FYGHTQ--TIVSLKWVNNDMLISASMDGSVKLWDCGKKL 433
           F+ HTQ  TI +L  V++++L+S S +G + ++D    L
Sbjct: 108 FFDHTQLNTITALH-VSDEVLVSGS-EGLLNIYDLNSGL 144

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 68/149 (45%), Gaps = 10/149 (6%)

Query: 352 IGKLVGHRGTISQLEFNSET-KLLASAADDNTIRVWHGGNGNS-IHCFYGHTQTIVSLKW 409
           I +  GH+   + L F  +T  LL S  +DN I++W   +    +  + GH+ TI  L +
Sbjct: 128 IAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNF 187

Query: 410 VNND-MLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFM 468
            +N     SAS D  VK+W+  K      G +      + VP        D+ +   G  
Sbjct: 188 TDNGHSFASASFDKWVKIWNTEK------GIIDKRLRFNSVPNCITFHPKDKNQLVVGLS 241

Query: 469 DGQVTVFNLAALLKRYSKGKKHKNHVMSI 497
           + ++  ++L  L + + + +K+ +H  SI
Sbjct: 242 NSEIRHYDL-RLSENHGEVQKYDHHQGSI 269

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 48/252 (19%), Positives = 94/252 (37%), Gaps = 24/252 (9%)

Query: 234 GDSIATGVENGELRLWN--KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWD 291
           G  + +G  +  ++LW+   E +L   +  H   I  +++  +   F S   D    +W+
Sbjct: 148 GHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNFTDNGHSFASASFDKWVKIWN 207

Query: 292 VNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRP 351
              G++ +     +                      D ++ V+      +  Y +  S  
Sbjct: 208 TEKGIIDKRLRFNSVPNCITFHPK------------DKNQLVVGLSNSEIRHYDLRLSEN 255

Query: 352 IG---KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLK 408
            G   K   H+G+I  L++  + K L S+++D T+R+W       I    G  Q   S+ 
Sbjct: 256 HGEVQKYDHHQGSILALKYFPDGKKLISSSEDKTVRIWENRINIPIKQISGTAQH--SMP 313

Query: 409 WVN----NDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYA 464
           W++         + SMD ++  +    K +             G  I   A S D +  A
Sbjct: 314 WIDINPQGQSFCTQSMDNTIYTYSMLPKYKRHPNKTFKGHNTTGYGIHF-AFSPDGQYIA 372

Query: 465 AGFMDGQVTVFN 476
           +G   GQ  +++
Sbjct: 373 SGDSKGQTFIWD 384

>Scas_693.22
          Length = 1145

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 8/111 (7%)

Query: 347 SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNS-IHCFYGHTQTIV 405
           S  RP       R   SQ+++N +   + ++A  N I +W    G++ +H   GH  ++ 
Sbjct: 149 SPHRPFYTTSAWRSGASQVKWNYKDSNILASAHSNDIYIWDLRMGSTPLHKLVGHDSSVN 208

Query: 406 SLKW--VNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAG 454
           S+ +    +  ++S+S DG+VK WD  K     T      T+    PI+ G
Sbjct: 209 SIDFNRFKSSEIMSSSNDGTVKFWDISKGSDNCTS-----TVSTDFPIWRG 254

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 16/113 (14%)

Query: 328 DTDKFVIPGPGGNLLVYTMSDSRPIG---KLVGHRGTISQLEFNSETKLLASAADDNTIR 384
           +T K V  G G  + ++   D+   G    L GH   ++ + F   T ++ SA++D  +R
Sbjct: 22  ETTKVVAYGAGKTIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVR 81

Query: 385 VWH-----GGNGNSIHCF-----YGHTQTIVSLKWVNNDMLISASMDGSVKLW 427
           VW+      G+ + + C      + HT T+ +   V  ++L+    DGS+ +W
Sbjct: 82  VWNFPKLREGHMDEVECIQVIKHHKHTITVFA---VLKNLLVVGCADGSISVW 131

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 352 IGKLVGHRGTISQLEFNSETKLLASAADDN-----TIRVWHGGNGNSI-HCFYGHTQTIV 405
           I KL GH   IS ++ + + KL+A+A   N      IR++   N N +      H  TI 
Sbjct: 552 IEKLYGHGYEISCIDVSPDRKLIATACKSNNAQHAVIRLFDAENWNQLPQVLPFHNLTIT 611

Query: 406 SLKWV-NNDMLISASMDGSVKLWD 428
            L++  +N  L+S S D    LW+
Sbjct: 612 KLRFSKDNRYLLSVSRDRLWSLWE 635

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 10/91 (10%)

Query: 224 QLTCLSWAHDGDSIATGV-----ENGELRLWNKEG--KLQNVFNFHKSPIIAIHWNSSNT 276
           +++C+  + D   IAT       ++  +RL++ E   +L  V  FH   I  + ++  N 
Sbjct: 561 EISCIDVSPDRKLIATACKSNNAQHAVIRLFDAENWNQLPQVLPFHNLTITKLRFSKDNR 620

Query: 277 HFISTDADNITILWDV---NSGVVLQHFESK 304
           + +S   D +  LW+    N+  VL+ F+ K
Sbjct: 621 YLLSVSRDRLWSLWERNFDNNSFVLRSFKEK 651

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 7/74 (9%)

Query: 362 ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFY---GHTQTIVSLKWVN-NDMLIS 417
           +S LE    TK++A  A   TI +W   + +    F    GHT  +  +++V   DM++S
Sbjct: 17  VSDLE--ETTKVVAYGAG-KTIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVS 73

Query: 418 ASMDGSVKLWDCGK 431
           AS D  V++W+  K
Sbjct: 74  ASEDFEVRVWNFPK 87

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/276 (20%), Positives = 95/276 (34%), Gaps = 79/276 (28%)

Query: 165 LQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQ 224
           + W P  SNILA G  DST  +   +    +D+  L  + +          A      N+
Sbjct: 63  VAWRP-HSNILAAGSFDSTVSIWGKDDDGYNDENDLETELL----------AIIEGHENE 111

Query: 225 LTCLSWAHDGDSIATGVENGELRLW-----NKEGKLQNVFNFHKSPIIAIHWNSSNTHFI 279
           + C++W+HDG+ +AT   +  + +W      +E +  +V   H   +  + W+ S     
Sbjct: 112 IKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLA 171

Query: 280 STDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGG 339
           S+  D+                                       +W D D         
Sbjct: 172 SSSYDDTV------------------------------------RIWKDCD--------- 186

Query: 340 NLLVYTMSDSRPIGKLVGHRGTI--SQLEFNSETKLLASAADDNTIRVW--HGGNGNSIH 395
                   D      L GH GT+  S  E ++    L S +DD T+R+W     NG    
Sbjct: 187 -------DDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQ 239

Query: 396 CFY-------GHTQTIVSLKWVNNDMLISASMDGSV 424
            +         HT+ + S+ W     + S   DG +
Sbjct: 240 EWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRL 275

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHC--FYGHTQTIVSL-- 407
           I  L  H   +  + ++    LLAS++ D+T+R+W   + +   C    GH  T+ S   
Sbjct: 148 ISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDF 207

Query: 408 -KWVNNDMLISASMDGSVKLW 427
            K  +N  L S S DG+V++W
Sbjct: 208 EKSNSNVRLCSGSDDGTVRIW 228

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGN-GNSIHC---FYGHTQTIVSLKWVNN 412
           GH   I  + ++ + +LLA+ + D ++ +W     G    C      H+Q +  + W  +
Sbjct: 107 GHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQS 166

Query: 413 -DMLISASMDGSVKLW-DC 429
             +L S+S D +V++W DC
Sbjct: 167 LPLLASSSYDDTVRIWKDC 185

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 55/126 (43%), Gaps = 20/126 (15%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVW----HGGNGNS------IHCFYGHTQTIVS 406
            H+ T+  + +   + +LA+ + D+T+ +W     G N  +      +    GH   I  
Sbjct: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114

Query: 407 LKWVNN-DMLISASMDGSVKLW---------DCGKKLQEITGNLIAETIVDGVPIFAGAI 456
           + W ++ ++L + S D SV +W         +C   LQE + ++        +P+ A + 
Sbjct: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174

Query: 457 SDDRER 462
            DD  R
Sbjct: 175 YDDTVR 180

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 66/152 (43%), Gaps = 14/152 (9%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH 400
           L ++ ++      + VGH+  +  ++ + +  ++ S + D TI+VW    G  +    GH
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWT-IKGQCLATLLGH 147

Query: 401 TQTIVSLKWVNND-------MLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFA 453
              +  ++ V N+        +ISA  D  VK W+  +   E      A+ I     I  
Sbjct: 148 NDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIE------ADFIGHNSNINT 201

Query: 454 GAISDDRERYAAGFMDGQVTVFNLAALLKRYS 485
              S D    A+   DG++ ++NLAA    Y+
Sbjct: 202 LTASPDGTLIASAGKDGEIMLWNLAAKKAMYT 233

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 2/91 (2%)

Query: 351 PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW- 409
           P+    GH   +      ++     SA+ D T+R+W    G +   F GH   ++S+   
Sbjct: 57  PVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

Query: 410 VNNDMLISASMDGSVKLWDC-GKKLQEITGN 439
               M+IS S D ++K+W   G+ L  + G+
Sbjct: 117 KKASMIISGSRDKTIKVWTIKGQCLATLLGH 147

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 91/247 (36%), Gaps = 43/247 (17%)

Query: 277 HFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDK---FV 333
           + +S   D    LWDV +G   Q F                     D + VD DK    +
Sbjct: 79  YALSASWDKTLRLWDVATGETYQRFVGHKS----------------DVMSVDIDKKASMI 122

Query: 334 IPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEF------NSETKLLASAADDNTIRVWH 387
           I G     +       + +  L+GH   +SQ+        + ++  + SA +D  ++ W+
Sbjct: 123 ISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWN 182

Query: 388 GGNGNSIHCFYGHTQTIVSLKWVNNDMLI-SASMDGSVKLWDCGKKLQEITGNLIAETIV 446
                    F GH   I +L    +  LI SA  DG + LW+   K    T +   E   
Sbjct: 183 LNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDE--- 239

Query: 447 DGVPIFAGAISDDRERYAAGF--------MDGQVTVFNLAALLKRYSKGKKHKNHVMSIP 498
               +F+ A S +R   AA          +D Q  V +L      YSK  +   H +S+ 
Sbjct: 240 ----VFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEP--HAVSLA 293

Query: 499 ICGDFQS 505
              D Q+
Sbjct: 294 WSADGQT 300

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 74/179 (41%), Gaps = 30/179 (16%)

Query: 265 PIIAIHWNSSNTHFI-----------STDADNITILWDVNSGVVLQHFESKAXXXXXXXX 313
           PI  + W + N + +           ST +DN  +L+D+ +    Q              
Sbjct: 204 PISNLSWGADNINHVRFNQNEVDILASTGSDNSVVLYDLRTNSPTQKI------------ 251

Query: 314 XXXXQMFGVDTVW--VDTDKFVIPGPGGNLLVYTMSD-SRPIGKLVGHRGTISQLEFNSE 370
                M      W  V+   FVI     N   Y M + S+ +     H   +  ++F+  
Sbjct: 252 --VQTMRTNSICWNPVEAFNFVIANEDHNAYYYDMRNMSKALHVFKDHVSAVMDVDFSPT 309

Query: 371 TKLLASAADDNTIRVWHGGNGNSIHCFY-GHTQTIVSLKW-VNNDMLISASMDGSVKLW 427
              + + + D TIR++   +G+S   ++    Q I  +K+ +++  ++S S DG+V+LW
Sbjct: 310 GDEVVTGSYDKTIRIYQVKHGHSREIYHTKRMQHIFQVKYTMDSKYIVSGSDDGNVRLW 368

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 76/181 (41%), Gaps = 30/181 (16%)

Query: 263 KSPIIAIHWNSSNTHFI-----------STDADNITILWDVNSGVVLQHFESKAXXXXXX 311
           K P+  + W   N  F+           ST +DN  +L+D+ +    Q            
Sbjct: 206 KKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLYDLRTNSPTQ------------ 253

Query: 312 XXXXXXQMFGVDTVW--VDTDKFVIPGPGGNLLVYTMSD-SRPIGKLVGHRGTISQLEFN 368
                 +M      W  ++   F I     N   Y M + SR +     H   +  ++F+
Sbjct: 254 --KVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFS 311

Query: 369 SETKLLASAADDNTIRVWHGGNGNSIHCFY-GHTQTIVSLKW-VNNDMLISASMDGSVKL 426
              + + + + D TIR+++  +G+S   ++    Q +  +K+ +++  ++S S DG+V+L
Sbjct: 312 PTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQHVFQVKFTMDSKYIVSGSDDGNVRL 371

Query: 427 W 427
           W
Sbjct: 372 W 372

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 61/154 (39%), Gaps = 14/154 (9%)

Query: 351 PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW- 409
           P+    GH   +             S + D T+R+W    G +   F GH   ++S+   
Sbjct: 57  PVKSFKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAID 116

Query: 410 VNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETI-----VDGVPIFAGAISDDRERYA 464
               M+IS S D S+K+W        I G+ +A  I     V  V I   +  DD+    
Sbjct: 117 KKASMIISGSRDKSIKVW-------SIKGDCLATLIGHNDWVSQVRIANSSDDDDKVTVI 169

Query: 465 AGFMDGQVTV-FNLAALLKRYSKGKKHKNHVMSI 497
           +   D  V V +N AA +  Y+     + + +S 
Sbjct: 170 SAGNDKMVKVLWNSAAKVPMYTLSAGDEVYALSF 203

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 63/144 (43%), Gaps = 16/144 (11%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH 400
           L ++ ++        VGH+G +  +  + +  ++ S + D +I+VW    G+ +    GH
Sbjct: 89  LRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIKVWS-IKGDCLATLIGH 147

Query: 401 TQTIVSLKWVNND------MLISASMDGSVK-LWDCGKKLQEITGNLIAETIVDGVPIFA 453
              +  ++  N+        +ISA  D  VK LW+   K+          T+  G  ++A
Sbjct: 148 NDWVSQVRIANSSDDDDKVTVISAGNDKMVKVLWNSAAKVPMY-------TLSAGDEVYA 200

Query: 454 GAISDDRERYAAGFMDGQVTVFNL 477
            + S +R    A    G + +F+L
Sbjct: 201 LSFSPNRYWLCAATASG-IKIFSL 223

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 62/128 (48%), Gaps = 4/128 (3%)

Query: 354 KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND 413
           KL GH   +  + FN +  LL +A+ D +I+ W   +G  +     H+  +VS+   + D
Sbjct: 91  KLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTLLKTMSAHSDPVVSIDTPDCD 150

Query: 414 --MLISASMDGSVKLWDC--GKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMD 469
             +L S S DG ++++D   G  L+ +T +   +T    VPI     S + +      +D
Sbjct: 151 ATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVVPISQVKFSRNGKFLLVRSLD 210

Query: 470 GQVTVFNL 477
           G V +++ 
Sbjct: 211 GVVKLWDF 218

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 37/77 (48%), Gaps = 2/77 (2%)

Query: 228 LSWAHDGDSIATGVENGELRLWNKE-GKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNI 286
           + W+ D   +A+G E+  + + + E G+L      H +P++++ +N       +   D  
Sbjct: 61  ICWSPDSACVASGSEDFTVEITHLEYGRLHK-LRGHSAPVLSVVFNCKGNLLCTASVDES 119

Query: 287 TILWDVNSGVVLQHFES 303
              WDV SG +L+   +
Sbjct: 120 IKQWDVLSGTLLKTMSA 136

>CAGL0K10692g 1039413..1040930 similar to sp|P43601 Saccharomyces
           cerevisiae YFR021w, start by similarity
          Length = 505

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNT-IRVWHGGNGNSIHCF 397
           G++++Y MS  +P+  +  H+G I+ L F+ +  L+A+A++  T IRV+   +G  ++ F
Sbjct: 228 GDVIIYDMSTLQPLMVIEAHKGEIAALNFSFDGSLIATASEKGTIIRVFSTSSGAKLYQF 287

Query: 398 YGHT--QTIVSLKWVNNDMLISAS 419
              T    I SL +  ++  +S +
Sbjct: 288 RRGTYPTKIYSLSFSQDNRFLSVT 311

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 75/186 (40%), Gaps = 22/186 (11%)

Query: 249 WNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITI-LWDVNSG----VVLQHFES 303
           W+   KL  V N H   +  +  +  +  + +T +++ TI +WD+ +G     ++ H  S
Sbjct: 108 WHAPWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMS 167

Query: 304 KAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTIS 363
                          MF         DK V          + +  +  I    GH   + 
Sbjct: 168 ---VRDIAISKRHPYMFSASE-----DKLV--------KCWDLERNTAIRDFHGHLSGVH 211

Query: 364 QLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND-MLISASMDG 422
            ++ +    ++A+A  D  +R+W   + + I    GH   I  +K +  D  +IS S D 
Sbjct: 212 TVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDPQIISCSGDA 271

Query: 423 SVKLWD 428
           +V+LWD
Sbjct: 272 TVRLWD 277

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/288 (20%), Positives = 110/288 (38%), Gaps = 32/288 (11%)

Query: 233 DGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWD 291
           D +  ATG  +  +++W+   GKL+     H   +  I  +  + +  S   D +   WD
Sbjct: 134 DNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASEDKLVKCWD 193

Query: 292 VNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLV--YTMSDS 349
           +     ++ F                 + GV TV V     +I   G + +V  + +   
Sbjct: 194 LERNTAIRDFHG--------------HLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSR 239

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW 409
             I  L GH+  I++++       + S + D T+R+W    G +      H++ I  L  
Sbjct: 240 SEIMVLPGHKSPINKVKCLPVDPQIISCSGDATVRLWDIIAGKASKVLTHHSRNIRDLTL 299

Query: 410 VNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMD 469
              +   ++     V+ W    KL E  G L+         I      +      AG  D
Sbjct: 300 HPAEFSFASVSTNDVRSW----KLPE--GQLLTNFQSQNTGILNTVSINHDNVLLAGGDD 353

Query: 470 GQVTVFNLAALLKRYSKGKKHKNHVMSIPICGDFQSAHSD-DSVFDLS 516
           G +  ++       Y  G K+++ +M+  + G  +S  S   S FD++
Sbjct: 354 GTLCFYD-------YKTGHKYQS-MMTTEVAGSLESERSILCSTFDVT 393

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 68/173 (39%), Gaps = 31/173 (17%)

Query: 149 FAKTLNEIFKLGKAVCLQWNPVSSNILAIGEHDSTAKLIELET----TTTDDQIKLIEKT 204
            +K +N      + VC+  +PV +   A G +D+T K+ +L       T    +  +   
Sbjct: 114 LSKVINGHTGWVRCVCV--DPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDI 171

Query: 205 IHELRHPFATSATTGKITNQLTC---------------LSWAHDGDS------IATGVEN 243
               RHP+  SA+  K+   + C               LS  H  D       IAT   +
Sbjct: 172 AISKRHPYMFSASEDKL---VKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRD 228

Query: 244 GELRLWNKEGKLQ-NVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295
             +RLW+   + +  V   HKSPI  +     +   IS   D    LWD+ +G
Sbjct: 229 AVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDPQIISCSGDATVRLWDIIAG 281

>CAGL0F07337g complement(714870..716735) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 621

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 83/212 (39%), Gaps = 28/212 (13%)

Query: 243 NGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHF 301
           N  L LWN   G+   +  + +  I ++HW+  + H     +D  T +WDV +  +++  
Sbjct: 272 NDSLYLWNGNNGEATLLKEYEECQITSVHWSDDDCHISIGKSDGNTEIWDVETSTLVRTM 331

Query: 302 ESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVG---- 357
            SK                     W++T    +   G       ++D R    +V     
Sbjct: 332 RSKLNVRIGSQS------------WLET----LLATGFRSGEIQINDVRIKDHIVNTWDE 375

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW--VNNDML 415
           H G +  L + ++   LAS  +DNT+ +W             H+  + +L W   N  +L
Sbjct: 376 HTGEVCGLSYKADGLQLASGGNDNTMMIWDTRTSMPQFVKKDHSAAVKALAWSPTNAGLL 435

Query: 416 IS--ASMDGSVKLWDC--GKKLQEI-TGNLIA 442
            S     D  +  W+   G KL  I TG+ ++
Sbjct: 436 ASGGGQTDQQIHFWNSTTGAKLHTINTGSQVS 467

>Scas_701.45
          Length = 1276

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 115/279 (41%), Gaps = 36/279 (12%)

Query: 228 LSWAHDGDSIATGVE-NGELRLWNKEGKLQNV-------FNFHKSPIIAIHWNSSNTHFI 279
           L W+ D   IA  ++ NG++ L++KE     +       F  H + +  + +N    + +
Sbjct: 70  LDWSFDNKFIAGALDDNGKIELFSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVL 129

Query: 280 STDADNITIL-WDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPG 338
           ++  +N  IL WD+N  +    +   A             +      W  +   V    G
Sbjct: 130 ASAGNNGEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSV-----SWNKSLAHVFASAG 184

Query: 339 GNLLVYTMSDSRPIGKLV---------GHRGTISQLEFNSE-TKLLASAA---DDNTIRV 385
                 ++ D +   +++         G +  ++ +E++ + T  +A+A+    D  I +
Sbjct: 185 DTTTYASIWDLKAKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDPVILI 244

Query: 386 WHGGNGN-SIHCFYG-HTQTIVSLKWVNND--MLISASMDGSVKLWDCGKKLQEITGNLI 441
           W   N N  +    G HT+ I+SL W   D  +L+S+  DG V LWD   K  E++    
Sbjct: 245 WDLRNSNMPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWDT--KANEVSTTYP 302

Query: 442 AETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAAL 480
             +       FA    ++ + +A+   DGQ+ V  L  L
Sbjct: 303 TRSQWCFKTKFA---PENPDIFASAGFDGQINVNTLQDL 338

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/239 (20%), Positives = 85/239 (35%), Gaps = 43/239 (17%)

Query: 258 VFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXX 317
           +   H + I    W+  +   +S   D   I+WD  +G+                     
Sbjct: 80  ILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGL-------------------KR 120

Query: 318 QMFGVDTVWVDTDKFVIPGP-------GGNLLVYTMSDSRPIGKLV-----GHRGTISQL 365
               +D+ WV T      G          N  +Y M     + + V     GH G IS +
Sbjct: 121 SAIPLDSQWVLTCALSPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGV 180

Query: 366 EFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLK-----WVNNDMLISASM 420
           EF SE++++ S+  D T  +W       +  +  H   ++++         N+M  S   
Sbjct: 181 EFVSESRVVTSSG-DMTCALWDIPKAKRVREYSDHLGDVLAISIPVTNLSKNNMFASCGS 239

Query: 421 DGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAA 479
           DG   +WD  +    +    I     + +  F      D    A G  DG +++F+L A
Sbjct: 240 DGYTFIWDV-RSPSAVQQFSIGSCDSNCLKFFP-----DGNSVAVGNDDGTISLFDLRA 292

 Score = 35.8 bits (81), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 89/220 (40%), Gaps = 59/220 (26%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNG------------------ 391
           +P+G L GH   I+   ++ ++KL+ SA+ D  + VW    G                  
Sbjct: 76  KPVGILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKRSAIPLDSQWVLTCAL 135

Query: 392 -----------------------------NSIHCFYGHTQTIVSLKWVNNDMLISASMDG 422
                                        N    F GHT  I  +++V+   ++++S D 
Sbjct: 136 SPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVSESRVVTSSGDM 195

Query: 423 SVKLWDC--GKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNL--A 478
           +  LWD    K+++E + +L  + +   +P+   +       +A+   DG   ++++   
Sbjct: 196 TCALWDIPKAKRVREYSDHL-GDVLAISIPVTNLS---KNNMFASCGSDGYTFIWDVRSP 251

Query: 479 ALLKRYSKGKKHKNHVMSIPICGDFQSAHSDD---SVFDL 515
           + ++++S G    N +   P  G+  +  +DD   S+FDL
Sbjct: 252 SAVQQFSIGSCDSNCLKFFPD-GNSVAVGNDDGTISLFDL 290

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 359 RGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLI-S 417
           RG IS L+F+   +L+ S   +   +VW    G  ++   GH   +  +K   + M I +
Sbjct: 341 RGVIS-LDFSGSGRLMYSCYINLGCQVWDVLKGEVVYSLEGHGNRLAGVKCSPDGMAICT 399

Query: 418 ASMDGSVKLW 427
            S D ++KLW
Sbjct: 400 GSWDQTLKLW 409

>Kwal_33.13148
          Length = 673

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 48/126 (38%), Gaps = 31/126 (24%)

Query: 337 PGGNLLVYTMSDSRP-------------IGKLVGHRGT--ISQLEFNSETKLLASAADDN 381
           PGG L    + + +P             + K  G R    I +  F  + KL+AS ++D 
Sbjct: 547 PGGQLSSLLLVNVQPHELQLWDFKEQILVQKYYGQRQLQFIIRSCFGYDNKLIASGSEDG 606

Query: 382 TIRVWHGGNGNSIHCFYGHTQ----------------TIVSLKWVNNDMLISASMDGSVK 425
            I +W   +GN I    GH                   IV+    N DM  S   DGS+K
Sbjct: 607 KIYIWDRFHGNIIGVINGHITDRPLALNAVNTFGRNCNIVAWNPANKDMFASGGDDGSIK 666

Query: 426 LWDCGK 431
           +W   +
Sbjct: 667 IWSVSR 672

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 40/82 (48%), Gaps = 16/82 (19%)

Query: 230 WAHDGDSIATGVENGELRLWNK-EGKLQNVFNFHKS--PII------------AIHWNSS 274
           + +D   IA+G E+G++ +W++  G +  V N H +  P+              + WN +
Sbjct: 592 FGYDNKLIASGSEDGKIYIWDRFHGNIIGVINGHITDRPLALNAVNTFGRNCNIVAWNPA 651

Query: 275 NTHFISTDADNITI-LWDVNSG 295
           N    ++  D+ +I +W V+ G
Sbjct: 652 NKDMFASGGDDGSIKIWSVSRG 673

>Scas_702.16
          Length = 816

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 60/134 (44%), Gaps = 25/134 (18%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYG---------- 399
           +P+  +  H G+++ L+F+   K LAS +DD  + +W       I   +G          
Sbjct: 70  KPLASMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESEKERWAV 129

Query: 400 ------HTQTIVSLKWV-NNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIF 452
                 H   I  + W  ++ +L+S  +D +V +W+ G   +++    + ++ V GV IF
Sbjct: 130 RKRLVAHDNDIQDICWAPDSSLLVSVGLDRAVIIWN-GITFEKLKRFDVHQSHVKGV-IF 187

Query: 453 AGA------ISDDR 460
             A       SDDR
Sbjct: 188 DPANKYFATASDDR 201

 Score = 35.8 bits (81), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 52/113 (46%), Gaps = 20/113 (17%)

Query: 207 ELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLW--NKEGKLQNVFN---- 260
           EL+ P A+ +   + T  +TCL ++ +G  +A+G ++  L +W  ++E  +Q +F     
Sbjct: 67  ELKKPLASMS---RHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESE 123

Query: 261 -----------FHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFE 302
                       H + I  I W   ++  +S   D   I+W+  +   L+ F+
Sbjct: 124 KERWAVRKRLVAHDNDIQDICWAPDSSLLVSVGLDRAVIIWNGITFEKLKRFD 176

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 21/84 (25%)

Query: 167 WNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLT 226
           ++PV+ N+LA    D T KL  +ET           K +  L+HP           + +T
Sbjct: 148 YHPVAENVLASSSGDYTVKLWNVETG----------KDMITLKHP-----------DMVT 186

Query: 227 CLSWAHDGDSIATGVENGELRLWN 250
            +S+++DG+ +AT   + +LR+WN
Sbjct: 187 SMSFSYDGNYLATVARDKKLRVWN 210

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 50/110 (45%), Gaps = 14/110 (12%)

Query: 348 DSRPIGKLVGHRGTISQLEFNSETK-LLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVS 406
           D +P+  L GH   +  + ++   + +LAS++ D T+++W+   G  +     H   + S
Sbjct: 129 DIKPVKFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITL-KHPDMVTS 187

Query: 407 LKW-VNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGA 455
           + +  + + L + + D  +++W           N+  E IV   P   GA
Sbjct: 188 MSFSYDGNYLATVARDKKLRVW-----------NIREEKIVSEGPAHTGA 226

>Kwal_23.5769
          Length = 627

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 75/192 (39%), Gaps = 16/192 (8%)

Query: 237 IATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGV 296
           I +G  +  +++W+ E +       H   +  +  +  +    S   D    +WD+ S  
Sbjct: 410 IVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNT 469

Query: 297 VLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLV 356
            ++ F                    +DT  + TD+   P P       T +   P G+L 
Sbjct: 470 CVKVFRGHVGQVQKVLPLTI-----LDTENLVTDRTSDP-PRNEA---TTAQDPPDGQL- 519

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLI 416
                   L + S    L S + DNTI++W    G  +   +GH + I  +   +N  ++
Sbjct: 520 --SALDDSLPYPSH---LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA-ADNFRIV 573

Query: 417 SASMDGSVKLWD 428
           S + D +VK+WD
Sbjct: 574 SGAHDKTVKVWD 585

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/183 (19%), Positives = 75/183 (40%), Gaps = 21/183 (11%)

Query: 239 TGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVV 297
           TG  +  + +W+   GKL      H+  + AI+++      I+   D +  +W+  +G  
Sbjct: 332 TGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGAC 389

Query: 298 LQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVG 357
           +  +   +             +  VD+      K ++ G     +     +SR    L G
Sbjct: 390 VAAYPGHSDS-----------VLSVDSY----KKIIVSGSADKTVKVWHVESRTCYTLRG 434

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH---TQTIVSLKWVNNDM 414
           H   +  ++ + ++    S +DD TIR+W   +   +  F GH    Q ++ L  ++ + 
Sbjct: 435 HTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTEN 494

Query: 415 LIS 417
           L++
Sbjct: 495 LVT 497

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 45/91 (49%), Gaps = 9/91 (9%)

Query: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN 411
           I +  GH   +  L+FN   +LL + + D+T+ +W    G  +    GH   + ++ + +
Sbjct: 310 IQEFKGHMDGVLSLQFN--YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-YFD 366

Query: 412 NDMLISASMDGSVKLWDCGKKLQEITGNLIA 442
              LI+ S+D  +++W+       +TG  +A
Sbjct: 367 GQKLITGSLDRMIRVWN------YVTGACVA 391

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 374 LASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKL 426
           + S A D T++VW   +G  IH F  H Q  ++   + +   +S    G VK+
Sbjct: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSH-QAPITCVGIGDSEFVSGDELGCVKV 623

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 76/205 (37%), Gaps = 42/205 (20%)

Query: 227 CLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNI 286
           C+ ++HDG  +AT  ++  LR+W              SP   +  N  +  F+ + A+ I
Sbjct: 131 CIRFSHDGKFMATAGKDEILRIWK----------VISSPAERLELNQHSISFLKSTANAI 180

Query: 287 TILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTM 346
           + L    +G + Q+                           DTD   +     N  V ++
Sbjct: 181 SQL----NGQLAQY-------------------------GGDTDSASLNSGSSNTHVDSL 211

Query: 347 SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVS 406
             S         +    + +  ++         D+   V+H    N +  F+ HT  I+ 
Sbjct: 212 GSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLGDSYCGVFHP---NPLVTFHEHTDDILD 268

Query: 407 LKWVNNDMLISASMDGSVKLWDCGK 431
           + W  N  +++ SMD S KLW C +
Sbjct: 269 IDWSKNSFILTGSMDKSCKLWHCAR 293

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 82/196 (41%), Gaps = 37/196 (18%)

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCF------------ 397
           +P+  +  H G+++ ++F+ + K LAS +DD  + +W    G +   F            
Sbjct: 67  KPLSTMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNV 126

Query: 398 ----YGHTQTIVSLKWV-NNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIF 452
                 H   I  + W  ++ +++S  +D ++ +W+ G   +++    + ++ V GV +F
Sbjct: 127 RRRLVAHDNDIQDICWAPDSSIMVSVGLDRAIIIWN-GSTFEKVKRFDVHQSHVKGV-VF 184

Query: 453 AGAISDDRERYAAGFMDGQVTVFNLAALLKRYSKGKKHK---NHVMSIPICGDFQSAHSD 509
             A     + +A    D  + +F       RY K  +      HV++ P  G   + +  
Sbjct: 185 DPA----NKYFATASDDRTIKMF-------RYHKTGETSFSVEHVITEPFKGSPLTTY-- 231

Query: 510 DSVFDLSWKEDRLAIA 525
                LSW  D   IA
Sbjct: 232 --FRRLSWSPDGQHIA 245

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/177 (16%), Positives = 67/177 (37%), Gaps = 22/177 (12%)

Query: 233 DGDSIATGVENGELRLWNKEGKLQ------------------NVFNFHKSPIIAIHWNSS 274
           D   +ATG  +G++R+W+    L+                  +  + H   +  + ++  
Sbjct: 28  DSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRHAGSVTTVKFSPD 87

Query: 275 NTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFG---VDTVWV-DTD 330
             +  S   D I ++W++  G     F +++                    D  W  D+ 
Sbjct: 88  GKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRLVAHDNDIQDICWAPDSS 147

Query: 331 KFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH 387
             V  G    ++++  S    + +   H+  +  + F+   K  A+A+DD TI+++ 
Sbjct: 148 IMVSVGLDRAIIIWNGSTFEKVKRFDVHQSHVKGVVFDPANKYFATASDDRTIKMFR 204

>Kwal_33.15475
          Length = 783

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 60/139 (43%), Gaps = 11/139 (7%)

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNG-NSIHCFY----GHTQTIVSLKWVNN 412
           H  TI++L F+S+++ L S + D    VW   +  N     +     HT+ I    W   
Sbjct: 597 HNLTITRLRFSSDSESLLSVSRDRQWAVWKKNSATNEFELTFKNEKAHTRIIWDCDWAPT 656

Query: 413 D---MLISASMDGSVKLWDCGKKLQEITGN--LIAETIVDGVPIFAGAISDDRERYAAGF 467
           +   + ++AS D  +K W   +  Q+      L     V  + +F G + + +   AAG 
Sbjct: 657 EFGHVFVTASRDKHIKAWKLSEDGQQYEQQHALKLAVPVTAISVFPG-LHNGKLLVAAGL 715

Query: 468 MDGQVTVFNLAALLKRYSK 486
            +G + VF      + YS+
Sbjct: 716 ENGNIQVFTYDNQFRCYSE 734

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 6/78 (7%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVW--HGGNGNSIHCFY---GHTQTIVSLKW 409
           L GH   ++ ++F   T L+ S+++D+ +R+W     + +++ C      H  TI SL  
Sbjct: 52  LKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQDALKCVQVIDHHKHTITSLSV 111

Query: 410 VNNDMLISASMDGSVKLW 427
           ++N +L     DGSV LW
Sbjct: 112 ISN-ILSVGCADGSVSLW 128

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 57/278 (20%), Positives = 106/278 (38%), Gaps = 77/278 (27%)

Query: 224 QLTCLSWAHDGDSIATGVENGELRLWNKEGKLQN------VFNFHKSPIIAIHWNSSNTH 277
           ++TC+ +    + + +  E+ ++RLW  E K Q+      V + HK  I ++   S  ++
Sbjct: 58  EVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQDALKCVQVIDHHKHTITSL---SVISN 114

Query: 278 FISTD-ADNITILW--DVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVI 334
            +S   AD    LW  + N  ++L  F  +                      V+ DK+++
Sbjct: 115 ILSVGCADGSVSLWLTENNQAILLHSFNLQTNVYPLCMALKL----------VEGDKYLL 164

Query: 335 PGPGGNLLVY---------TMSDSRPIGKLVGHRGTISQLEFNSETK---LLASAADDNT 382
              G N  V+         T+++ +   +L GH   +  ++F  E+    LLA+ + D  
Sbjct: 165 AIGGTNPRVFIYSFTLQDGTLNNFQLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRY 224

Query: 383 IRVWHGGN-----------------GNSIHCFY----------------GHTQTIVSLKW 409
           IR+W                     GN    F+                GH   I  LKW
Sbjct: 225 IRLWRIRTNELIDNSDEDEFKLNLLGNKQSKFFITPDLKVAINFDALIVGHDDWISCLKW 284

Query: 410 -VNNDMLISASMDGSVKLWD---------CGKKLQEIT 437
                 L++++ D +V +W+         C  +L E++
Sbjct: 285 HKERPQLLASTADTAVMVWEPDADSGVWICASRLGELS 322

>AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH]
           (168010..169263) [1254 bp, 417 aa]
          Length = 417

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 4/99 (4%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDN-TIRVWHGGNGNSIHCFYG 399
           LL     D+    K   H G I+ L+FN    +L  AAD N  I +W     +     + 
Sbjct: 271 LLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGGIALWDCRAFSKPLSVFN 330

Query: 400 HTQTIVSLKWVNNDMLISASM---DGSVKLWDCGKKLQE 435
           H  ++ +L+W  N   I A+    DG +K+WD  ++ ++
Sbjct: 331 HGDSVSALQWNPNLPTIVATAGQGDGLIKIWDTSREPED 369

>Scas_607.8
          Length = 462

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 56/95 (58%), Gaps = 8/95 (8%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNT-IRVWHGGNGNSIHCF 397
           GN+++Y +S  +P   +  H   I+ L F+S+  LLA+A+   T IRV++  +G  + C+
Sbjct: 202 GNVVIYDLSILQPRIIIEAHESEIAALTFSSDGTLLATASVKGTIIRVFNCTSG--LRCY 259

Query: 398 ---YGHTQT-IVSLKWVNNDMLISASM-DGSVKLW 427
               G  QT I+S+ + NN+  ++ +  +G++ ++
Sbjct: 260 QFRRGTYQTRILSMNFSNNNQFLAVTCSNGTIHIF 294

>Scas_721.115*
          Length = 318

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 2/91 (2%)

Query: 351 PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW- 409
           P+    GH   +       +     SA+ D T+R+W    G +   F GH   ++S+   
Sbjct: 57  PVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAID 116

Query: 410 VNNDMLISASMDGSVKLWDC-GKKLQEITGN 439
               M+IS S D ++K+W   G+ L  + G+
Sbjct: 117 RKASMIISGSRDKTIKVWTIKGQCLATLLGH 147

 Score = 35.4 bits (80), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 75/207 (36%), Gaps = 27/207 (13%)

Query: 277 HFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPG 336
           + +S   D    LWDV +G   Q F                 M             +I G
Sbjct: 79  YALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASM-------------IISG 125

Query: 337 PGGNLLVYTMSDSRPIGKLVGHRGTISQLEF-----NSETKLLASAADDNTIRVWHGGNG 391
                +       + +  L+GH   +SQ+       N ++  + SA +D  ++ W+    
Sbjct: 126 SRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQF 185

Query: 392 NSIHCFYGHTQTIVSLKWVNNDMLI-SASMDGSVKLWDCGKKLQEITGNLIAETIVDGVP 450
                F GH   + ++    +  LI SA  DG + LW+  +K    T +   E       
Sbjct: 186 QIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDE------- 238

Query: 451 IFAGAISDDRERYAAGFMDGQVTVFNL 477
           +FA A S +R   AA    G + +F L
Sbjct: 239 VFALAFSPNRYWLAAATASG-IKIFCL 264

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 62/151 (41%), Gaps = 13/151 (8%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH 400
           L ++ ++      + VGH+  +  +  + +  ++ S + D TI+VW    G  +    GH
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWT-IKGQCLATLLGH 147

Query: 401 TQTIVSLKWVNNDM------LISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAG 454
              +  ++    D       +ISA  D  VK W+  +   E      A+ +     +   
Sbjct: 148 NDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIE------ADFVGHNGNVNTV 201

Query: 455 AISDDRERYAAGFMDGQVTVFNLAALLKRYS 485
             S D    A+   DG++ ++NLA     Y+
Sbjct: 202 TASPDGTLIASAGKDGEIMLWNLAEKKAMYT 232

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 51/262 (19%), Positives = 101/262 (38%), Gaps = 38/262 (14%)

Query: 232 HDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILW 290
            DG    +   +  LRLW+   G+    F  HKS ++++  +   +  IS   D    +W
Sbjct: 75  QDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVW 134

Query: 291 DVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLV--YTMSD 348
            +  G  L                   Q         + D   +   G + +V  + ++ 
Sbjct: 135 TIK-GQCLATLLGHNDWVSQVRIAPTDQ---------NDDSVTVISAGNDKMVKAWNLNQ 184

Query: 349 SRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLK 408
            +     VGH G ++ +  + +  L+ASA  D  I +W+     +++      + + +L 
Sbjct: 185 FQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDE-VFALA 243

Query: 409 WVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGV-PIFAG------------A 455
           +  N   ++A+    +K++ C          L  +++VD + P FAG            A
Sbjct: 244 FSPNRYWLAAATASGIKIF-C----------LDPQSLVDDLRPEFAGYNKSAEPHAVSLA 292

Query: 456 ISDDRERYAAGFMDGQVTVFNL 477
            S D +   AG+ D  + V+ +
Sbjct: 293 WSADGQTLFAGYTDSVIRVWQV 314

>Scas_592.4*
          Length = 318

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 2/91 (2%)

Query: 351 PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW- 409
           P+    GH   +       +     SA+ D T+R+W    G +   F GH   ++S+   
Sbjct: 57  PVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAID 116

Query: 410 VNNDMLISASMDGSVKLWDC-GKKLQEITGN 439
               M+IS S D ++K+W   G+ L  + G+
Sbjct: 117 RKASMIISGSRDKTIKVWTIKGQCLATLLGH 147

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 63/151 (41%), Gaps = 13/151 (8%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH 400
           L ++ ++      + VGH+  +  +  + +  ++ S + D TI+VW    G  +    GH
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWT-IKGQCLATLLGH 147

Query: 401 TQTIVSLKWVNNDM------LISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAG 454
              +  ++    D       +ISA  D  VK W+  +   E      A+ +     + A 
Sbjct: 148 NDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIE------ADFVGHNGNVNAV 201

Query: 455 AISDDRERYAAGFMDGQVTVFNLAALLKRYS 485
             S D    A+   DG++ ++NLA     Y+
Sbjct: 202 TASPDGTLIASAGKDGEIMLWNLAEKKAMYT 232

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 74/207 (35%), Gaps = 27/207 (13%)

Query: 277 HFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPG 336
           + +S   D    LWDV +G   Q F                 M             +I G
Sbjct: 79  YALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASM-------------IISG 125

Query: 337 PGGNLLVYTMSDSRPIGKLVGHRGTISQLEF-----NSETKLLASAADDNTIRVWHGGNG 391
                +       + +  L+GH   +SQ+       N +   + SA +D  ++ W+    
Sbjct: 126 SRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQF 185

Query: 392 NSIHCFYGHTQTIVSLKWVNNDMLI-SASMDGSVKLWDCGKKLQEITGNLIAETIVDGVP 450
                F GH   + ++    +  LI SA  DG + LW+  +K    T +   E       
Sbjct: 186 QIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDE------- 238

Query: 451 IFAGAISDDRERYAAGFMDGQVTVFNL 477
           +F+ A S +R   AA    G + +F L
Sbjct: 239 VFSLAFSPNRYWLAAATASG-IKIFCL 264

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 59/132 (44%), Gaps = 23/132 (17%)

Query: 351 PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYG----------- 399
           P+  +  H G+I+ ++F+ + K LAS +DD  + +W      S    +G           
Sbjct: 71  PLCSMSRHTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVR 130

Query: 400 -----HTQTIVSLKWV-NNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPI-- 451
                H   I  + W  ++ +L++  +D SV +W+ G   +++    + +++V GV    
Sbjct: 131 KRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWN-GSTFEKLKRFDVHQSLVKGVVFDP 189

Query: 452 ---FAGAISDDR 460
              +    SDDR
Sbjct: 190 ANKYFATTSDDR 201

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/139 (20%), Positives = 61/139 (43%), Gaps = 26/139 (18%)

Query: 181 DSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATG 240
           DS  + +ELE+ T +  +        +L+ P  + +   + T  +TC+ ++ DG  +A+G
Sbjct: 47  DSILRCMELESLTPEIPLP------QDLQMPLCSMS---RHTGSITCVKFSPDGKYLASG 97

Query: 241 VENGELRLW--NKEGKLQNVFN---------------FHKSPIIAIHWNSSNTHFISTDA 283
            ++  L +W  ++E   Q  F                 H + I  I W   ++  ++   
Sbjct: 98  SDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDNDIQDICWAPDSSILVTVGL 157

Query: 284 DNITILWDVNSGVVLQHFE 302
           D   I+W+ ++   L+ F+
Sbjct: 158 DRSVIVWNGSTFEKLKRFD 176

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 52/104 (50%), Gaps = 2/104 (1%)

Query: 340 NLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYG 399
           N+   T  + +P+  L GH   +S   ++S+++ + SA+ D  + +W    G   +    
Sbjct: 108 NVAPITSVNLKPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPL 167

Query: 400 HTQTIVSLKWV-NNDMLISASMDGSVKLWDCGKKLQEITGNLIA 442
           H+Q ++S     N +++ SA +D +  ++   +K   I  N+++
Sbjct: 168 HSQWVLSCAICPNGNLVASAGLDNNCTIYRVSRK-DRIQQNIVS 210

 Score = 32.3 bits (72), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 39/219 (17%), Positives = 84/219 (38%), Gaps = 27/219 (12%)

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQ-NVFNFHKSPIIAIHWNSSNTHFIST 281
           N+++   W+ D  +I +  ++G + LW+    L+ N    H   +++     +     S 
Sbjct: 128 NKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLHSQWVLSCAICPNGNLVASA 187

Query: 282 DADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFV----IPGP 337
             DN   ++ V+    +Q                   +F   T ++   +F+    I   
Sbjct: 188 GLDNNCTIYRVSRKDRIQQ--------------NIVSIFKGHTCYISEIEFLDDNSILTA 233

Query: 338 GGNL--LVYTMSDSRPIGKLVGHRGTISQL-----EFNSETKLLASAADDNTIRVWHGGN 390
            G++   ++ ++ S+ I +   H G +  L     E      + AS   D  + +W    
Sbjct: 234 SGDMTCALWDITKSKRINEFADHLGDVLSLSAAPTETEGNGNVFASGGSDGYLYIWDKRV 293

Query: 391 GNSIHCFYGHTQTIVSLKWVNN-DMLISASMDGSVKLWD 428
             S+  F+     +  +K+  N + + + S DG   L+D
Sbjct: 294 PTSVQSFFVSDSDVSKVKFFRNGNTIATGSDDGCTNLYD 332

>Kwal_26.8953
          Length = 458

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 61/270 (22%), Positives = 105/270 (38%), Gaps = 54/270 (20%)

Query: 246 LRLWNKEGKLQNVFNFHKSPI--IAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFES 303
            RL N E +L   F+ H+  +  I I  N+++T   S   D    + DV++G  L+ F+ 
Sbjct: 201 FRLINSELQLVRTFSGHEHIVSHIKIWKNATDTLVASCSRDLTCKIGDVSNGYFLKSFQP 260

Query: 304 KAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTIS 363
            A             + G +   V    +    P G  L + +    P+ ++      +S
Sbjct: 261 HAEWVRSLDIMGEYIITGSNDCTVRVSHW----PTGRALSFGIGHDFPVEQVKIIPMELS 316

Query: 364 QLE---------FNSETKLLA-----SAADDNTIRVWH-----------------GGNGN 392
           + +         FN +   L      S + DNT+R+W                    +  
Sbjct: 317 ESDDPQNNTYSAFNKDYLPLGFSHVVSCSRDNTLRIWQVPIPRLIAHRAPQPNPARAHFT 376

Query: 393 SIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD--CGKKLQEITGNLIAETIVDGVP 450
            +    GH+  +  ++ V  + +IS S D SV++WD   G+ ++EIT         D   
Sbjct: 377 LVKTLKGHSSWVRDIR-VRGNFIISCSDDRSVRVWDLETGETVREIT---------DSHT 426

Query: 451 IFAGAISDD-----RERYAAGFMDGQVTVF 475
            FA  I  D     R+   +G  DG+V V+
Sbjct: 427 GFANCIDTDCGGLNRQLLVSGGADGKVIVY 456

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 75/169 (44%), Gaps = 22/169 (13%)

Query: 266 IIAIHWNSSNTHFI-STDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDT 324
           I ++ +N + T  + ST +DN  +L+D+ +    Q                  Q    + 
Sbjct: 222 ITSLKFNQNETDILASTGSDNSIVLYDLRTNSPTQKI---------------VQTMRTNA 266

Query: 325 V-W--VDTDKFVIPGPGGNLLVYTMSD-SRPIGKLVGHRGTISQLEFNSETKLLASAADD 380
           + W  ++   FV      N   Y M + SR +     H   +  ++F+     + + + D
Sbjct: 267 ICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPTGDEIVTGSYD 326

Query: 381 NTIRVWHGGNGNSIHCFY-GHTQTIVSLKW-VNNDMLISASMDGSVKLW 427
            +IR++   +G+S   ++    Q +  +K+ +++  +IS S DG+V+LW
Sbjct: 327 KSIRIYKTNHGHSREIYHTKRMQHVFQVKYSMDSKYIISGSDDGNVRLW 375

>Scas_692.25
          Length = 488

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 5/83 (6%)

Query: 355 LVGHRGTISQLEFNSETK--LLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN 412
           L+ H   +S+++   +     LAS + D +IR+W   +G  ++ F+ H + +  L  V+ 
Sbjct: 231 LMNHEHIVSEVKLFRKLNNIYLASCSRDTSIRIWTAEDGMILNSFHPHNEWVRCLD-VSG 289

Query: 413 DMLISASMDGSVKL--WDCGKKL 433
           D ++S S D S++L  W  G  L
Sbjct: 290 DFVLSGSQDASLRLTHWPSGNGL 312

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/236 (19%), Positives = 91/236 (38%), Gaps = 45/236 (19%)

Query: 159 LGKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIH-ELRHPFATSAT 217
           + +  CL WN   +++L  G  D                     + +H ++R P     T
Sbjct: 344 IDRVACLSWN---NHVLTSGSRD--------------------HRILHRDVRMPDPFFET 380

Query: 218 TGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNV-FNFHKSPIIAIHWNSSNT 276
               T ++  L W    + +A+G  +  + ++    K   + F+ HK+ + A+ W+    
Sbjct: 381 IESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKR 440

Query: 277 HFIST---DADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFV 333
             ++T    AD    +W+VN+ + +   +S +                 + VW      +
Sbjct: 441 GVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQI--------------CNMVWSKNTNEL 486

Query: 334 IPGPGG---NLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
           +   G    NL ++  +   PI  L GH   +  L  +++   + S A D T+R W
Sbjct: 487 VTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYW 542

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLIS 417
           H   +  L++N     LAS  +DN + V+ G + + I  F  H   + ++ W  +   + 
Sbjct: 384 HTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVL 443

Query: 418 ASMDGS----VKLWDCGKKLQ 434
           A+  G+    +K+W+    ++
Sbjct: 444 ATGGGTADRRLKIWNVNTSIK 464

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 352 IGKLVGHRGTISQLEFNSET-KLLASAADDNTIRVW-HGGNGNSIHCFYGHTQTIVSLKW 409
           I    GH    + L+F  +T  L+ S  +D+TI++W    +   +  F GH + I +L++
Sbjct: 155 IRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRF 214

Query: 410 VNN-DMLISASMDGSVKLWD 428
             +    +S+S D SVK+WD
Sbjct: 215 TEDCQSFLSSSFDRSVKIWD 234

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/158 (18%), Positives = 67/158 (42%), Gaps = 17/158 (10%)

Query: 234 GDSIATGVENGELRLWNKEGKLQNVFNF--HKSPIIAIHWNSSNTHFISTDADNITILWD 291
           G  I +G  +  +++W+     + + +F  H  PI A+ +      F+S+  D    +WD
Sbjct: 175 GHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWD 234

Query: 292 VNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVY--TMSDS 349
             +G V       +                V++   +  +F++      +L Y   +S++
Sbjct: 235 TETGKVKTRLHLNSTPAD------------VESRPTNPHEFIVGLSNSKILHYDDRVSEN 282

Query: 350 RPIGKLVGHR-GTISQLEFNSETKLLASAADDNTIRVW 386
           + + +   H   +I  L++  +     S+++D T+R+W
Sbjct: 283 QGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIW 320

>AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372)
           [3072 bp, 1023 aa]
          Length = 1023

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 81/212 (38%), Gaps = 15/212 (7%)

Query: 234 GDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDV 292
           G+    G  NG + ++N + G  + V+  HK  +  +  +  N   +S   D +   +D 
Sbjct: 560 GNFALIGSSNGGISVYNLQSGIKRKVYKMHKGSVTGLAVDGMNRKMVSCGLDGLVGFYDF 619

Query: 293 NSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPI 352
            +   L   +  A            ++F V       D F I        V      R +
Sbjct: 620 TTNSFLGKLQLGAPITQLVYHRAS-ELFAVAL-----DDFSIQ-------VIDSVTQRVV 666

Query: 353 GKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN 412
            +L GH   I+  +F+ + + + SA+ D+T+R W    G  I      +         N 
Sbjct: 667 RQLWGHSNRITAFDFSPDGRWIVSASLDSTLRTWDLPTGTCIDGVRLESVATNVQFSANG 726

Query: 413 DMLISASMDGS-VKLWDCGKKLQEITGNLIAE 443
           D+L +  + G+ + +W    + + I+   I E
Sbjct: 727 DILATTHVAGNGIAIWSNRSQFKAISTRQIDE 758

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 56/111 (50%), Gaps = 10/111 (9%)

Query: 373 LLASAADDNTIRVWHGGNGNS-----IHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLW 427
           L+AS    N   ++     N      +  F GHT  +  L+++NN+ +++AS D +  LW
Sbjct: 144 LVASGGLSNNCTIYRISQENRTQQKIVSIFKGHTCYVSDLEFINNESILTASGDMTCALW 203

Query: 428 DC--GKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFN 476
           D    K++ E + +L  + +   VP  AG  S D   +A+G  DG V +++
Sbjct: 204 DIPKSKRVSEYSDHL-GDVLTLSVPP-AGTTSYD-SMFASGGSDGYVYLWD 251

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 95/257 (36%), Gaps = 48/257 (18%)

Query: 262 HKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFG 321
           H + I    W+  +   +S   D   ++WD  SG+                         
Sbjct: 87  HNNKISDFRWSRDSKSILSASQDGFMLIWDPMSGL-------------------KKNAIP 127

Query: 322 VDTVWV-------DTDKFVIPGPGGNLLVYTMS-DSRPIGKLV----GHRGTISQLEF-N 368
           +D+ WV         +     G   N  +Y +S ++R   K+V    GH   +S LEF N
Sbjct: 128 LDSQWVLACAISPSRNLVASGGLSNNCTIYRISQENRTQQKIVSIFKGHTCYVSDLEFIN 187

Query: 369 SETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN------NDMLISASMDG 422
           +E+ L AS   D T  +W       +  +  H   +++L          + M  S   DG
Sbjct: 188 NESILTASG--DMTCALWDIPKSKRVSEYSDHLGDVLTLSVPPAGTTSYDSMFASGGSDG 245

Query: 423 SVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAA--L 480
            V LWD  +    +    ++++ +  V  F+     D      G  DG   +F+L +   
Sbjct: 246 YVYLWDT-RSPSSVQNFFVSDSDISTVRFFS-----DGNSIITGSDDGIARLFDLRSDCE 299

Query: 481 LKRYSKGKKHKNHVMSI 497
           L  YS  +K +   M +
Sbjct: 300 LSSYSLSQKVQQQQMKL 316

>Sklu_2139.2 YFR021W, Contig c2139 1540-3165 reverse complement
          Length = 541

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 4/97 (4%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNT-IRVWHGGNGNSIHCF 397
           G+++++ M   +P   +  H+G I+ L  + +  LLA+A++  T IRV+    G  I+ F
Sbjct: 249 GDVILFNMQSLQPTMVIEAHKGEIAALTLSKDGSLLATASEKGTIIRVFSVETGAKIYQF 308

Query: 398 YGHT--QTIVSLKWV-NNDMLISASMDGSVKLWDCGK 431
              T    I SL +  +N  L ++S   +V ++  GK
Sbjct: 309 RRGTYPTKIYSLSFSDDNQFLAASSSSKTVHIFRLGK 345

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 65/146 (44%), Gaps = 16/146 (10%)

Query: 339 GNLLVYTMSDSRPIGKL-VGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCF 397
           G + ++   +  P GK    H G +    ++ +   +AS   DNT++++   +G S    
Sbjct: 58  GKVRIWDAQNGVPQGKAQYEHNGPVLCTRWSLDGARIASGGCDNTVKLYDVASGQSQQ-I 116

Query: 398 YGHTQTIVSLKWV-----NNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIF 452
             H   + SL++V     N + L++ S D ++K WD  ++ Q IT   + E +       
Sbjct: 117 GSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWDT-RQPQPITTIAMPERVY------ 169

Query: 453 AGAISDDRERYAAGFMDGQVTVFNLA 478
              + + ++    G  +  + + NLA
Sbjct: 170 --TMDNKQQLLVVGTAERHIAIINLA 193

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 243 NGELRLWNKE-GKLQNVFNF-HKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295
           +G++R+W+ + G  Q    + H  P++   W+       S   DN   L+DV SG
Sbjct: 57  DGKVRIWDAQNGVPQGKAQYEHNGPVLCTRWSLDGARIASGGCDNTVKLYDVASG 111

>CAGL0J08998g 882655..886500 highly similar to sp|P38968
           Saccharomyces cerevisiae YDL195w SEC31 component of the
           COPII coat of ER-golgi vesicles, start by similarity
          Length = 1281

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 107/253 (42%), Gaps = 54/253 (21%)

Query: 228 LSWAHDGDSIATGVENGELRLW-----NKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTD 282
           L W+ D   IA  ++NG + ++      +E K Q  F  H + +  + +NS   + + + 
Sbjct: 68  LDWSADNKYIAGAMDNGAVEIYEFNSSKQELKKQGSFKNHSTVVRTVKFNSKQNNVLLSG 127

Query: 283 ADNITI-LWDVN-------------SGVVLQHFE---SKAXXXXXXXXXXXXQMFGVDTV 325
            ++  I +WD+N              GV +   +   S +                  ++
Sbjct: 128 GNSQEIFIWDLNKLLDSKANYQPLTPGVSMSPIDEIHSLSWNKSLAHVFASASNSSFASI 187

Query: 326 W-VDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFN--SETKLLASAADDNT 382
           W +   K VI       L YT  ++       G +   S +E++  + T++  + ++DN 
Sbjct: 188 WDLKAKKEVI------HLSYTSQNT-------GLKSDFSAVEWHPLNSTRVATATSNDNE 234

Query: 383 --IRVWHGGNGNSI--------HCFYGHTQTIVSLKWVNND--MLISASMDGSVKLWD-- 428
             I VW   N N+         +  +GH++ I+SL W   D  +L+S++ D SV LW+  
Sbjct: 235 PLILVWDLRNSNTPLQTLSAANNQGHGHSKGILSLDWCQQDENLLLSSARDSSVMLWNPQ 294

Query: 429 CGKKLQE--ITGN 439
            G+ L E   TGN
Sbjct: 295 SGEALTEYNTTGN 307

>YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anaphase
           promoting complex (APC), required for microtubule
           function at mitosis and for exit from anaphase, contains
           WD (WD-40) repeats [1833 bp, 610 aa]
          Length = 610

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 79/206 (38%), Gaps = 29/206 (14%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKE-GKLQNVFNFHKSPIIAIHWNSSNTHFISTDA 283
           L  LSW+   + +A  ++   L LWN   G +  + +F  + I ++ W+  + H      
Sbjct: 264 LNLLSWSKK-NVLAIALDTA-LYLWNATTGDVSLLTDFENTTICSVTWSDDDCHISIGKE 321

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGV---DTVWVDTDKFVIPGPGGN 340
           D  T +WDV +  +++   S                 GV      W+DT    +   G  
Sbjct: 322 DGNTEIWDVETMSLIRTMRSG---------------LGVRIGSLSWLDT----LIATGSR 362

Query: 341 LLVYTMSDSRPIGKLVG----HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHC 396
                ++D R    +V     H G +  L + S+   LAS  +DNT+ +W          
Sbjct: 363 SGEIQINDVRIKQHIVSTWAEHTGEVCGLSYKSDGLQLASGGNDNTVMIWDTRTSLPQFS 422

Query: 397 FYGHTQTIVSLKWVNNDMLISASMDG 422
              HT  + +L W      I AS  G
Sbjct: 423 KKTHTAAVKALSWCPYSPNILASGGG 448

>Scas_670.21
          Length = 595

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 354 KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND 413
           +L  H   +  L++N+E   LAS  +DN + V+ G + N +  F  H   + +L W  + 
Sbjct: 409 RLNTHSQEVCGLQWNTEENKLASGGNDNVVCVYDGTSRNPMIKFIEHKAAVKALAWSPHK 468

Query: 414 MLISASMDGSV----KLWDCGK--KLQEI-TGNLIAETI 445
             I A+  G+V    K+W+     KL ++ TG+ +   I
Sbjct: 469 RGILATGGGTVDRRLKIWNVNTSMKLSDVDTGSQVCNMI 507

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 40/233 (17%), Positives = 88/233 (37%), Gaps = 43/233 (18%)

Query: 161 KAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGK 220
           +  CL WN    +IL  G  D                  ++ + +  +  PF     T  
Sbjct: 375 RVACLSWN---GHILTSGSRDH----------------NILHRDV-RMPDPFFERLNTH- 413

Query: 221 ITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNV-FNFHKSPIIAIHWNSSNTHFI 279
            + ++  L W  + + +A+G  +  + +++   +   + F  HK+ + A+ W+      +
Sbjct: 414 -SQEVCGLQWNTEENKLASGGNDNVVCVYDGTSRNPMIKFIEHKAAVKALAWSPHKRGIL 472

Query: 280 STDA---DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPG 336
           +T     D    +W+VN+ + L   ++ +                 + +W      ++  
Sbjct: 473 ATGGGTVDRRLKIWNVNTSMKLSDVDTGSQV--------------CNMIWSKNTDEIVTS 518

Query: 337 PGGN---LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
            G +   L ++      P+  L GH   +  L  +++   + S A D T+R W
Sbjct: 519 HGYSKYHLTLWDYPTMNPVAILKGHSFRVLHLTLSADGTTVVSGAGDETLRYW 571

>Scas_659.9
          Length = 475

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 50/99 (50%), Gaps = 3/99 (3%)

Query: 332 FVIPGPGGNLLVYTMSD-SRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGN 390
           FV+     N   Y M + SR +     H   +  ++F+     + + + D TIR+++  +
Sbjct: 271 FVVANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTH 330

Query: 391 GNSIHCFY-GHTQTIVSLKW-VNNDMLISASMDGSVKLW 427
           G+S   ++    Q +  +K+ ++   ++S S DG+V+LW
Sbjct: 331 GHSREIYHTKRMQHVFQVKFSMDAKYIVSGSDDGNVRLW 369

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/236 (18%), Positives = 88/236 (37%), Gaps = 45/236 (19%)

Query: 159 LGKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIH-ELRHPFATSAT 217
           + +  CL WN   ++IL  G  D                     K +H ++R P      
Sbjct: 333 MDRVACLSWN---NHILTSGSRD--------------------RKILHRDVRMPEPYFEQ 369

Query: 218 TGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNV-FNFHKSPIIAIHWNSSNT 276
               T ++  L W  D + +A+G  +  + +++   +   +    H + + AI W+    
Sbjct: 370 VETHTQEVCGLKWNTDENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWSPHKR 429

Query: 277 HFIST---DADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFV 333
             ++T    AD    +W+VN+   L+  ++ +                 + +W      +
Sbjct: 430 GILATGGGTADKKMKIWNVNTSTKLRDIDTGSQV--------------CNMIWSKNTNEL 475

Query: 334 IPGPGG---NLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
           +   G    NL ++      P+  L GH   +  L  +++   + S A D T+R W
Sbjct: 476 VTSHGYSRYNLTLWDYPSMEPVAILKGHSFRVLHLTLSADGTTVVSGAGDETLRYW 531

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 7/95 (7%)

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLIS 417
           H   +  L++N++   LAS  +DN + V+ G +         HT  + ++ W  +   I 
Sbjct: 373 HTQEVCGLKWNTDENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWSPHKRGIL 432

Query: 418 A----SMDGSVKLWDC--GKKLQEI-TGNLIAETI 445
           A    + D  +K+W+     KL++I TG+ +   I
Sbjct: 433 ATGGGTADKKMKIWNVNTSTKLRDIDTGSQVCNMI 467

>YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of the
           COPII coat of secretory pathway vesicles involved in
           endoplasmic reticulum to Golgi transport, associated
           with Sec13p, member of WD (WD-40) repeat family [3822
           bp, 1273 aa]
          Length = 1273

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 101/242 (41%), Gaps = 48/242 (19%)

Query: 220 KITNQLTCLSWAHDGDSIATGVENGELRLW--NKEGKLQNV---FNFHKSPIIAIHWNSS 274
           ++ ++   L W+H+   IA  ++NG L L+  N+     N    F+ H S +  + +N+ 
Sbjct: 60  QVDSKFNDLDWSHNNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAK 119

Query: 275 NTHFISTDADNITI-LWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTV----WVDT 329
             + +++  +N  I +WD+N        ES +             M  VD V    W  +
Sbjct: 120 QDNVLASGGNNGEIFIWDMNKCT-----ESPS---NYTPLTPGQSMSSVDEVISLAWNQS 171

Query: 330 DKFVIPGPGGN---------------LLVYTMSDSRPIGKLVGHRGTISQLEF---NSET 371
              V    G +                L YT  +S       G +  +S +E+   NS  
Sbjct: 172 LAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNS-------GIKQQLSVVEWHPKNSTR 224

Query: 372 KLLASAAD-DNTIRVWHGGNGNSI--HCFYGHTQTIVSLKWVNND--MLISASMDGSVKL 426
              A+ +D D +I +W   N N+       GH + I+SL W + D  +L+S+  D +V L
Sbjct: 225 VATATGSDNDPSILIWDLRNANTPLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLL 284

Query: 427 WD 428
           W+
Sbjct: 285 WN 286

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 52/111 (46%), Gaps = 11/111 (9%)

Query: 203 KTIHELRHPFATSATTGKITNQLTCLSWAHDGDSI----ATGVEN-GELRLW---NKEGK 254
           K   E+ H   TS  +G I  QL+ + W H  +S     ATG +N   + +W   N    
Sbjct: 191 KAKKEVIHLSYTSPNSG-IKQQLSVVEW-HPKNSTRVATATGSDNDPSILIWDLRNANTP 248

Query: 255 LQNVFNFHKSPIIAIHWNSSNTH-FISTDADNITILWDVNSGVVLQHFESK 304
           LQ +   H+  I+++ W   + H  +S+  DN  +LW+  S   L  F ++
Sbjct: 249 LQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPESAEQLSQFPAR 299

 Score = 36.2 bits (82), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 94/226 (41%), Gaps = 22/226 (9%)

Query: 231 AHDGDSIATGVENGELRLWNKEGKLQNVFNFHK-SP---------IIAIHWNSSNTH-FI 279
           A   + +A+G  NGE+ +W+     ++  N+   +P         +I++ WN S  H F 
Sbjct: 118 AKQDNVLASGGNNGEIFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFA 177

Query: 280 STDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGG 339
           S  + N   +WD+ +   + H    +            +    ++  V T       P  
Sbjct: 178 SAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPS- 236

Query: 340 NLLVYTMSDSR-PIGKL-VGHRGTISQLEF-NSETKLLASAADDNTIRVWHGGNGNSIHC 396
            +L++ + ++  P+  L  GH+  I  L++ + +  LL S+  DNT+ +W+  +   +  
Sbjct: 237 -ILIWDLRNANTPLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPESAEQLSQ 295

Query: 397 FYGHTQTIVSLKWVNN--DMLISASMDGSVKLWDCGKKLQEITGNL 440
           F          K+     D+   AS D  +++    + LQ +T  L
Sbjct: 296 FPARGNWCFKTKFAPEAPDLFACASFDNKIEV----QTLQNLTNTL 337

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 358 HRGTISQLEFNSETKLLASAADDNTIRVW-HGGNGNSIHCFYGHTQTIVSLKWV-NNDML 415
           H GT S         L+ S  +DNT+++W    +   +  F GH++ I +L +  ++   
Sbjct: 148 HNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQF 207

Query: 416 ISASMDGSVKLWD 428
           +S S D  VK+WD
Sbjct: 208 LSGSYDQQVKIWD 220

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 30/157 (19%), Positives = 61/157 (38%), Gaps = 15/157 (9%)

Query: 234 GDSIATGVENGELRLWN--KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWD 291
           G  I +G  +  ++LW+   + K    F  H  PI  + + S ++ F+S   D    +WD
Sbjct: 161 GHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQVKIWD 220

Query: 292 VNSGVVLQHFESKAXXXXXXXXXXXXQMF--GVDTVWVDTDKFVIPGPGGNLLVYTMSDS 349
             +G V +   + +              F  G+ +  +      +    G + VY     
Sbjct: 221 TETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYDTRVSEKDGLVQVYDH--- 277

Query: 350 RPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
                   H  +I  +++  +     S+++D T+R+W
Sbjct: 278 --------HLSSILAIKYFPDGSKFISSSEDKTLRIW 306

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 13/86 (15%)

Query: 218 TGKITNQLTCLSWAHD-------GDSIATGVENGELRLWN-----KEGKLQNVFNFHKSP 265
           TGK+T +L   S  +        G+    G+ + +++ ++     K+G +Q V++ H S 
Sbjct: 223 TGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYDTRVSEKDGLVQ-VYDHHLSS 281

Query: 266 IIAIHWNSSNTHFISTDADNITILWD 291
           I+AI +    + FIS+  D    +W+
Sbjct: 282 ILAIKYFPDGSKFISSSEDKTLRIWN 307

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 228 LSWAHDGDSIATGVENGELRLW--NKEGKLQNVFNFHKSPIIAIHWNSSNT 276
           L+++ DG  + +G   G+L LW  N   KL ++    KSPI  + W+   T
Sbjct: 375 LTFSPDGRFLCSGDARGQLFLWDWNTNRKLCDLKLPTKSPITQVSWHPKET 425

>Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement
          Length = 587

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 77/194 (39%), Gaps = 29/194 (14%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKE-GKLQNVFNFHKSPIIAIHWNSSNTHFISTDA 283
           L  LSW+   + +A  +E+  L LWN E G +  +  F    I ++ W+  + H     +
Sbjct: 254 LNLLSWSKK-NCLAIALES-SLYLWNGESGDVTLLTEFEAETISSVTWSDDDCHVSIGKS 311

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGV---DTVWVDTDKFVIPGPGGN 340
           D  T +WDV +  +++   S                 GV      W+DT   V  G    
Sbjct: 312 DGNTEIWDVETMSLVRTMRSG---------------LGVRIGSQSWLDT--LVACGTKSG 354

Query: 341 LLVYTMSDSRPIGKLVG----HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHC 396
            +   ++D R    +V     H G +  L +  +   LAS ++DN++ +W          
Sbjct: 355 EI--QINDVRIKNHIVSAWQEHSGEVCGLSYRKDGLQLASGSNDNSVMIWDTRTSMPQFV 412

Query: 397 FYGHTQTIVSLKWV 410
              HT  + ++ W 
Sbjct: 413 KRNHTAAVKAISWC 426

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 68/149 (45%), Gaps = 26/149 (17%)

Query: 378 ADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLIS-ASMDGSVKLWDCGKKLQEI 436
           A ++++ +W+G +G+         +TI S+ W ++D  +S    DG+ ++WD       +
Sbjct: 268 ALESSLYLWNGESGDVTLLTEFEAETISSVTWSDDDCHVSIGKSDGNTEIWD-------V 320

Query: 437 TGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAALLKRYSKGKKHKNHVMS 496
               +  T+  G+ +  G+ S      A G   G++ + ++           + KNH++S
Sbjct: 321 ETMSLVRTMRSGLGVRIGSQSWLDTLVACGTKSGEIQINDV-----------RIKNHIVS 369

Query: 497 IPICGDFQSAHSDDSVFDLSWKEDRLAIA 525
                     HS + V  LS+++D L +A
Sbjct: 370 A------WQEHSGE-VCGLSYRKDGLQLA 391

>AGR367C [4678] [Homologous to ScYDR324C - SH] (1408366..1410681)
           [2316 bp, 771 aa]
          Length = 771

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 53/126 (42%), Gaps = 16/126 (12%)

Query: 337 PGGNLLVYTMSDSR-----------PIGKLVGHRGTISQLEFNSETKLLASAADDNTIRV 385
           PGG L ++++  S            P+     + G I  L  NS    LA   D+ T+ +
Sbjct: 116 PGGPLRLFSIGGSTIVTEWDLASGLPLRNYDCNAGVIWSLCVNSSNTKLAVGCDNGTVVL 175

Query: 386 W--HGGNGNSIH--CFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLI 441
               GG G   H          +++L WV +D ++    DG +++W C K+  +  G L+
Sbjct: 176 IDISGGRGVMEHDSILTRQDARVLALTWVGDDAVVGGCSDGRIRIW-CVKEDDQNRGRLL 234

Query: 442 AETIVD 447
               VD
Sbjct: 235 HTMKVD 240

>YBL106C (SRO77) [97] chr2 complement(10847..13879) Protein that
           functions together with Sec9p in exocytosis downstream
           of the Rho3p GTPase [3033 bp, 1010 aa]
          Length = 1010

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 46/98 (46%), Gaps = 14/98 (14%)

Query: 217 TTGKITNQLTCLSWAHDGDSIATGVENGELRLW----NKEGKLQNVFNFHKS-------- 264
           TT    N +TC       D +  G+E+G + ++    N+  KL+ + NF KS        
Sbjct: 119 TTVFCPNSITCFETDPPLDWMLIGLESGSILIYDVDRNQMSKLK-IENFQKSVFLPKERL 177

Query: 265 -PIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHF 301
            P+I+I WN  +   I    ++IT+++      V QHF
Sbjct: 178 SPVISIQWNPRDIGTILISYEHITVIYSFIDYKVKQHF 215

>Scas_721.29
          Length = 414

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 5/92 (5%)

Query: 348 DSRPIGKLVGHRGTISQLEFNS--ETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIV 405
           D  PI K + H  +IS LE+N   ET + ++  DD  +++W       +    GH   + 
Sbjct: 322 DGEPI-KTLHHGSSISTLEWNPNLETIVASAGQDDGLVKLWDVSTDELVFTHGGHMLGVN 380

Query: 406 SLKWVNND--MLISASMDGSVKLWDCGKKLQE 435
            + W  +D  ++ S S D SV++W     L E
Sbjct: 381 DISWNLHDTWLMCSVSNDNSVQVWKPAHNLVE 412

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query: 394 IHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKK 432
           +  +  H Q ++ + W  N+ ++SASMD +VKLW   +K
Sbjct: 271 LRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRK 309

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 369 SETKLLASAADDNTIRVWHGGNGNSIHCF-YGHTQTIVSLKWVNNDMLISASMDGSVKLW 427
           S+   + SA+ D T+++WH    NS+  F +    T V     ++   IS  +D   +LW
Sbjct: 287 SKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLW 346

>Kwal_23.4118
          Length = 939

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 2/99 (2%)

Query: 331 KFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGN 390
           K V  G  G +  Y  S S  +GKL      ++ + ++  + L A A DD +I V     
Sbjct: 517 KMVSCGLDGIVGFYDFSKSSYLGKL-QLDAPVTSMVYHRSSDLFALALDDFSIVVVDAVT 575

Query: 391 GNSIHCFYGHTQTIVSLKWVNNDM-LISASMDGSVKLWD 428
              +   +GH+  I S  +  +   +IS S+DG+ + WD
Sbjct: 576 QKVVRQLWGHSNRISSFDFSPDGRWIISTSLDGTARTWD 614

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 31/156 (19%), Positives = 57/156 (36%), Gaps = 14/156 (8%)

Query: 240 GVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVL 298
           G  NG + ++N + G  +  +  HK  +  I  +  N   +S   D I   +D +    L
Sbjct: 479 GSSNGGIGVYNLQSGLPRKKYRLHKKAVSGIAVDGMNRKMVSCGLDGIVGFYDFSKSSYL 538

Query: 299 QHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGH 358
              +  A                       +D F +     +++V      + + +L GH
Sbjct: 539 GKLQLDAPVTSMVYHR-------------SSDLFALALDDFSIVVVDAVTQKVVRQLWGH 585

Query: 359 RGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSI 394
              IS  +F+ + + + S + D T R W    G  I
Sbjct: 586 SNRISSFDFSPDGRWIISTSLDGTARTWDLPTGCCI 621

>Scas_719.52
          Length = 628

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 22/90 (24%)

Query: 167 WNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLT 226
           ++PV+ N+LA    D T KL  +ET           + +  L+HP           + +T
Sbjct: 148 FHPVAENVLASSSLDYTVKLWNIETG----------EAVITLKHP-----------DMVT 186

Query: 227 CLSWAHDGDSIATGVENGELRLWN-KEGKL 255
            +S+++ G+ +AT   + +LR+W+ +EGK+
Sbjct: 187 SMSFSYGGNHLATVCRDKKLRVWDIREGKI 216

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/201 (18%), Positives = 80/201 (39%), Gaps = 53/201 (26%)

Query: 258 VFNFHKSPIIAIHWNSSNTHFISTDADNITI-LWDVNSGVVLQHFESKAXXXXXXXXXXX 316
           +F  H + ++   ++  N H I++ +D+  I +W +      QH+               
Sbjct: 76  LFRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHY--------------- 120

Query: 317 XQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETK-LLA 375
                     +D D     G   N+        +P+  L GH   +  + F+   + +LA
Sbjct: 121 ----------LDPD-----GEPKNI--------KPVKFLSGHSRKVGHVLFHPVAENVLA 157

Query: 376 SAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWDCGKKLQ 434
           S++ D T+++W+   G ++     H   + S+ +    + L +   D  +++WD  +   
Sbjct: 158 SSSLDYTVKLWNIETGEAVITL-KHPDMVTSMSFSYGGNHLATVCRDKKLRVWDIRE--- 213

Query: 435 EITGNLIAETIVDGVPIFAGA 455
              G +++E      P  AGA
Sbjct: 214 ---GKIVSEG-----PAHAGA 226

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 42/94 (44%), Gaps = 15/94 (15%)

Query: 390 NGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD-----CGKKLQEITGNLIAET 444
           N   +H F GHT  +  +K V    L S S D S++ WD     C K   E +   I   
Sbjct: 373 NFEKVHVFKGHTSWVRDIK-VRGRHLFSCSDDRSIRCWDLVTGQCLKVWPEASHGFINCL 431

Query: 445 IVDGVPIFAGAISDD---RERYAAGFMDGQVTVF 475
            VD        +S+D   RE + +G +DG+  VF
Sbjct: 432 SVD------SDVSNDKLLRELFLSGSIDGKCNVF 459

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 355 LVGHRGTISQLEF--NSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNN 412
           L  H   +SQ  F  +    LLA+ + D T++VW   +G  I  F  H Q + +L+ ++ 
Sbjct: 207 LSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLE-LHG 265

Query: 413 DMLISASMDGSVKL--WDCGKKL 433
           D +I+ S D +++L  W  G  L
Sbjct: 266 DYVITGSNDATIRLSHWPSGNGL 288

>CAGL0M05291g complement(566250..567509) similar to sp|P13712
           Saccharomyces cerevisiae YBR195c MSI1, hypothetical
           start
          Length = 419

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 56/124 (45%), Gaps = 21/124 (16%)

Query: 327 VDTDKFVIPGPGGNLLVYTMS-------------DSRPIGKLVGHRGTISQLEFNSETKL 373
           ++T KF    PG +LLV +               D  PI  +  H  +IS +E+N    +
Sbjct: 295 INTCKF---NPGNSLLVASADTCGRINLWDIRKLDQEPISTM-QHGSSISTIEWNPNIGV 350

Query: 374 LASAA--DDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND--MLISASMDGSVKLWDC 429
           + ++A  +D  +++W    G  I    GH   +  + W  +D  ++ S S D ++++W  
Sbjct: 351 VFASAGQEDGLVKLWDASVGKEIFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWRP 410

Query: 430 GKKL 433
            K +
Sbjct: 411 AKNI 414

>Scas_717.68
          Length = 908

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 390 NGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLW 427
           N +    F  HT  ++ L W  N+ LI++SMD +VKLW
Sbjct: 317 NPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLW 354

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 7/108 (6%)

Query: 369 SETKLLASAADDNTIRVWHGGNGNSIHCF-YGHTQTIVSLKWVNNDMLISASMDGSVKLW 427
           S+   L +++ D T+++WH     S+  F +    T V     ++   IS  +D  V+LW
Sbjct: 337 SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396

Query: 428 DCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVF 475
              +   EIT     + ++  + +  G    D +    G  +G V V 
Sbjct: 397 SILE--NEITFEFDCQDLITSLTLSPG----DGKYTIVGTFNGYVHVL 438

>AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH]
           (425925..427226) [1302 bp, 433 aa]
          Length = 433

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 199 KLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGK---- 254
           +L++     L+    T   T +I  Q  CL ++  GD +A G  NG L +++ + K    
Sbjct: 4   RLLQDPFSVLKEYPETLTYTFEIPLQCDCLEFSPGGDYLAVGCSNGSLVIYDMDTKKPIS 63

Query: 255 -LQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDV 292
            L N    H   + ++ W+    +  S+  D    +WD+
Sbjct: 64  VLGNHGGGHVRAVQSVAWSQCGRYLWSSSRDWRVKMWDL 102

>Kwal_26.7655
          Length = 743

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 397 FYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGK 431
           +  HTQ I+ L W  N  +++ SMD + +LW C +
Sbjct: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDR 302

>Kwal_26.8628
          Length = 422

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 54/121 (44%), Gaps = 22/121 (18%)

Query: 367 FNSETKLLASAADDNTIRVWHGGNGNSIH-----CFYGHTQTIVSLKWVNNDMLISASMD 421
            NS   L+ASA   N+  ++     N +       F GHT  +  +++  N+ +I+AS D
Sbjct: 136 INSSGNLVASAGLTNSCTIYRISQENRVQQQIVSMFKGHTCYVSQVEFFENNSIITASGD 195

Query: 422 GSVKLWDC--GKKLQEIT---GNLIAETIVD-----GVPIFAGA-------ISDDRERYA 464
            +  LWD    K++ E +   G+++A  +         PIFA         I D R R A
Sbjct: 196 MTCALWDIPKAKRIAEFSDHLGDVLALALPPPHAQTSSPIFASGGSDGYVYIWDTRARAA 255

Query: 465 A 465
           A
Sbjct: 256 A 256

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 42/235 (17%), Positives = 89/235 (37%), Gaps = 31/235 (13%)

Query: 223 NQLTCLSWAHDGDSIATGVENGELRLWNKE-GKLQNVFNFHKSPIIAIHWNSSNTHFIST 281
           N+++  +W+ D  SI +  ++G + +W+   G  +N        ++    NSS     S 
Sbjct: 87  NKISDFAWSSDSRSILSASQDGFMIVWDASLGFKKNAIPLDSQWVLTCAINSSGNLVASA 146

Query: 282 DADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKF-----VIPG 336
              N   ++ ++    +Q                   MF   T +V   +F     +I  
Sbjct: 147 GLTNSCTIYRISQENRVQQ--------------QIVSMFKGHTCYVSQVEFFENNSIITA 192

Query: 337 PGG-NLLVYTMSDSRPIGKLVGHRGTISQLEF-----NSETKLLASAADDNTIRVWHGGN 390
            G     ++ +  ++ I +   H G +  L        + + + AS   D  + +W    
Sbjct: 193 SGDMTCALWDIPKAKRIAEFSDHLGDVLALALPPPHAQTSSPIFASGGSDGYVYIWDTRA 252

Query: 391 GNSIHCFYGHTQTIVSLKWVNNDM-LISASMDGSVKLW----DCGKKLQEITGNL 440
             +   F+     I +LK+ NN   +++ + DG  +++    DC      ++ NL
Sbjct: 253 RAAAQSFFVSESDISTLKFFNNGYAIVTGADDGVARMFDMRSDCAVASYSLSQNL 307

>Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement
          Length = 1261

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 64/285 (22%), Positives = 116/285 (40%), Gaps = 51/285 (17%)

Query: 228 LSWAHDGDSIATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFI-STDADN 285
           L W+ D   +A  ++NG +  ++ KE K     + H +P+  + +N+   + + S D+  
Sbjct: 68  LDWSPDNSILAGALDNGIVEFFSPKELKSVAKISKHTTPVNTLKFNAKQDNVLCSGDSRG 127

Query: 286 ITILWDVN-----------SGVVLQHFE---SKAXXXXXXXXXXXXQMFGVDTVW-VDTD 330
              +WD+N            GV +   +   S A               G  ++W +   
Sbjct: 128 EIFIWDINKITSSGYVPFSPGVAMTPIDEVYSLAWNQSLAHVFASAGSSGYTSIWDLKAK 187

Query: 331 KFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEF--NSETKLLASAADDN--TIRVW 386
           K V+       L YT   +       G +  +S +E+  ++ TK+  +  +DN   I VW
Sbjct: 188 KEVL------HLSYTSPST-------GAKNHLSVVEWHPSNSTKIATATGNDNDPVILVW 234

Query: 387 HGGNGNSI--HCFYGHTQTIVSLKWVNND--MLISASMDGSVKLWD--CGKKLQEIT--G 438
              N  +       GH++ I+SL W   D  +L+S+  D +  LW+    +KL +    G
Sbjct: 235 DLRNAKAPLQAMSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWNPQTAQKLSQFPTRG 294

Query: 439 NLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAALLKR 483
           N   +T       FA    D    +A+  +D ++ V  L  L  +
Sbjct: 295 NWCFKT------KFAPEAPD---LFASASLDNKIQVQTLQNLTNK 330

>KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomyces
           cerevisiae YDR128w, start by similarity
          Length = 1133

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 51/111 (45%), Gaps = 8/111 (7%)

Query: 347 SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNS-IHCFYGHTQTIV 405
           S  +P  +    R   +Q+++N +   + + +  N + VW    G S +    GH+ ++ 
Sbjct: 146 SPKKPYFRTSNWRSGAAQVKWNHKNSNVLATSHSNIVYVWDVRKGTSPLSVLEGHSGSVN 205

Query: 406 SLKW--VNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAG 454
           S+ +   N   ++S+  DG+VK WD  K   E     +  TI    P++ G
Sbjct: 206 SIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE-----LQMTITTEFPVWRG 251

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/126 (19%), Positives = 46/126 (36%), Gaps = 56/126 (44%)

Query: 263 KSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGV 322
           +S    + WN  N++ ++T   NI  +WDV  G                           
Sbjct: 158 RSGAAQVKWNHKNSNVLATSHSNIVYVWDVRKG--------------------------- 190

Query: 323 DTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFN--SETKLLASAADD 380
                                     + P+  L GH G+++ ++FN  +ET+++ S+ +D
Sbjct: 191 --------------------------TSPLSVLEGHSGSVNSIDFNPFNETEIM-SSGND 223

Query: 381 NTIRVW 386
            T++ W
Sbjct: 224 GTVKFW 229

>KLLA0B07667g 667863..673862 weakly similar to sp|P25356 Saccharomyces
            cerevisiae YCR032w BPH1g to human beige-like protein and
            mouse lysosomal trafficking regulator singleton, start by
            similarity
          Length = 1999

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 4/87 (4%)

Query: 222  TNQLTCLSWAHDGDSIATGVENGELRLW--NKEG-KLQNVFNFHKSPIIAIHWNSSNTHF 278
            ++++T LS   D   IATG   G ++LW  +K+G      F  H+S I +I  +      
Sbjct: 1780 SSKITVLS-NFDQSLIATGDSIGLIKLWRTSKDGLTFLRCFCGHESSIKSIRASLQCDTI 1838

Query: 279  ISTDADNITILWDVNSGVVLQHFESKA 305
            IS D    TI+WD+ +G V+  F   A
Sbjct: 1839 ISLDTHGTTIVWDLKNGTVINKFSIMA 1865

>Sklu_2167.5 YGL213C, Contig c2167 8275-9186
          Length = 303

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW 386
           GNL V T S    +G    H G +  L FNS  + LAS   D+ +RVW
Sbjct: 178 GNLTVPTHSAQTSVGSFA-HDGWVFSLSFNSTGEFLASCGYDSKVRVW 224

>Scas_700.27*
          Length = 433

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 364 QLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND-MLISASMDG 422
           Q+ F     L+A+A  D+ +R+W      ++    GH   I  +  +  D  ++S S D 
Sbjct: 211 QMIFILLLNLIATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQIVSCSTDA 270

Query: 423 SVKLWD--CGKKLQEIT 437
           +++LWD   GK ++ IT
Sbjct: 271 TIRLWDIVAGKSMKVIT 287

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 68/151 (45%), Gaps = 14/151 (9%)

Query: 355 LVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDM 414
           L+GH+  I+++        + S + D TIR+W    G S+     H +++ ++ +   + 
Sbjct: 244 LIGHKNPINKVHCLPVDPQIVSCSTDATIRLWDIVAGKSMKVITHHKKSVRNIAFHPTEF 303

Query: 415 LISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTV 474
            +S+     ++ W    KL E  G L+     DG+ I      +  +   AG  +G ++ 
Sbjct: 304 SMSSCSANDIRSW----KLPE--GGLLTNFNSDGLGIINTLSINQDDVLFAGSDNGMLSF 357

Query: 475 FNLAALLKRYSKGKKHKNHVMSIPICGDFQS 505
           ++       Y  G K+++ +M+  I G  +S
Sbjct: 358 YD-------YKSGHKYQS-MMTKEIPGSLES 380

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 237 IATGVENGELRLWNKEGKLQNVFNF-HKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295
           IAT   +  +RLW+   ++  +    HK+PI  +H    +   +S   D    LWD+ +G
Sbjct: 221 IATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQIVSCSTDATIRLWDIVAG 280

Query: 296 ----VVLQHFES 303
               V+  H +S
Sbjct: 281 KSMKVITHHKKS 292

>Kwal_26.8975
          Length = 445

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 234 GDSIATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILW 290
           GD I +G  +G +R WN  GK++  +  H   + A+ + SS T  +S   D    LW
Sbjct: 112 GDKIVSGSYDGIVRTWNLSGKVEKQYAGHSGAVRAVKYISS-TRLVSGANDRTLRLW 167

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 118/298 (39%), Gaps = 48/298 (16%)

Query: 225 LTCLSWAHDGDSIATGVENGELRLWNKE-GKLQNVFNFHKSPIIAIHWNSSNTHFISTDA 283
           L  LSW+   + +A  ++   + LWN E G++  +  F    I ++ W++ + H      
Sbjct: 226 LNLLSWSKK-NVLAIALDQ-SIYLWNGETGEVSLLTEFETETITSVVWSNDDCHISIGKD 283

Query: 284 DNITILWDVNSGVVLQHFESKAXXXXXXXXXXXXQMFGVDTV---WVDTDKFVIPGPGGN 340
           D  T +WDV +   ++   S                 GV      W+DT    I    G 
Sbjct: 284 DGNTEIWDVETMSHVRTMRSS---------------LGVRICSQDWLDT-VVCIGAKSGE 327

Query: 341 LLVYTMSDSRPIGKLVG----HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHC 396
           + V   +D R    +V     H   +  ++F  +   LAS  +DNT+ +W       +  
Sbjct: 328 IQV---NDVRVKDHIVSTWEKHTSEVCGIKFRQDGLQLASGGNDNTVMIWDTRQDEPLWV 384

Query: 397 FYGHTQTIVSLKW----VNNDMLISASMDGSVKLWD--CGKKLQEI-TGNLIAETIVDGV 449
              H   + ++ W    VN       S+D  +  W+   G ++  I TG+ ++       
Sbjct: 385 KRNHNAAVKAITWHPDVVNLLATGGGSLDRHIHFWNTTTGARIGSINTGSQVSS------ 438

Query: 450 PIFAGAISDD----RERYA-AGFMDGQVTVFNLAALLKRYSKGKKHKNHVMSIPICGD 502
            +  G   +D    RE  A  G  D  ++++N  + +K     + H++ ++S  +  D
Sbjct: 439 -LHWGQSYEDSHMNREIVATGGSPDNSISIYNYDSKVKVAEITQAHESRIVSSQLSPD 495

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 36.6 bits (83), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 246 LRLWN-KEGKLQNVFNF-HKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQ 299
           +R+W+ + G  Q    + H++P++   W+S  T   S   DNI  L+DV SG   Q
Sbjct: 58  VRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLYDVASGQAQQ 113

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 3/71 (4%)

Query: 361 TISQLEFNSETKLLAS-AADDNTIRVWHGGNGNSI-HCFYGHTQTIVSLKWVNNDMLI-S 417
           ++S + F+ +   L S AA DNT+R+W   NG +     Y H   +++ +W ++   + S
Sbjct: 35  SVSDIAFSPQQDFLFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVAS 94

Query: 418 ASMDGSVKLWD 428
              D  +KL+D
Sbjct: 95  GGCDNILKLYD 105

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 38/207 (18%), Positives = 80/207 (38%), Gaps = 17/207 (8%)

Query: 240 GVENGELRLWNKEGKLQNV-FNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVL 298
           G   G + ++N +  LQ   +  HK  +  +  +  N   +S   D +   +D      L
Sbjct: 484 GSSEGGIGVYNLQSGLQRKKYRLHKKAVTGVAIDGMNRKMVSCGLDGLIGFYDFTKSAFL 543

Query: 299 QHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGH 358
              +  A                       +D F +     +++V      + + +L GH
Sbjct: 544 GKLQLDAPVTSMVYHR-------------SSDLFAVALDDLSIVVIDAVTQKVVRQLWGH 590

Query: 359 RGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWV-NNDMLIS 417
              ++  +F+ + + + SA+ D+TIR W    G  I      +    +LK+  N D+L +
Sbjct: 591 SNRVTAFDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGVRLDS-VATNLKFSPNGDLLAT 649

Query: 418 ASMDGS-VKLWDCGKKLQEITGNLIAE 443
             + G+ + +W    + + ++   I E
Sbjct: 650 THVTGNGISIWTNRAQFKPVSTRQINE 676

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 42/98 (42%), Gaps = 3/98 (3%)

Query: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSI-HCFYGHT 401
           V+  +    +   V H   I  +  +     + + +DD T+++W+  N  S+   F GH 
Sbjct: 81  VFNYNTGEKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHE 140

Query: 402 QTIVSLKWVNND--MLISASMDGSVKLWDCGKKLQEIT 437
             ++ + +   D  +  S  +D  VK+W  G+     T
Sbjct: 141 HFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFT 178

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 49/102 (48%), Gaps = 4/102 (3%)

Query: 343 VYTMSDSRPIGKL-VGHRGTISQLEFNS--ETKLLASAADDNTIRVWHGGNGNSIHCFYG 399
           V+++  S P   L  G    ++ +++    +   + +++DD T++++     + +    G
Sbjct: 167 VWSLGQSTPNFTLHTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVATLEG 226

Query: 400 HTQTI-VSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNL 440
           H   +  ++      ++IS S DG+VKLW+      E T NL
Sbjct: 227 HMSNVSFAVFHPTLPIIISGSEDGTVKLWNSSTYKLEKTLNL 268

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 69/164 (42%), Gaps = 18/164 (10%)

Query: 366 EFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLK-WVNNDMLISASMDGSV 424
           +F +    +   +DDN +RV++   G  +  F  H   I S+    +   +++ S D +V
Sbjct: 62  KFITRKNWIVVGSDDNKVRVFNYNTGEKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTV 121

Query: 425 KLWDCGKKLQEITGNLIAETIVDGVPIFAGAIS---DDRERYAAGFMDGQVTVFNLAALL 481
           KLW+          +   E    G   F   ++    D   +A+G +D +V V++L    
Sbjct: 122 KLWNW-------ENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQST 174

Query: 482 KRY---SKGKKHKNHVMSIPICGD-FQSAHSDDS---VFDLSWK 518
             +   +  +K  N+V   P+    +    SDD+   +FD   K
Sbjct: 175 PNFTLHTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTK 218

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 43/84 (51%), Gaps = 21/84 (25%)

Query: 167 WNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLT 226
           ++P + ++LA    D T ++  +ET           + I++L+HP           + +T
Sbjct: 147 YHPTAKDVLASSSLDYTVRIWNVETG----------EDIYKLKHP-----------DMVT 185

Query: 227 CLSWAHDGDSIATGVENGELRLWN 250
            +S+++DG  +AT   + +LR+WN
Sbjct: 186 SMSFSYDGTHLATVARDKKLRVWN 209

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 346 MSDSRPIGKLVGHRGTISQLEFNSETK-LLASAADDNTIRVWHGGNGNSIHCFYGHTQTI 404
           + D  P   L GH   +  + ++   K +LAS++ D T+R+W+   G  I+    H   +
Sbjct: 126 IKDIEPTKFLTGHSRKVGHILYHPTAKDVLASSSLDYTVRIWNVETGEDIYKL-KHPDMV 184

Query: 405 VSLKW-VNNDMLISASMDGSVKLWDC 429
            S+ +  +   L + + D  +++W+ 
Sbjct: 185 TSMSFSYDGTHLATVARDKKLRVWNV 210

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 43/100 (43%), Gaps = 3/100 (3%)

Query: 341 LLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWH-GGNGNSIHCFYG 399
           L VY  +    + +   H   I  +  +     + + +DD TI++W+   N      F G
Sbjct: 79  LRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQQTFTG 138

Query: 400 HTQTIVSLKWVNND--MLISASMDGSVKLWDCGKKLQEIT 437
           H   ++S+ +   D     S  +D ++K+W  G+ +   T
Sbjct: 139 HEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFT 178

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/155 (19%), Positives = 61/155 (39%), Gaps = 12/155 (7%)

Query: 237 IATGVENGELRLWN--KEGKLQNVFNFHKSPIIAIHWNSSNT-HFISTDADNITILWDVN 293
           + TG ++  ++LWN  K    Q  F  H+  ++++ +N  +   F S   D+   +W + 
Sbjct: 112 VLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIG 171

Query: 294 SGVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIG 353
             V   +F  KA             +        D    +     G + V+       + 
Sbjct: 172 QDV--PNFTLKAHETKGVNYVDYYPL-------QDKPYLITTSDDGTIKVWDYQTKSNVA 222

Query: 354 KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHG 388
            L GH   +S   F+    ++ S ++D T+++W+ 
Sbjct: 223 TLEGHMANVSYAVFHPTLPIIISGSEDGTLKIWNA 257

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 6/106 (5%)

Query: 374 LASAADDNTIRVWHGGNGNSIHCFYGHTQTI-VSLKWVNNDMLISASMDGSVKLWDCGKK 432
           L + +DD TI+VW     +++    GH   +  ++      ++IS S DG++K+W+    
Sbjct: 201 LITTSDDGTIKVWDYQTKSNVATLEGHMANVSYAVFHPTLPIIISGSEDGTLKIWNANTY 260

Query: 433 LQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLA 478
             E T N+  E         A   S  R   A+GF +G  TV +L 
Sbjct: 261 KLEKTLNIGLERSW----CIATHPSGKRNYIASGFDNG-FTVLSLG 301

>Kwal_56.24478
          Length = 1296

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 15/116 (12%)

Query: 198 IKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGE-----LRLW--- 249
           +K  ++ IH L H   TS+ TG+  NQL+ + W H  +S      +G      + +W   
Sbjct: 184 LKAKKEVIH-LSH---TSSITGQ-KNQLSIVEW-HPNNSTRIATASGSDSDPSILVWDLR 237

Query: 250 NKEGKLQNVFNFHKSPIIAIHWNSSN-THFISTDADNITILWDVNSGVVLQHFESK 304
           N    LQ +   H   ++++ W   + T  +S+  DN  +LW+  SG  L  F ++
Sbjct: 238 NANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRDNSCVLWNPESGQNLTQFPTR 293

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 61/120 (50%), Gaps = 14/120 (11%)

Query: 355 LVGHRGTISQLEF--NSETKLL-ASAAD-DNTIRVWHGGNGN-SIHCF-YGHTQTIVSLK 408
           + G +  +S +E+  N+ T++  AS +D D +I VW   N N  +     GHT+ ++SL 
Sbjct: 199 ITGQKNQLSIVEWHPNNSTRIATASGSDSDPSILVWDLRNANVPLQTLSQGHTKGVLSLD 258

Query: 409 WVNND--MLISASMDGSVKLW--DCGKKLQEIT--GNLIAET-IVDGVP-IFAGAISDDR 460
           W   D  +L+S+  D S  LW  + G+ L +    GN   +T      P +FA A  D++
Sbjct: 259 WCKQDETLLLSSGRDNSCVLWNPESGQNLTQFPTRGNWCFKTKFAPQAPDLFASASFDNK 318

>CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces
           cerevisiae YAR003w, hypothetical start
          Length = 440

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 41/96 (42%), Gaps = 16/96 (16%)

Query: 202 EKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATGVENGELRLWNKEG-----KLQ 256
           EK +H L +P  T            CL ++  GD +A G  NG + +++ +       L 
Sbjct: 17  EKLVHTLENPLNTE-----------CLEFSPGGDYLALGCSNGAVIIYDMDTLKPITMLG 65

Query: 257 NVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDV 292
           +    H   + ++ W+    + I+T  D    LWD+
Sbjct: 66  SKLGGHVQAVNSVSWSGCGRYLITTSRDWFIKLWDL 101

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 4/64 (6%)

Query: 368 NSETKLLASA--ADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISAS--MDGS 423
           NS   L+ASA  +  + + +W  G G  +    G  + ++++ W  N+M I+ +    GS
Sbjct: 284 NSAEYLVASAHGSSAHELYIWETGAGTLVRVLEGAEEELMNISWNFNNMCIACNGFETGS 343

Query: 424 VKLW 427
           + +W
Sbjct: 344 IYIW 347

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 399 GHTQTIVSLKWVN-NDMLISASMDGSVKLWDCGKKLQEITGNLIAETI 445
           GH Q + S+ W      LI+ S D  +KLWD  K  + +   L++ ++
Sbjct: 70  GHVQAVNSVSWSGCGRYLITTSRDWFIKLWDLAKPGEPLKEVLMSSSV 117

>Kwal_14.1235
          Length = 607

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 237 IATGVENGELRLWN---KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVN 293
           + +G++NG + +      EG + + F  H S +  +  N+  + FIS   D   + WD+N
Sbjct: 289 LLSGLQNGGITMQGCRFMEGHIAHYFKKHTSTVNQLKLNNDESRFISGSWDKQVLEWDLN 348

Query: 294 SGVVLQHFESKA 305
           SG  +  F+  +
Sbjct: 349 SGECINEFKGSS 360

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 5/67 (7%)

Query: 391 GNSIHCFYGHTQTIVSLKWVNND--MLISASMDGSVKLWD--CGKKLQEITGNLIAETIV 446
           G+  H F  HT T+  LK +NND    IS S D  V  WD   G+ + E  G+    + +
Sbjct: 308 GHIAHYFKKHTSTVNQLK-LNNDESRFISGSWDKQVLEWDLNSGECINEFKGSSAQISSL 366

Query: 447 DGVPIFA 453
           +  P+F+
Sbjct: 367 EFRPLFS 373

>Kwal_56.24399
          Length = 369

 Score = 36.2 bits (82), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 391 GNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKK 432
           G  +  F GHT+ +  ++ +N D   S S DG++K+WD   K
Sbjct: 151 GRKLRNFAGHTRVVNQVRALNTDRFASVSDDGALKIWDAHTK 192

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 50/127 (39%), Gaps = 16/127 (12%)

Query: 262 HKSPIIAIHWNSSNTHFISTDADNITILWDVNSG--VVLQHFESKAXXXXXXXXXXXXQM 319
           H  P++A  +  S T  +S   D    +WD+ SG   VL H   ++             +
Sbjct: 75  HTRPVLACKFVKSGTLALSAGLDPHLCIWDLKSGHNHVLGHCHRRSAA-----------I 123

Query: 320 FGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAAD 379
              DT  +D  + V       L +  +   R +    GH   ++Q+     T   AS +D
Sbjct: 124 TTFDT--LDDTRAVTGSSDTRLALVDLHTGRKLRNFAGHTRVVNQVR-ALNTDRFASVSD 180

Query: 380 DNTIRVW 386
           D  +++W
Sbjct: 181 DGALKIW 187

>Kwal_56.23685
          Length = 1102

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 363 SQLEFNSETKLLASAADDNTIRVWHGGNG-NSIHCFYGHTQTIVSLKWVNNDM--LISAS 419
           SQ+++N +   + ++A  N + +W    G   +H   GH  ++ S+ +   D   ++S+S
Sbjct: 162 SQVKWNYKNSNVMASAHSNDVYIWDLRKGCTPLHVLQGHVNSVNSIDFSKFDETEIMSSS 221

Query: 420 MDGSVKLWD 428
            DG+VK WD
Sbjct: 222 NDGTVKFWD 230

>YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and
           COMPASS complex, contains a WD (WD-40) repeat [1281 bp,
           426 aa]
          Length = 426

 Score = 36.2 bits (82), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 12/98 (12%)

Query: 208 LRHPFAT-----SATTGKITNQLT--CLSWAHDGDSIATGVENGELRLWNKEGKLQ---- 256
           L+ PFA         T  I N L   CL ++  GD +A G  NG L +++ +        
Sbjct: 5   LQDPFAVLKEHPEKLTHTIENPLRTECLQFSPCGDYLALGCANGALVIYDMDTFRPICVP 64

Query: 257 -NVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVN 293
            N+   H  PI +I W+      +++  D    LWD++
Sbjct: 65  GNMLGAHVRPITSIAWSPDGRLLLTSSRDWSIKLWDLS 102

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 4/42 (9%)

Query: 399 GHTQTIVSLKW-VNNDMLISASMDGSVKLWDC---GKKLQEI 436
            H + I S+ W  +  +L+++S D S+KLWD     K L+EI
Sbjct: 70  AHVRPITSIAWSPDGRLLLTSSRDWSIKLWDLSKPSKPLKEI 111

>YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly
           complex subunit 1, involved in nucleosome assembly
           linked with DNA replication, has WD (WD-40) repeats
           [1407 bp, 468 aa]
          Length = 468

 Score = 36.2 bits (82), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 57/128 (44%), Gaps = 15/128 (11%)

Query: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN 411
           +G L  H   I+ + FNS+  +LASA DD  + +W   + N+        +++V    ++
Sbjct: 64  LGSLTHHEQAINVIRFNSKGDVLASAGDDGQVLLWKQEDPNT------QQESVVRPFGMD 117

Query: 412 NDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQ 471
            +   ++  D + + W   K+L+  +G   A  I D       A S D        MD  
Sbjct: 118 AE---TSEADENKEKWVVWKRLRGGSGATAAAEIYD------LAWSPDNRNIVVACMDNS 168

Query: 472 VTVFNLAA 479
           + +F++ A
Sbjct: 169 IRLFDVGA 176

 Score = 29.6 bits (65), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 40/95 (42%), Gaps = 23/95 (24%)

Query: 348 DSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVW------HGGNGNSIHC----F 397
           DS+P+  L          + NS    L +A  DN +R+W      +G NG         F
Sbjct: 12  DSQPVYSLT--------FQKNSANDKLFTAGGDNKVRIWKLNRDENGQNGGVRKIESLDF 63

Query: 398 YG----HTQTIVSLKW-VNNDMLISASMDGSVKLW 427
            G    H Q I  +++    D+L SA  DG V LW
Sbjct: 64  LGSLTHHEQAINVIRFNSKGDVLASAGDDGQVLLW 98

>Scas_658.1
          Length = 442

 Score = 36.2 bits (82), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 74/173 (42%), Gaps = 22/173 (12%)

Query: 222 TNQLTCLSW-AHDGDSIATGVENGELRLWNKEGK--LQNVFNFHKSPIIAIHWNSSNTHF 278
           TN  T L++  + G+ + +G  +  +++W+   K  L   +  H   I ++ +N   T+F
Sbjct: 149 TNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGTNF 208

Query: 279 ISTDADNITILWDVNSGVVLQ--HFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPG 336
           IS+  D+   +WD   G V    HF+S                  V     ++ +F++  
Sbjct: 209 ISSSFDHTIKIWDTEQGKVKTKLHFKSTPND--------------VKFRPFNSSEFIVGF 254

Query: 337 PGGNLLVYTMSDSRPIGKLV---GHRGTISQLEFNSETKLLASAADDNTIRVW 386
               +  Y    S   G++     H  +I  L+F  +     S+++D T+R+W
Sbjct: 255 ANSKIYHYDTRISENDGRVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIW 307

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/173 (18%), Positives = 63/173 (36%), Gaps = 51/173 (29%)

Query: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGN------------------------ 392
           GH   I+ L+FN +     S++ D+TI++W    G                         
Sbjct: 191 GHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPFNSSEF 250

Query: 393 ---------------------SIHCFYGHTQTIVSLKWV-NNDMLISASMDGSVKLWDCG 430
                                 +  +  H  +I++LK+  +    IS+S D +V++WD  
Sbjct: 251 IVGFANSKIYHYDTRISENDGRVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIWD-- 308

Query: 431 KKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAALLKR 483
                +    I++T    +P     I  D++ + A  MD  +  +++    +R
Sbjct: 309 -NQVNVPIKQISDTTQYSMPSI--DIHPDKKNFCAQSMDNTIYTYSMKPKYRR 358

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 245 ELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQH 300
           + R+   +G++Q V++ H S I+A+ +    + FIS+  D    +WD    V ++ 
Sbjct: 263 DTRISENDGRVQ-VYDHHMSSILALKFFPDGSKFISSSEDKTVRIWDNQVNVPIKQ 317

>Sklu_2113.2 YCL039W, Contig c2113 2538-4865
          Length = 775

 Score = 36.2 bits (82), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 18/94 (19%)

Query: 352 IGKLVGHRGT--ISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHT-------- 401
           + K VG R    I +  F  + KL+AS ++D  + +W   +GN I    GHT        
Sbjct: 677 VQKYVGQRQLQFIIRSCFGYDNKLIASGSEDGKVYIWDRFHGNIIGVLKGHTADRPVPPG 736

Query: 402 ------QTIVSLKW--VNNDMLISASMDGSVKLW 427
                 +   ++ W  VN  +  S   DG VK+W
Sbjct: 737 SSKQYGKNCNTVVWNPVNKHLFASGGDDGLVKVW 770

>Kwal_55.21450
          Length = 503

 Score = 35.8 bits (81), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 53/110 (48%), Gaps = 14/110 (12%)

Query: 188 ELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSW-AHDGDSIATGVENGEL 246
           E  + + D QIK+ +    ++RH ++ S     I N   C  +   + +    G+ N E+
Sbjct: 268 EFLSVSFDQQIKIWDTETGKVRHQYSYSC----IPN---CAEFRPSNSNEFIVGLSNSEI 320

Query: 247 RLWN-----KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWD 291
           R ++     K G +Q V++ H S IIA+ +    + F+S+  D    +W+
Sbjct: 321 RHYDLRTSHKNGLVQ-VYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWE 369

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 6/88 (6%)

Query: 400 HTQTIVSLKWV-NNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISD 458
           H  +I++LK+  +    +S+S D S+++W+       I    I++T    +P     I  
Sbjct: 340 HLSSIIALKYFPDGSKFVSSSEDKSMRIWE---NQINIPIKQISDTSQYSMPYIG--IHP 394

Query: 459 DRERYAAGFMDGQVTVFNLAALLKRYSK 486
           ++  +AA  MD  +  F++    KR+ K
Sbjct: 395 EQNYFAAQSMDNAIYAFSMKPKYKRHPK 422

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 51/124 (41%), Gaps = 9/124 (7%)

Query: 357 GHR-GTISQLEFNSETKLLASAADDNTIRVWHGGNGNS-IHCFYGHTQTIVSLKW-VNND 413
           GH+ GT S L       L  SA +DN +++W        +  + GH++ +  + +     
Sbjct: 208 GHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGISFNSEGS 267

Query: 414 MLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVT 473
             +S S D  +K+WD        TG +  +     +P  A     +   +  G  + ++ 
Sbjct: 268 EFLSVSFDQQIKIWDTE------TGKVRHQYSYSCIPNCAEFRPSNSNEFIVGLSNSEIR 321

Query: 474 VFNL 477
            ++L
Sbjct: 322 HYDL 325

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 59/132 (44%), Gaps = 17/132 (12%)

Query: 394 IHCFYGH---TQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVP 450
           IH + GH   T +I+ L   +  + +SA  D  VK+WD  +  + +         V G+ 
Sbjct: 203 IHTYPGHKNGTNSILLLP-KSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGI- 260

Query: 451 IFAGAISDDRERYAAGFMDGQVTVFNLAALLKRYSKGK-KHKNHVMSIPICGDFQSAHSD 509
               + + +   + +   D Q+ +++          GK +H+     IP C +F+ ++S+
Sbjct: 261 ----SFNSEGSEFLSVSFDQQIKIWDTET-------GKVRHQYSYSCIPNCAEFRPSNSN 309

Query: 510 DSVFDLSWKEDR 521
           + +  LS  E R
Sbjct: 310 EFIVGLSNSEIR 321

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 45/259 (17%), Positives = 101/259 (38%), Gaps = 27/259 (10%)

Query: 237 IATGVENGELRLWN--KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNS 294
           ++ G +N ++++W+  ++ +L   +  H   +  I +NS  + F+S   D    +WD  +
Sbjct: 227 LSAGNDN-QVKIWDLYRDRELLRDYRGHSKAVRGISFNSEGSEFLSVSFDQQIKIWDTET 285

Query: 295 GVVLQHFESKAXXXXXXXXXXXXQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGK 354
           G V   +                          ++++F++      +  Y +  S   G 
Sbjct: 286 GKVRHQYSYSCIPNCAEFRPS------------NSNEFIVGLSNSEIRHYDLRTSHKNGL 333

Query: 355 LV---GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN 411
           +     H  +I  L++  +     S+++D ++R+W       I      +Q   S+ ++ 
Sbjct: 334 VQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWENQINIPIKQISDTSQ--YSMPYIG 391

Query: 412 ----NDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGF 467
                +   + SMD ++  +    K +       +     G  I  G  S D +  A+G 
Sbjct: 392 IHPEQNYFAAQSMDNAIYAFSMKPKYKRHPKKHFSGHKCAGFGIGFG-FSPDGQYIASGD 450

Query: 468 MDGQVTVFNLAA--LLKRY 484
             G+V +++     LLK +
Sbjct: 451 TRGRVYIWDWKTTHLLKHF 469

>Scas_442.2*
          Length = 795

 Score = 35.8 bits (81), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 68/157 (43%), Gaps = 18/157 (11%)

Query: 336 GPGGNLLVYTMSDSRPIG---KLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNG- 391
           G G  + ++   D    G    L GH   ++ ++F ++T  + S ++D+ +++W    G 
Sbjct: 33  GAGQTIALWNPLDENSQGVFATLKGHEAEVTCVKFITDTPYMVSCSEDHHVKIWKQNPGV 92

Query: 392 -------NSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAE- 443
                    +     ++ T+V+L  V   ++     DG V LW   +K++E    L  E 
Sbjct: 93  AREVDGWTCVQTLDHYSHTVVALA-VLPGLIAVGCADGKVSLW--VQKMKEDVFILGEEF 149

Query: 444 TIVDGVPIFAGAIS---DDRERYAAGFMDGQVTVFNL 477
            +  GV   A A S   DD+   A G  +  V VF+ 
Sbjct: 150 EVQKGVLPLALAFSKVIDDKYLLAVGGTNVNVFVFSF 186

>YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown
           function, member of the WD (WD-40) repeat family [2238
           bp, 745 aa]
          Length = 745

 Score = 35.8 bits (81), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 73/172 (42%), Gaps = 33/172 (19%)

Query: 327 VDTDKFVIP-----GPGGNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDN 381
           VD   F+IP       G N+   ++    P+     H+G   Q + +    L+  +  DN
Sbjct: 585 VDPKNFLIPRIARLDVGKNMTCISL----PLN--TTHQGFHRQ-QISESQHLVLVSLQDN 637

Query: 382 TIRVWHGGNGNSIHCFYGHTQ---TIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITG 438
            +++W       I  ++G  Q    I S     N +++S S DG + +WD       I G
Sbjct: 638 ELQMWDYKENILIQKYFGQKQQHFIIRSCFAYGNKLVMSGSEDGKIYIWD------RIRG 691

Query: 439 NLIA-----ETIVDGVPIFAGAISD-------DRERYAAGFMDGQVTVFNLA 478
           NL++      T++       G   +       D+E +A+G  DG++ ++ ++
Sbjct: 692 NLVSVLSGHSTVMSNSTKPMGKNCNVVASNPADKEMFASGGDDGKIKIWKIS 743

>Scas_657.13
          Length = 411

 Score = 35.4 bits (80), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 25/125 (20%), Positives = 50/125 (40%), Gaps = 18/125 (14%)

Query: 332 FVIPGPGGNLLVYTMSD-SRPIGKLVGHRGTISQLEFNSETK-LLASAADDNTIRVW--- 386
           F   G   ++ ++   D SRP+  + GH G ++ +EF+ +   +L ++ +D    +W   
Sbjct: 277 FAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDIC 336

Query: 387 -----------HGGNGNSIHCFYGHTQTIVSLKWVNND--MLISASMDGSVKLWDCGKKL 433
                        G    +    GH   I       N   ++ S+  +  +++W C  KL
Sbjct: 337 DIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKL 396

Query: 434 QEITG 438
             + G
Sbjct: 397 PRVGG 401

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 80/205 (39%), Gaps = 37/205 (18%)

Query: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKL-----------LASAADDNTIRVWH 387
           G + +Y  S  +       H G +S  E++ E              L S +DD TI +W+
Sbjct: 149 GKVFLYDRSKDK-------HSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWN 201

Query: 388 GGNGNSIHCFYG---HTQTIVSLKWVNNDMLI--SASMDGSVKLWDCGKKLQEITGNLIA 442
             N NS   +     H+  +   KW N D+ +  S S D +++L D  +K         +
Sbjct: 202 VNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREK-----DTFTS 256

Query: 443 ETIVDGVPIFAGAISDDRER-YAAGFMDGQVTVFNLAALLKRYSKGKKHKNHVMSIPICG 501
           +  VD  P    A S   +  +AA   D  V +F+   + +       H   V ++    
Sbjct: 257 QFKVDA-PFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSP 315

Query: 502 DFQSAHSDDSVFDLSWKEDRLAIAY 526
           D       D +  ++  EDR AI +
Sbjct: 316 D------QDGIL-MTSGEDRRAIIW 333

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score = 35.8 bits (81), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 394 IHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGK 431
           +  +  H   ++ + W  N+ LISASMD + KLW   K
Sbjct: 405 VRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSK 442

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 3/61 (4%)

Query: 369 SETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW--VNNDMLISASMDGSVKL 426
           S+   L SA+ D T ++WH     S+  F  H   +  +K+   ++   IS  +D   +L
Sbjct: 421 SKNNFLISASMDKTAKLWHPSKMRSLKSFQ-HPDFVTCVKFHPTDDRFFISGCLDQKCRL 479

Query: 427 W 427
           W
Sbjct: 480 W 480

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score = 35.8 bits (81), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 397 FYGHTQTIVSLKWVNNDMLISASMDGSVKLW 427
           F  H Q I+   W  N  L++ASMD +VKLW
Sbjct: 210 FGEHLQDILDCDWSKNSFLLTASMDKTVKLW 240

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 47/114 (41%), Gaps = 10/114 (8%)

Query: 369 SETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNND--MLISASMDGSVKL 426
           S+   L +A+ D T+++WH     S+  F  H   +  +++  +D     S  +D +V+ 
Sbjct: 223 SKNSFLLTASMDKTVKLWHINRTTSLKTFV-HPDFVTCVRFHPHDDRFFFSGCLDHTVRT 281

Query: 427 WDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAAL 480
           W        I    +AE    G  I A  +S D      G  +G V V +   L
Sbjct: 282 WS-------ILEGEVAEAFNCGDLIMALDVSPDGNWLLIGTFNGYVHVLHTNGL 328

>Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement
          Length = 367

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 245 ELRLWNKEGKL-QNVFNF-HKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQ 299
           ++R+W+  G + Q    + H++P++   W++  T   S   DN+  L+DV SG   Q
Sbjct: 59  KVRIWDVNGGMAQGRAQYEHQAPVLTTRWSNDGTKVASGGCDNVVKLFDVQSGQAQQ 115

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,965,741
Number of extensions: 799844
Number of successful extensions: 5517
Number of sequences better than 10.0: 441
Number of HSP's gapped: 4785
Number of HSP's successfully gapped: 1033
Length of query: 527
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 421
Effective length of database: 12,926,601
Effective search space: 5442099021
Effective search space used: 5442099021
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)