Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K12100g32732217430.0
YDR044W (HEM13)32832314820.0
Scas_569.333332314120.0
Sklu_2357.834132313960.0
Kwal_27.1093534432313820.0
KLLA0F18546g37531513090.0
AGR030C32431611771e-163
KLLA0E11275g38572720.42
AEL178C30787653.1
Scas_681.121176146645.0
Sklu_2020.347950636.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K12100g
         (322 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K12100g 1183383..1184366 highly similar to sp|P11353 Saccha...   676   0.0  
YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen I...   575   0.0  
Scas_569.3                                                            548   0.0  
Sklu_2357.8 YDR044W, Contig c2357 11533-12558                         542   0.0  
Kwal_27.10935                                                         536   0.0  
KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1 Kluyver...   508   0.0  
AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH] (768609..7...   457   e-163
KLLA0E11275g complement(993416..994573) similar to ca|CA5508|IPF...    32   0.42 
AEL178C [2328] [Homologous to ScYJL053W (PEP8) - SH] (303884..30...    30   3.1  
Scas_681.12                                                            29   5.0  
Sklu_2020.3 YCR045C, Contig c2020 5388-6827 reverse complement         29   6.0  

>CAGL0K12100g 1183383..1184366 highly similar to sp|P11353
           Saccharomyces cerevisiae YDR044w HEM13
           coproporphyrinogen III oxidase, start by similarity
          Length = 327

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/322 (100%), Positives = 322/322 (100%)

Query: 1   MTAPQDPKHLPIRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQN 60
           MTAPQDPKHLPIRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQN
Sbjct: 1   MTAPQDPKHLPIRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQN 60

Query: 61  GSTFEKGGVNVSVVYGELTPGAVLAMKQEHKDLKLPESANGLPNSEGVKFFACGLSMVIH 120
           GSTFEKGGVNVSVVYGELTPGAVLAMKQEHKDLKLPESANGLPNSEGVKFFACGLSMVIH
Sbjct: 61  GSTFEKGGVNVSVVYGELTPGAVLAMKQEHKDLKLPESANGLPNSEGVKFFACGLSMVIH 120

Query: 121 PVNPLAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDKH 180
           PVNPLAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDKH
Sbjct: 121 PVNPLAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDKH 180

Query: 181 DTALYPRFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYLT 240
           DTALYPRFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYLT
Sbjct: 181 DTALYPRFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYLT 240

Query: 241 IMKRRKDLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHASW 300
           IMKRRKDLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHASW
Sbjct: 241 IMKRRKDLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHASW 300

Query: 301 VYNHHPEPGSEEAKLLEVTTKP 322
           VYNHHPEPGSEEAKLLEVTTKP
Sbjct: 301 VYNHHPEPGSEEAKLLEVTTKP 322

>YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen III
           oxidase, catalyzes the oxidative decarboxylation of
           coproporphyrinogen III to proto-porhyrinogen IX, the
           sixth step in heme biosynthetic pathway, repressed by
           oxygen [987 bp, 328 aa]
          Length = 328

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/323 (83%), Positives = 295/323 (91%), Gaps = 1/323 (0%)

Query: 1   MTAPQDPKHLPIRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQN 60
           M APQDP++LPIRQQMEALIRRKQ EIT+GLESIDTVKF ADTW RGNDGGGGTSMVIQ+
Sbjct: 1   MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQD 60

Query: 61  GSTFEKGGVNVSVVYGELTPGAVLAMKQEHKDLKLPES-ANGLPNSEGVKFFACGLSMVI 119
           G+TFEKGGVNVSVVYG+L+P AV AMK +HK+L+LPE    GLP ++GVKFFACGLSMVI
Sbjct: 61  GTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVI 120

Query: 120 HPVNPLAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDK 179
           HPVNP APTTHLNYRYFETWN DGTPQTWWFGGGADLTP YL+EED + FH+LHK ALDK
Sbjct: 121 HPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDK 180

Query: 180 HDTALYPRFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYL 239
           HDTALYPRFKKWCDEYFYI HR ETRGIGGIFFDDY+E+DPQEILK+ EDCFDAFLPSYL
Sbjct: 181 HDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYL 240

Query: 240 TIMKRRKDLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHAS 299
           TI+KRRKD+PY ++++ WQ IRRGRY EFNLIYDRGTQFGLRTPGSRVESILMSLP HAS
Sbjct: 241 TIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 300

Query: 300 WVYNHHPEPGSEEAKLLEVTTKP 322
           W+YNHHP PGS EAKLLEVTTKP
Sbjct: 301 WLYNHHPAPGSREAKLLEVTTKP 323

>Scas_569.3
          Length = 333

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/323 (83%), Positives = 293/323 (90%), Gaps = 1/323 (0%)

Query: 1   MTAPQDPKHLPIRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQN 60
           M APQD  HLPIRQQMEALIRRKQ EIT+GLES+DTVKF AD+W RGNDGGGGTSMVI N
Sbjct: 7   MPAPQDKTHLPIRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGTSMVIAN 66

Query: 61  GSTFEKGGVNVSVVYGELTPGAVLAMKQEHKDLKLP-ESANGLPNSEGVKFFACGLSMVI 119
           GSTFEKGGVNVSVVYG LTP AVLAMK +HK+LKLP +   GLP  +GVKFFACGLSMVI
Sbjct: 67  GSTFEKGGVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFACGLSMVI 126

Query: 120 HPVNPLAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDK 179
           HP NP APTTHLNYRYFETWNPDGTPQ+WWFGGGADLTPFYL+EEDA+HFH+LHK ALDK
Sbjct: 127 HPKNPHAPTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELHKKALDK 186

Query: 180 HDTALYPRFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYL 239
           HD  LYP++KKWCDEYFYIAHR ETRGIGGIFFDD++++DPQEILKICEDCFDAFLPSYL
Sbjct: 187 HDKTLYPKYKKWCDEYFYIAHRKETRGIGGIFFDDFDDRDPQEILKICEDCFDAFLPSYL 246

Query: 240 TIMKRRKDLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHAS 299
            I+++RKD+PY E++K WQLIRRGRY EFNLIYDRGTQFGLRTPGSRVESILMSLP HAS
Sbjct: 247 PIIEKRKDMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 306

Query: 300 WVYNHHPEPGSEEAKLLEVTTKP 322
           W+YNHHP PGS EAKLLEVTT P
Sbjct: 307 WLYNHHPAPGSREAKLLEVTTNP 329

>Sklu_2357.8 YDR044W, Contig c2357 11533-12558
          Length = 341

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/323 (77%), Positives = 284/323 (87%), Gaps = 1/323 (0%)

Query: 1   MTAPQDPKHLPIRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQN 60
           M APQDPKHLPIRQQME LI RKQKEIT+GLE++DTVKF AD+W RGNDGGGGTSMV+QN
Sbjct: 15  MPAPQDPKHLPIRQQMEQLILRKQKEITKGLETLDTVKFRADSWTRGNDGGGGTSMVLQN 74

Query: 61  GSTFEKGGVNVSVVYGELTPGAVLAMKQEHKDLKLP-ESANGLPNSEGVKFFACGLSMVI 119
           G+TFEKGGVN SVVYG+L+P A+ AM+Q+HK+L LP +   G PN++GV FFACGLSMVI
Sbjct: 75  GTTFEKGGVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNADGVNFFACGLSMVI 134

Query: 120 HPVNPLAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDK 179
           HP NP APTTHLNYRYFETWNPDG+PQ WWFGGGADLTP YL+EEDA  FHKLHK ALDK
Sbjct: 135 HPHNPHAPTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEEDAILFHKLHKEALDK 194

Query: 180 HDTALYPRFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYL 239
           HDT LYPRFKKWCDEYF+I HRGETRGIGGIFFDD +++DPQEILK+ EDCFDAFLPSYL
Sbjct: 195 HDTDLYPRFKKWCDEYFFINHRGETRGIGGIFFDDLDDRDPQEILKLVEDCFDAFLPSYL 254

Query: 240 TIMKRRKDLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHAS 299
           TI+ RRKD+PY E++K WQ +RRGRY EFNL+ DRGTQFGLRTPGSRVESILMSLP+ AS
Sbjct: 255 TIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTAS 314

Query: 300 WVYNHHPEPGSEEAKLLEVTTKP 322
           W+Y+HHP+ GS E +LLEV   P
Sbjct: 315 WLYDHHPDAGSREDQLLEVLKHP 337

>Kwal_27.10935
          Length = 344

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/323 (76%), Positives = 281/323 (86%), Gaps = 1/323 (0%)

Query: 1   MTAPQDPKHLPIRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQN 60
           M AP DP  +PIRQQME LIRRKQ+EIT+GLE++DTVKF  D+W RGNDGGGGTSMV+QN
Sbjct: 18  MPAPVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTSMVLQN 77

Query: 61  GSTFEKGGVNVSVVYGELTPGAVLAMKQEHKDLKLP-ESANGLPNSEGVKFFACGLSMVI 119
           G+TFEKGGVNVSVVYG+L+P A+ AMK +HK+LKLP +   GLPN++GVKFFACGLSMVI
Sbjct: 78  GTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACGLSMVI 137

Query: 120 HPVNPLAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDK 179
           HP NP APTTHLNYRYFETWNPDGTPQTWWFGGGADLTP YL+EEDA  FH+ HK ALDK
Sbjct: 138 HPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHKKALDK 197

Query: 180 HDTALYPRFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYL 239
           HDT+LYPR+KKWCDEYF+I HR ETRGIGGIFFDD +++DPQEIL + EDCFDAFLPSYL
Sbjct: 198 HDTSLYPRYKKWCDEYFFIKHRNETRGIGGIFFDDKDDRDPQEILSLIEDCFDAFLPSYL 257

Query: 240 TIMKRRKDLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHAS 299
            I+ RRKD+P+ E++K WQLIRRGRY EFNL+ DRGTQFGLRTPGSR ESILMSLP+ A 
Sbjct: 258 PIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSLPVTAC 317

Query: 300 WVYNHHPEPGSEEAKLLEVTTKP 322
           W Y+HHPEPGS E KLL+V   P
Sbjct: 318 WFYDHHPEPGSREEKLLKVLESP 340

>KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1
           Kluyveromyces lactis putative coproporphyrinogen
           oxidase, start by similarity
          Length = 375

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 232/315 (73%), Positives = 275/315 (87%), Gaps = 1/315 (0%)

Query: 9   HLPIRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQNGSTFEKGG 68
            +PIR++MEAL+RRKQ+EIT+GLE++DTVKF AD+W+RGN+GGGG SMV+QNG+TFEKGG
Sbjct: 57  QVPIRERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGGVSMVLQNGTTFEKGG 116

Query: 69  VNVSVVYGELTPGAVLAMKQEHKDLKLP-ESANGLPNSEGVKFFACGLSMVIHPVNPLAP 127
           VNVSVV+G L+P A+ AMK +HK+L LP + A G P++ GVKFFACGLSMVIHP+NP AP
Sbjct: 117 VNVSVVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFACGLSMVIHPINPHAP 176

Query: 128 TTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDKHDTALYPR 187
           TTHLNYRYFETWN DGTPQ WWFGGGADLTP YL+EEDA+ FH+LHK ALDK D ALYP+
Sbjct: 177 TTHLNYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQLHKDALDKTDVALYPK 236

Query: 188 FKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYLTIMKRRKD 247
           +KKWCDEYFYI HR ETRGIGGIFFDD +++DP EIL++ E+CFDAFLPSYL I+KRRKD
Sbjct: 237 YKKWCDEYFYIKHREETRGIGGIFFDDVDDRDPNEILQMVENCFDAFLPSYLEIIKRRKD 296

Query: 248 LPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHASWVYNHHPE 307
           +PY E+++ WQ IRRGRY EFNL+ DRGTQFGLRTPGSRVESILMSLP+ ASW+Y+HHPE
Sbjct: 297 MPYTEEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLYDHHPE 356

Query: 308 PGSEEAKLLEVTTKP 322
             S E KLL+V   P
Sbjct: 357 VDSREDKLLQVLKNP 371

>AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH]
           (768609..769583) [975 bp, 324 aa]
          Length = 324

 Score =  457 bits (1177), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 213/316 (67%), Positives = 257/316 (81%), Gaps = 4/316 (1%)

Query: 9   HLP-IRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQNGSTFEKG 67
           H P +R++ME L+RRKQ+EIT   E+IDTVKF AD+WER  +GGGGTS V+Q+G+TFEK 
Sbjct: 5   HTPHMRERMEELVRRKQREITAAFEAIDTVKFKADSWER-KEGGGGTSCVLQHGTTFEKA 63

Query: 68  GVNVSVVYGELTPGAVLAMKQEHKDLKLP-ESANGLPNSEGVKFFACGLSMVIHPVNPLA 126
           GVNVSVV+GEL+P AV AM+ EHK+L LP +   G P + GV+FFACG+S+V+HPVNP A
Sbjct: 64  GVNVSVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAA-GVRFFACGISLVMHPVNPHA 122

Query: 127 PTTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDKHDTALYP 186
           PT HLNYRYFETW+  G PQTWWFGGG+DLTP YL+EEDA  FH  HKAALD+ D ALYP
Sbjct: 123 PTVHLNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPALYP 182

Query: 187 RFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYLTIMKRRK 246
           RFKKWCDEYF+I HRGE+RGIGGIF+DD ++++P+ +L++ EDC DAF+P+Y TIM RRK
Sbjct: 183 RFKKWCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIMLRRK 242

Query: 247 DLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHASWVYNHHP 306
           D+PY   +  WQ IRRGRY EFNL+ DRGTQFGLRTPGSRVESILMSLP+ A W Y+HHP
Sbjct: 243 DMPYTAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEYDHHP 302

Query: 307 EPGSEEAKLLEVTTKP 322
             G+ EA LLEV   P
Sbjct: 303 AEGTREAALLEVLRHP 318

>KLLA0E11275g complement(993416..994573) similar to ca|CA5508|IPF745
           Candida albicans unknown function, start by similarity
          Length = 385

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 7/72 (9%)

Query: 176 ALDKHDTALYPRFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFL 235
           ALD+ DT++        +  +Y+     T     I F ++ + DP++ L +       FL
Sbjct: 256 ALDQFDTSI-------VNPLYYVTFTTATLTASFILFKNFEDSDPKDSLSLVCGFVIIFL 308

Query: 236 PSYLTIMKRRKD 247
             YL  + R+K+
Sbjct: 309 GVYLLNLSRKKN 320

>AEL178C [2328] [Homologous to ScYJL053W (PEP8) - SH]
           (303884..304807) [924 bp, 307 aa]
          Length = 307

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 37/87 (42%)

Query: 22  RKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQNGSTFEKGGVNVSVVYGELTPG 81
           RKQ EI     +  T+K     +E G    G  ++ ++ G   E  G+ VS+V    T  
Sbjct: 19  RKQVEIPSVSSTSKTLKDRYPLYEDGESVSGLVTLRVREGRKVEHLGIRVSLVGSVDTTK 78

Query: 82  AVLAMKQEHKDLKLPESANGLPNSEGV 108
           +    K+   D  L  SA+  P  E V
Sbjct: 79  SSSEAKKRAIDTFLSLSADICPPGELV 105

>Scas_681.12
          Length = 1176

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 63/146 (43%), Gaps = 24/146 (16%)

Query: 185 YPRFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQE------ILKICEDC--FDAFLP 236
           YP  K +CDE+ Y     +   +   F +D+    P+       +++I ++    D  LP
Sbjct: 535 YPDLKTYCDEFSYALFLEQK--LENTFIEDFQILWPKRQEENVFVVQINKNAPGLDTILP 592

Query: 237 SYLTIMKRRKDLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPL 296
            +L    +   +P+NE+Q          +  +  + + GTQ          + I++ L L
Sbjct: 593 PHLAQFVK---IPFNERQPLMLSSNDESHVWYTFVKEVGTQG---------KKIILLLEL 640

Query: 297 HASWVYNHHP-EPGSEEAKLLEVTTK 321
             SW     P + GSE+ KLL V+ +
Sbjct: 641 F-SWNKLSLPIQSGSEQFKLLPVSAQ 665

>Sklu_2020.3 YCR045C, Contig c2020 5388-6827 reverse complement
          Length = 479

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 13/50 (26%)

Query: 225 KICEDCFDAFLPSYLTIMKRRKDLPYNEKQKNWQLIRRGRYAEFNLIYDR 274
           K+ ED      P +L  + RR  LPY+E+         G Y EFN  YDR
Sbjct: 109 KVQEDA-----PRHLARLSRRGPLPYSEED--------GWYQEFNYYYDR 145

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.138    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,079,174
Number of extensions: 565155
Number of successful extensions: 1161
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1155
Number of HSP's successfully gapped: 11
Length of query: 322
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 220
Effective length of database: 13,065,073
Effective search space: 2874316060
Effective search space used: 2874316060
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)