Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K12056g23523211791e-166
YDR041W (RSM10)2031826476e-86
Sklu_2357.42041846355e-84
Kwal_27.105452022306215e-82
AGR035C2071785947e-78
Scas_569.12411875925e-77
KLLA0F18436g2071765713e-74
KLLA0E05225g175588680.98
Kwal_33.1303333261617.1
KLLA0F06941g63086608.9
AGL320C57645609.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K12056g
         (232 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces...   458   e-166
YDR041W (RSM10) [894] chr4 (539798..540409) Component of the mit...   253   6e-86
Sklu_2357.4 YDR041W, Contig c2357 5034-5648                           249   5e-84
Kwal_27.10545                                                         243   5e-82
AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH] (773294..7...   233   7e-78
Scas_569.1                                                            232   5e-77
KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomy...   224   3e-74
KLLA0E05225g 467253..472520 similar to sp|P25386 Saccharomyces c...    31   0.98 
Kwal_33.13033                                                          28   7.1  
KLLA0F06941g complement(665970..667862) similar to sp|P53734 Sac...    28   8.9  
AGL320C [3992] [Homologous to ScYBL039C (URA7) - SH; ScYJR103W (...    28   9.8  

>CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces
           cerevisiae YDR041w RSM10, hypothetical start
          Length = 235

 Score =  458 bits (1179), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 222/232 (95%), Positives = 222/232 (95%)

Query: 1   MLRTSVRSPLLYRCLSKRFQSTAVPLSSKAVQNDLELTPKQQXXXXXXXXXXIPPQLPVN 60
           MLRTSVRSPLLYRCLSKRFQSTAVPLSSKAVQNDLELTPKQQ          IPPQLPVN
Sbjct: 1   MLRTSVRSPLLYRCLSKRFQSTAVPLSSKAVQNDLELTPKQQTNSSTTTSTNIPPQLPVN 60

Query: 61  VEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGPKPLPTRR 120
           VEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGPKPLPTRR
Sbjct: 61  VEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGPKPLPTRR 120

Query: 121 ERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGVGLKCTTY 180
           ERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGVGLKCTTY
Sbjct: 121 ERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGVGLKCTTY 180

Query: 181 QRTTVDAKSGKISDAIEEINSTHNINPSLKENEEIGAKVVELLNTPTFKKYL 232
           QRTTVDAKSGKISDAIEEINSTHNINPSLKENEEIGAKVVELLNTPTFKKYL
Sbjct: 181 QRTTVDAKSGKISDAIEEINSTHNINPSLKENEEIGAKVVELLNTPTFKKYL 232

>YDR041W (RSM10) [894] chr4 (539798..540409) Component of the
           mitochondrial ribosomal small subunit [612 bp, 203 aa]
          Length = 203

 Score =  253 bits (647), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 118/182 (64%), Positives = 150/182 (82%), Gaps = 9/182 (4%)

Query: 58  PVNVEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGPKPLP 117
           PVNVEA+YYAPLK P+ +G LVAD+QLR+YDNENLDF+ DFILR GYYLG+P+TGPKPLP
Sbjct: 21  PVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSDFILRTGYYLGIPLTGPKPLP 80

Query: 118 TRRERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGVGLKC 177
           TRRERWTVI+SPFVHAKSKENFERHTHKRLIR WD+NPEV+QML+ YITK+S+AGVG+KC
Sbjct: 81  TRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEVLQMLIAYITKHSMAGVGMKC 140

Query: 178 TTYQRTTVDAKSGKISDAIEEINSTHNINP--SLKENEE-----IGAKVVELLNTPTFKK 230
             +QR+ +    G  ++ +E+  S  NI+   SL+ +++     +G KV+ELL++P FKK
Sbjct: 141 NFFQRSEISLDLGSDANGLEK--SLSNIDELYSLRNDDKAQTSAVGQKVLELLDSPDFKK 198

Query: 231 YL 232
           +L
Sbjct: 199 HL 200

>Sklu_2357.4 YDR041W, Contig c2357 5034-5648
          Length = 204

 Score =  249 bits (635), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 145/184 (78%), Gaps = 15/184 (8%)

Query: 54  PPQLPVNVEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGP 113
           P   P+NV A+Y+APLK P+THG LVADLQLR+YDNENLDFF DFILRAG+YLG+P+TGP
Sbjct: 31  PNAFPINVTAVYHAPLKLPITHGDLVADLQLRSYDNENLDFFSDFILRAGFYLGMPLTGP 90

Query: 114 KPLPTRRERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGV 173
           KPLPTRRERWTVIRSPF  AKSKENFERHTHKRLIRVWD+NPEV+++ + Y+TK+SI GV
Sbjct: 91  KPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPEVIELWLSYLTKHSIPGV 150

Query: 174 GLKCTTYQRTTVDAKSGKISDAIEEINSTHNINPSLKEN-----EEIGAKVVELLNTPTF 228
           G+KC  YQR  V     ++SD+I+      ++ P L+ N     E +G +VVELLN P F
Sbjct: 151 GIKCNVYQREGV-----RLSDSIDT-----SVLPELEGNTKTLDEAVGERVVELLNDPEF 200

Query: 229 KKYL 232
           KK++
Sbjct: 201 KKHI 204

>Kwal_27.10545
          Length = 202

 Score =  243 bits (621), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 159/230 (69%), Gaps = 30/230 (13%)

Query: 1   MLRTSVRSPLLYRCLSKRFQSTAVPLSSKAVQNDLELTPKQQXXXXXXXXXXIPPQLPVN 60
           M R S+ +PL +     RFQST+V   +  V                        +LP+N
Sbjct: 1   MFRPSLLAPLRHFA---RFQSTSVASEAPNVAK----------------------KLPIN 35

Query: 61  VEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGPKPLPTRR 120
           VEA+YYAPL+ P+THG L+ADLQLR+YD+ENLDFF DFILRAG+YLG+P+TGPKPLPTRR
Sbjct: 36  VEAVYYAPLRIPITHGDLIADLQLRSYDHENLDFFADFILRAGFYLGMPLTGPKPLPTRR 95

Query: 121 ERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGVGLKCTTY 180
           ERWTVIRSPF  AKSKENFERHTHKRLIRVWD+NPEVV++ + YI+K+SI GVG+KC  +
Sbjct: 96  ERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPEVVELWLSYISKHSIPGVGIKCNLF 155

Query: 181 QRTTVDAKSGKISDAIEEINSTHNINPSLKENEEIGAKVVELLNTPTFKK 230
           Q+  +     ++S  +E+ +   +   S   +E +G +V+ELLN+  FKK
Sbjct: 156 QKEGL-----QLSQNLEQNSLLQSPGKSNSLDEAVGERVLELLNSENFKK 200

>AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH]
           (773294..773917) [624 bp, 207 aa]
          Length = 207

 Score =  233 bits (594), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 108/178 (60%), Positives = 139/178 (78%), Gaps = 11/178 (6%)

Query: 57  LPVNVEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGPKPL 116
           LP +V ALY+ PLK PV H  LVADLQLRA+DN++LDFF +F LR GYYLG+PMTGPKPL
Sbjct: 39  LPKSVHALYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPKPL 98

Query: 117 PTRRERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGVGLK 176
           PTRRERWTVIR+PF HAKSKENFERHTHKRL+R+WD+NPEVV+M + YITK+S+AGVG+K
Sbjct: 99  PTRRERWTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVGMK 158

Query: 177 CTTYQRTTVDAKSGKISDAIEEINSTHNINPSLKE--NEEIGAKVVELLNTPTFKKYL 232
           C  +QR +V     +++  + ++     + P   +  +E +GAKV EL+ +P FKK+L
Sbjct: 159 CNMFQRESV-----QLAQELADV----PLAPGAPQTADEVVGAKVAELMQSPEFKKHL 207

>Scas_569.1
          Length = 241

 Score =  232 bits (592), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 102/187 (54%), Positives = 143/187 (76%), Gaps = 11/187 (5%)

Query: 55  PQLPVNVEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGPK 114
           P +P+N++A+Y+APL+NP+ +G LVA++QLR+YDNENLDF+ DF LR G+YLG+P+TGPK
Sbjct: 57  PIVPINIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPLTGPK 116

Query: 115 PLPTRRERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGVG 174
           PLPTRRERWTVI+SPFVHAKSKENFERHTHKR+I+VWD+N E+++M + YITK+++AGVG
Sbjct: 117 PLPTRRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYITKHAMAGVG 176

Query: 175 LKCTTYQRTTVDAKSGKISDAIEE---------INSTHNINPSLKENEEIGAKVVELLNT 225
           +KCT +QR+ + +K    +              +N   ++   L +N+ +  K+VELL  
Sbjct: 177 MKCTVFQRSPIASKEDATNGVSSSDSSSVLKSIVNQKDDV--KLTDNDLVNEKIVELLGR 234

Query: 226 PTFKKYL 232
             FKKY+
Sbjct: 235 EEFKKYI 241

>KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomyces
           cerevisiae YDR041w RSM10 component of the mitochondrial
           ribosomal small subunit, hypothetical start
          Length = 207

 Score =  224 bits (571), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 135/176 (76%), Gaps = 3/176 (1%)

Query: 57  LPVNVEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGPKPL 116
           +P  VEA+Y+APLK   TH  L+AD+QLR+YDNENLDFF  F+LRAGYYLG+PM GPKPL
Sbjct: 34  IPKCVEAVYHAPLKIEPTHRDLIADIQLRSYDNENLDFFSSFVLRAGYYLGIPMKGPKPL 93

Query: 117 PTRRERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGVGLK 176
           PT+R+RWTVIR+PFV AKSKENFERHTH RLIR++D N E+V+ L+ YI+K+ I+GVG+K
Sbjct: 94  PTKRKRWTVIRAPFVMAKSKENFERHTHARLIRLYDCNTELVETLLSYISKHGISGVGIK 153

Query: 177 CTTYQRTTVDAKSGKISDAIEEINSTHNINPSLKENEEIGAKVVELLNTPTFKKYL 232
           C  YQR  +D  S K    +E I+ +  +      ++ +GAKVVELLN P FKK+L
Sbjct: 154 CNLYQREPIDLDSKKDGPELENIDISSQLQ---GLDDVVGAKVVELLNNPEFKKHL 206

>KLLA0E05225g 467253..472520 similar to sp|P25386 Saccharomyces
            cerevisiae YDL058w USO1 intracellular protein transport
            protein, start by similarity
          Length = 1755

 Score = 30.8 bits (68), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 17/88 (19%)

Query: 132  HAKSKENFERHTHK----------RLIRVWDSNPEVVQMLVDYIT-----KNSIAGVGLK 176
            H K KENF+ HT K           +I +     E  + + +Y T     KNS+  + +K
Sbjct: 988  HQKEKENFDAHTQKLTSENNSKSESIISLQTKLDECERQIKEYKTTNEELKNSLHALNVK 1047

Query: 177  CTTYQRTTVDAK--SGKISDAIEEINST 202
            C   + +   AK  +    + IEE+N +
Sbjct: 1048 CIELESSLESAKQSTDNSDETIEELNDS 1075

>Kwal_33.13033
          Length = 332

 Score = 28.1 bits (61), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 115 PLPTRRERWTVIRSPFVHAKSKENFERHT------HKRLIRVWDSNPEVVQMLVDYITKN 168
           P  T R R +V RSPFV AKS  + E  T       K+ +  + SNP V   L++ ++K 
Sbjct: 32  PSCTSRRR-SVPRSPFVLAKSSGSAEEDTACDSDFAKKPVVHFKSNPAVSATLLEAVSKY 90

Query: 169 S 169
           S
Sbjct: 91  S 91

>KLLA0F06941g complement(665970..667862) similar to sp|P53734
           Saccharomyces cerevisiae YNR038w DBP6 RNA helicase
           required for 60S ribosomal subunit assembly, start by
           similarity
          Length = 630

 Score = 27.7 bits (60), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 21/86 (24%)

Query: 11  LYRCLSKRFQSTAVPLSSKAVQNDLELTPKQQXXXXXXXXXXIPPQLPVNVEALYYAPLK 70
           +Y CLSK  Q T++ +S   ++N L    K++                   + LY +P  
Sbjct: 276 VYDCLSKLSQGTSLNVSMSKLENSL----KEEHN-----------------KFLYNSPDI 314

Query: 71  NPVTHGHLVADLQLRAYDNENLDFFC 96
             +T G LV  LQ+ ++D + L F  
Sbjct: 315 LIITPGRLVDHLQMESFDLKTLKFLV 340

>AGL320C [3992] [Homologous to ScYBL039C (URA7) - SH; ScYJR103W
           (URA8) - SH] (105701..107431) [1731 bp, 576 aa]
          Length = 576

 Score = 27.7 bits (60), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 7/45 (15%)

Query: 123 WTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITK 167
           W++IR  +  A S E  ERH H+     ++ NP++VQ L ++  K
Sbjct: 470 WSIIRKLYGSASSVE--ERHRHR-----YEINPKMVQKLEEHGLK 507

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,660,899
Number of extensions: 318561
Number of successful extensions: 877
Number of sequences better than 10.0: 16
Number of HSP's gapped: 870
Number of HSP's successfully gapped: 16
Length of query: 232
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 134
Effective length of database: 13,203,545
Effective search space: 1769275030
Effective search space used: 1769275030
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)