Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K12034g1087107155430.0
YDR039C (ENA2)1091106540320.0
YDR038C (ENA5)1091106540300.0
YDR040C (ENA1)1091106540250.0
Kwal_23.31601100106537570.0
AGL097C1096107436730.0
KLLA0F20658g1082106436520.0
KLLA0E14630g1082106335980.0
Scas_569.0d46837316810.0
CAGL0J01870g9469308578e-99
AEL301W95710518561e-98
Kwal_14.149893910568542e-98
CAGL0I04312g95110498472e-97
YGL167C (PMR1)95010128445e-97
Scas_707.48*7418187526e-86
KLLA0A03157g9385365524e-58
Kwal_47.17547124010315476e-57
KLLA0A08910g12808545282e-54
CAGL0A00517g11229985252e-54
AFL011W12426224603e-46
YGL006W (PMC1)11734004541e-45
Scas_297.18002853376e-32
KLLA0A09031g8993532886e-26
YGL008C (PMA1)9183542887e-26
YPL036W (PMA2)9473542833e-25
CAGL0A00495g9023572781e-24
Scas_710.419043562781e-24
AGL085C9093252734e-24
Kwal_47.175228993522708e-24
Scas_688.19133162583e-22
YIL048W (NEO1)11516112092e-16
CAGL0M11308g14524132092e-16
KLLA0C08393g11486882073e-16
Scas_704.3811615802021e-15
Scas_665.3014393172012e-15
CAGL0L00715g11445531993e-15
Sklu_2193.111435751975e-15
ADR350W13116551967e-15
Kwal_26.920714697241959e-15
KLLA0B08217g14393151951e-14
ADL079C11666211886e-14
Scas_583.14*8753151876e-14
Kwal_23.578911336281823e-13
YOR291W14723231805e-13
YEL031W (SPF1)12152851681e-11
KLLA0E22352g12062171601e-10
AFR354C12102191591e-10
KLLA0A04015g13435291529e-10
AFR567W14493151502e-09
Scas_615.99421601492e-09
CAGL0G06270g13283011483e-09
YDR270W (CCC2)10041911412e-08
CAGL0L01419g12143061403e-08
YBR295W (PCA1)12162231393e-08
KLLA0D04092g11521491393e-08
CAGL0H04477g16263741385e-08
Kwal_26.707013154011304e-07
Kwal_23.355615973731295e-07
KLLA0F07447g9752071271e-06
AGL041C12331471261e-06
KLLA0E01650g15503261252e-06
Scas_89.12712401202e-06
AFL191W15752711242e-06
Kwal_55.215759891691205e-06
YAL026C (DRS2)13553121152e-05
CAGL0M08602g10121881133e-05
YMR162C (DNF3)16561021101e-04
ACR086C8102001053e-04
Scas_669.316381221054e-04
YGR208W (SER2)309158790.25
Scas_505.41025203810.26
Scas_227.0d30781790.26
Scas_576.81591115800.33
CAGL0G08085g1578432780.48
CAGL0L11814g1576439751.4
KLLA0C17644g1576108741.6
YDR093W (DNF2)1612115732.1
YER166W (DNF1)157177722.6
AGR120C1547215713.4
Scas_463.331546703.6
Scas_636.161554347695.7
ACL130C31621678.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K12034g
         (1071 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...  2139   0.0  
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...  1557   0.0  
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...  1556   0.0  
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...  1555   0.0  
Kwal_23.3160                                                         1451   0.0  
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....  1419   0.0  
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...  1411   0.0  
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...  1390   0.0  
Scas_569.0d                                                           652   0.0  
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...   334   8e-99
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...   334   1e-98
Kwal_14.1498                                                          333   2e-98
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...   330   2e-97
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...   329   5e-97
Scas_707.48*                                                          294   6e-86
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....   217   4e-58
Kwal_47.17547                                                         215   6e-57
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   207   2e-54
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   206   2e-54
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...   181   3e-46
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   179   1e-45
Scas_297.1                                                            134   6e-32
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...   115   6e-26
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...   115   7e-26
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...   113   3e-25
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...   111   1e-24
Scas_710.41                                                           111   1e-24
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...   109   4e-24
Kwal_47.17522                                                         108   8e-24
Scas_688.1                                                            103   3e-22
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    85   2e-16
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    85   2e-16
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    84   3e-16
Scas_704.38                                                            82   1e-15
Scas_665.30                                                            82   2e-15
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    81   3e-15
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          80   5e-15
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    80   7e-15
Kwal_26.9207                                                           80   9e-15
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    80   1e-14
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    77   6e-14
Scas_583.14*                                                           77   6e-14
Kwal_23.5789                                                           75   3e-13
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    74   5e-13
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    69   1e-11
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    66   1e-10
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    66   1e-10
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    63   9e-10
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    62   2e-09
Scas_615.9                                                             62   2e-09
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    62   3e-09
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    59   2e-08
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    59   3e-08
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    58   3e-08
KLLA0D04092g complement(344666..348124) some similarities with s...    58   3e-08
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    58   5e-08
Kwal_26.7070                                                           55   4e-07
Kwal_23.3556                                                           54   5e-07
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    54   1e-06
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    53   1e-06
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    53   2e-06
Scas_89.1                                                              51   2e-06
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    52   2e-06
Kwal_55.21575                                                          51   5e-06
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    49   2e-05
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    48   3e-05
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    47   1e-04
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    45   3e-04
Scas_669.3                                                             45   4e-04
YGR208W (SER2) [2158] chr7 (911886..912815) Phosphoserine phosph...    35   0.25 
Scas_505.4                                                             36   0.26 
Scas_227.0d                                                            35   0.26 
Scas_576.8                                                             35   0.33 
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    35   0.48 
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    33   1.4  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    33   1.6  
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    33   2.1  
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    32   2.6  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    32   3.4  
Scas_463.3                                                             32   3.6  
Scas_636.16                                                            31   5.7  
ACL130C [919] [Homologous to ScYGR208W (SER2) - SH] (124650..125...    30   8.1  

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 2139 bits (5543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1033/1071 (96%), Positives = 1033/1071 (96%)

Query: 1    MTNGQIDFEFSDYHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKA 60
            MTNGQIDFEFSDYHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKA
Sbjct: 1    MTNGQIDFEFSDYHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKA 60

Query: 61   MLIHQICNAXXXXXXXXXXXXFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRA 120
            MLIHQICNA            FAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRA
Sbjct: 61   MLIHQICNAMILVLIISMIISFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRA 120

Query: 121  LSSPNAHVIRNGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESL 180
            LSSPNAHVIRNGNSEVVDST              TIPADLRLVSQQNFETDEALLTGESL
Sbjct: 121  LSSPNAHVIRNGNSEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESL 180

Query: 181  PVSKDANEIFDDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNEL 240
            PVSKDANEIFDDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNEL
Sbjct: 181  PVSKDANEIFDDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNEL 240

Query: 241  ISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQK 300
            ISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQK
Sbjct: 241  ISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQK 300

Query: 301  FDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDI 360
            FDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDI
Sbjct: 301  FDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDI 360

Query: 361  CSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETED 420
            CSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETED
Sbjct: 361  CSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETED 420

Query: 421  VGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAI 480
            VGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAI
Sbjct: 421  VGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAI 480

Query: 481  QVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMS 540
            QVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMS
Sbjct: 481  QVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMS 540

Query: 541  SVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGL 600
            SVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPN            IKENIDSMSSEGL
Sbjct: 541  SVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIKENIDSMSSEGL 600

Query: 601  RVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQA 660
            RVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQA
Sbjct: 601  RVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQA 660

Query: 661  GINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPV 720
            GINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPV
Sbjct: 661  GINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPV 720

Query: 721  LPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDA 780
            LPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDA
Sbjct: 721  LPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDA 780

Query: 781  SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVF 840
            SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVF
Sbjct: 781  SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVF 840

Query: 841  PLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWMA 900
            PLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWMA
Sbjct: 841  PLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWMA 900

Query: 901  ASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVIDLR 960
            ASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVIDLR
Sbjct: 901  ASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVIDLR 960

Query: 961  RSFFRMHPDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPIGWE 1020
            RSFFRMHPDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPIGWE
Sbjct: 961  RSFFRMHPDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPIGWE 1020

Query: 1021 WGIAIAFSVCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPFDAY 1071
            WGIAIAFSVCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPFDAY
Sbjct: 1021 WGIAIAFSVCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPFDAY 1071

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 1557 bits (4032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/1065 (69%), Positives = 874/1065 (82%), Gaps = 4/1065 (0%)

Query: 9    EFSDYHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICN 68
            EF+ YH L+ E+    + T  ++G++ +E   RL   GEN+LGDD KIDYKAM++HQ+CN
Sbjct: 13   EFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCN 72

Query: 69   AXXXXXXXXXXXXFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHV 128
            A            FA+RDWITGGVI FVI +NV+IGL+QEYKA+KTMN+L+ LSSPNAHV
Sbjct: 73   AMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHV 132

Query: 129  IRNGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKDANE 188
            IRNG SE ++S               TIPADLRL+  +NF+TDE+LLTGESLPVSKDAN 
Sbjct: 133  IRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANL 192

Query: 189  IF--DDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPA 246
            +F  ++ET VGDR+NLAFSSS VVKGRA+GI IKT LN+EIGKIAKSL+G + LISRDP+
Sbjct: 193  VFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPS 252

Query: 247  KTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRG 306
            K+W QN WISTK+  GAFLGT  GTPLHRKLSKLAVLLFWIAV+FAI+VMASQKFDVD+ 
Sbjct: 253  KSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKR 312

Query: 307  VAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTG 366
            VAIYA+CVALSMIPSSLVVVLTITMSVGAAVM SRNVI+RKLDSLEALGAVNDICSDKTG
Sbjct: 313  VAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTG 372

Query: 367  TLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQN 426
            TLTQGKM+A+QIW+P+FGT+ +  S++P NP +G+++ IP  SPYEYSHNE  DVGI+QN
Sbjct: 373  TLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQN 432

Query: 427  FKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFATR 486
            FKD+   K +P +    LF KWLETA+LANIA+VF D  T  WKAHGDPTEIAIQVFAT+
Sbjct: 433  FKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATK 492

Query: 487  MDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESR 546
            MDLP + LTGE+     +E   S SLS+ +    +A+F H AEFPFDST+KRMSSVY + 
Sbjct: 493  MDLPHNALTGEKSTNQSNENDQS-SLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNN 551

Query: 547  DYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFA 606
              +TY IY KGAFES+++CC+ WYG+D              I++N+ S+S+EGLRVL FA
Sbjct: 552  HNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFA 611

Query: 607  NKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRM 666
            +KS+ K  VN+++L+ I   R  AE+ L FLGLIGIYDPPR ETAGAVKKFHQAGINV M
Sbjct: 612  SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHM 671

Query: 667  LTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIA 726
            LTGDF GTAKAIAQEVGILPTNLYHYS+E+VD MVMTG QFD LSE+E+D+LPVLPLVIA
Sbjct: 672  LTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIA 731

Query: 727  RCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLS 786
            RCSPQTKVRMIEALHRR+KFCAMTGDGVNDSPSLKMANVGIAMGINGSDV+K+ASDIVLS
Sbjct: 732  RCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791

Query: 787  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPLAPVE 846
            DDNFASILNAVEEGRRM+DNIQKFVLQLLAENVAQALYLI+GL F+D+ GKSVFPL+PVE
Sbjct: 792  DDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851

Query: 847  VLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWMAASCMAT 906
            VLWIIVVTSCFPAMGLGLEKAA DLMDRPP+DS+ GIFTWE+I+D F YG+ M  SCMA+
Sbjct: 852  VLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMAS 911

Query: 907  FVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVIDLRRSFFRM 966
            F   +YG + G LG +C+  Y+ SC DV+R+RSAAFATMTWCALILAWEV+D+RRSFFRM
Sbjct: 912  FTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFRM 971

Query: 967  HPDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPIGWEWGIAIA 1026
            HPDTD+PVK+FF+ I+GN+FLF+S++FGF S FPVVYIPVIN  VFLHKPIG EWG+AIA
Sbjct: 972  HPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIA 1031

Query: 1027 FSVCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPFDAY 1071
            F++ FWIG EL+K  KR Y++ + RA NPENDLE+     PF+AY
Sbjct: 1032 FTIAFWIGAELYKCGKRRYFKTQ-RAHNPENDLESNNKRDPFEAY 1075

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 1556 bits (4030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/1065 (69%), Positives = 873/1065 (81%), Gaps = 4/1065 (0%)

Query: 9    EFSDYHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICN 68
            EF+ YH L+ E+    + T  ++G++ +E   RL   GEN+LGDD KIDYKAM++HQ+CN
Sbjct: 13   EFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCN 72

Query: 69   AXXXXXXXXXXXXFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHV 128
            A            FA+RDWITGGVI FVI +NV+IGL+QEYKA+KTMN+L+ LSSPNAHV
Sbjct: 73   AMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHV 132

Query: 129  IRNGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKDANE 188
            IRNG SE ++S               TIPADLRL+  +NF+TDE+LLTGESLPVSKDAN 
Sbjct: 133  IRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANL 192

Query: 189  IF--DDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPA 246
            +F  ++ET VGDR+NLAFSSS VVKGRA+GI IKT LN+EIGKIAKSL+G + LISRDP+
Sbjct: 193  VFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPS 252

Query: 247  KTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRG 306
            K+W QN WISTK+  GAFLGT  GTPLHRKLSKLAVLLFWIAV+FAI+VMASQKFDVD+ 
Sbjct: 253  KSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKR 312

Query: 307  VAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTG 366
            VAIYA+CVALSMIPSSLVVVLTITMSVGAAVM SRNVI+RKLDSLEALGAVNDICSDKTG
Sbjct: 313  VAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTG 372

Query: 367  TLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQN 426
            TLTQGKM+A+QIW+P+FGT+ +  S++P NP +G+++ IP  SPYEYSHNE  DVGI+QN
Sbjct: 373  TLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQN 432

Query: 427  FKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFATR 486
            FKD+   K +P +    LF KWLETA+LANIA+VF D  T  WKAHGDPTEIAIQVFAT+
Sbjct: 433  FKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATK 492

Query: 487  MDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESR 546
            MDLP + LTGE+     +E   S SLS+ +    +A+F H AEFPFDST+KRMSSVY + 
Sbjct: 493  MDLPHNALTGEKSTNQSNENDQS-SLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNN 551

Query: 547  DYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFA 606
              +TY IY KGAFES+++CC+ WYG+D              I++N+ S+S+EGLRVL FA
Sbjct: 552  HNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFA 611

Query: 607  NKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRM 666
            +KS+ K  VN+++L+ I   R  AE+ L FLGLIGIYDPPR ETAGAVKKFHQAGINV M
Sbjct: 612  SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHM 671

Query: 667  LTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIA 726
            LTGDF GTAKAIAQEVGILPTNLYHYS+E+VD MVMTG QFD LSE+E+D+LPVLPLVIA
Sbjct: 672  LTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIA 731

Query: 727  RCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLS 786
            RCSPQTKVRMIEALHRR+KFCAMTGDGVNDSPSLKMANVGIAMGINGSDV+K+ASDIVLS
Sbjct: 732  RCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791

Query: 787  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPLAPVE 846
            DDNFASILNAVEEGRRM+DNIQKFVLQLLAENVAQALYLI+GL F+D+ GKSVFPL+PVE
Sbjct: 792  DDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851

Query: 847  VLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWMAASCMAT 906
            VLWIIVVTSCFPAMGLGLEKAA DLMDRPPNDS+ GIFTWE+I+D F YG+ M  SCMA+
Sbjct: 852  VLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIIDTFAYGIIMTGSCMAS 911

Query: 907  FVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVIDLRRSFFRM 966
            F   +YG + G LG +C+  Y+ SC DV+R+RSAAFATMTWCALILAWEV+D+RRSFFRM
Sbjct: 912  FTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFRM 971

Query: 967  HPDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPIGWEWGIAIA 1026
            HPDTD+PVK+FF+ I+GN+FLF+S++FGF S FPVVYIPVIN  VFLHKPIG EWG+AIA
Sbjct: 972  HPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIA 1031

Query: 1027 FSVCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPFDAY 1071
            F++ FWIG EL+K  KR Y++ + RA N ENDLE  +   PF+AY
Sbjct: 1032 FTIAFWIGAELYKCGKRRYFKTQ-RAHNSENDLERSSKHDPFEAY 1075

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 1555 bits (4025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 740/1065 (69%), Positives = 873/1065 (81%), Gaps = 4/1065 (0%)

Query: 9    EFSDYHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICN 68
            EF+ YH L+ E+    + T  ++G++ +EF  RL   GEN+LGDD KIDYKAM++HQ+CN
Sbjct: 13   EFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCN 72

Query: 69   AXXXXXXXXXXXXFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHV 128
            A            FA+ DWITGGVI FVI +NV+IGL+QEYKA+KTMN+L+ LSSPNAHV
Sbjct: 73   AMIMVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHV 132

Query: 129  IRNGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKDANE 188
            IRNG SE ++S               TIPADLRL+  +NF+TDE+LLTGESLPVSKDAN 
Sbjct: 133  IRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANL 192

Query: 189  IF--DDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPA 246
            +F  ++ET VGDR+NLAFSSS VVKGRA+GI IKT LN+EIGKIAKSL+G + LISRDP+
Sbjct: 193  VFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPS 252

Query: 247  KTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRG 306
            K+W QN WISTK+  GAFLGT  GTPLHRKLSKLAVLLFWIAV+FAI+VMASQKFDVD+ 
Sbjct: 253  KSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKR 312

Query: 307  VAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTG 366
            VAIYA+CVALSMIPSSLVVVLTITMSVGAAVM SRNVI+RKLDSLEALGAVNDICSDKTG
Sbjct: 313  VAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTG 372

Query: 367  TLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQN 426
            TLTQGKM+A+QIW+P+FGT+ +  S++P NP +G+++ IP  SPYEYSHNE  DVGI+QN
Sbjct: 373  TLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQN 432

Query: 427  FKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFATR 486
            FKD+   K +P +    LF KWLETA+LANIA+VF D  T  WKAHGDPTEIAIQVFAT+
Sbjct: 433  FKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATK 492

Query: 487  MDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESR 546
            MDLP + LTGE+     +E   S SLS+ +    +A+F H AEFPFDST+KRMSSVY + 
Sbjct: 493  MDLPHNALTGEKSTNQSNENDQS-SLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNN 551

Query: 547  DYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFA 606
              +TY IY KGAFES+++CC+ WYG+D              I++N+ S+S+EGLRVL FA
Sbjct: 552  HNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFA 611

Query: 607  NKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRM 666
            +KS+ K  VN+++L+ I   R  AE+ L FLGLIGIYDPPR ETAGAVKKFHQAGINV M
Sbjct: 612  SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHM 671

Query: 667  LTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIA 726
            LTGDF GTAKAIAQEVGILPTNLYHYS+E+VD MVMTG QFD LSE+E+D+LPVLPLVIA
Sbjct: 672  LTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIA 731

Query: 727  RCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLS 786
            RCSPQTKVRMIEALHRR+KFC MTGDGVNDSPSLKMANVGIAMGINGSDV+K+ASDIVLS
Sbjct: 732  RCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791

Query: 787  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPLAPVE 846
            DDNFASILNAVEEGRRM+DNIQKFVLQLLAENVAQALYLI+GL F+D+ GKSVFPL+PVE
Sbjct: 792  DDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851

Query: 847  VLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWMAASCMAT 906
            VLWIIVVTSCFPAMGLGLEKAA DLMDRPP+DS+ GIFTWE+I+D F YG+ M  SCMA+
Sbjct: 852  VLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMAS 911

Query: 907  FVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVIDLRRSFFRM 966
            F   +YG + G LG +C+  Y+ SC DV+R+RSAAFATMTWCALILAWEV+D+RRSFFRM
Sbjct: 912  FTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFRM 971

Query: 967  HPDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPIGWEWGIAIA 1026
            HPDTD+PVK+FF+ I+GN+FLF+S++FGF S FPVVYIPVIN  VFLHKPIG EWG+AIA
Sbjct: 972  HPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIA 1031

Query: 1027 FSVCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPFDAY 1071
            F++ FWIG EL+K  KR Y++ + RA NPENDLE+     PF+AY
Sbjct: 1032 FTIAFWIGAELYKCGKRRYFKTQ-RAHNPENDLESNNKRDPFEAY 1075

>Kwal_23.3160
          Length = 1100

 Score = 1451 bits (3757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/1065 (65%), Positives = 848/1065 (79%), Gaps = 11/1065 (1%)

Query: 13   YHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAXXX 72
            +H +S  DT   L TD   G+   E  AR++Q GENSLGDD+KID+K++L+HQICNA   
Sbjct: 23   FHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMIL 82

Query: 73   XXXXXXXXXFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNG 132
                      AIRDWI+GGVI FV+ INV IG  QEYKASKTMN+L++LS+P+AHVIR+G
Sbjct: 83   VLFISMVITLAIRDWISGGVIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIRDG 142

Query: 133  NSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKDANEIF-- 190
            N E + S               T+PADLRL+   NFETDEALLTGESLP++K+A++++  
Sbjct: 143  NDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYPA 202

Query: 191  DDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWY 250
             ++TPVGDR+NLAF+SSTV KGRA GI +KTGLNTEIGKIA+SL+G N LIS+D  KT++
Sbjct: 203  TEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFW 262

Query: 251  QNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIY 310
             NA I+   T+G+FLGTT GTPLHRKLSKLAVLLF+IAVVFAIVVMA+QKF V++ VAIY
Sbjct: 263  ANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFVVNKEVAIY 322

Query: 311  AVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQ 370
            A+CVA+SMIPSSLVVVLTITMSVGA +MA+RNV++RKLDSLEALGAVND+CSDKTGTLTQ
Sbjct: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQ 382

Query: 371  GKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQNFKDK 430
            GKMI KQ WVP FGT+ V  S+ P +P  G I  IP  SP++Y H+ TEDVGI+ +FK+K
Sbjct: 383  GKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKNK 442

Query: 431  YEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFATRMDLP 490
            +    +P     +LF  WL+TA+LANIA V+ DPET+EWKAHGDPTEIAIQVFA ++D+P
Sbjct: 443  FYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMP 502

Query: 491  RHVLTGE-RDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESRDY- 548
            R+ LT E + D + DE     +L EK  ++    ++H AEFPFDS+IKRMS+VY S D  
Sbjct: 503  RNALTAEDKSDSESDE---DAALGEK-TSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDED 558

Query: 549  KTYEIYTKGAFESVLNCCTHWY--GRDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFA 606
              + ++TKGAFE VL+CCT W   G + +            + +N++++SSEGLRVLAFA
Sbjct: 559  NAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFA 618

Query: 607  NKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRM 666
             KS+ +S   +   + + K RD+ E+ L F GL+GIYDPPR+ETAGAVK+FH+AGINV M
Sbjct: 619  TKSFTESQALKVS-EDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHM 677

Query: 667  LTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIA 726
            LTGDFPGTAKAIAQEVGILP NLYHY KEVVD MVMT  QFD L+++EIDNL +LPLVIA
Sbjct: 678  LTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIA 737

Query: 727  RCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLS 786
            RC+PQTKVRMI+ALHRREKFCAMTGDGVNDSPSLK ANVGIAMGINGSDVAKDASDIVLS
Sbjct: 738  RCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLS 797

Query: 787  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPLAPVE 846
            DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYL++GL F D++  SVFPL+PVE
Sbjct: 798  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPVE 857

Query: 847  VLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWMAASCMAT 906
            VLWIIVVTSCFPAMGLGLEK+A D+M++ P DSKAGIFTWEII+DM +YG WMAA C+A 
Sbjct: 858  VLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAACCLAC 917

Query: 907  FVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVIDLRRSFFRM 966
            F+T+IYG+ +G LG NCN  YSESC +V+  R+A FA+MTWCALILAWEVID+RRSFF+M
Sbjct: 918  FITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRSFFKM 977

Query: 967  HPDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPIGWEWGIAIA 1026
             P+TD P  Q+ KDI+ N+FLF+SV+FGF SVFPVVYIPVIN DVF HK IG+EWG+A+A
Sbjct: 978  QPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWGLAVA 1037

Query: 1027 FSVCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPFDAY 1071
            +++ FWIG EL+KYFKR Y++NK RA NPE DLE++    PF+ Y
Sbjct: 1038 YTIAFWIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPFEKY 1082

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 1419 bits (3673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/1074 (64%), Positives = 831/1074 (77%), Gaps = 14/1074 (1%)

Query: 1    MTNGQIDFEFSDYHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKA 60
            ++ G   +E +D+HAL   +    L TD  +G++ EE +ARL   G+N+LG++  I+ +A
Sbjct: 9    ISGGTDVYERTDFHALPAHEVARLLGTDLRRGLTAEEARARLEVVGDNTLGEEEGINVRA 68

Query: 61   MLIHQICNAXXXXXXXXXXXXFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRA 120
            +L+ Q+CNA             AI+DWI+GGVI FV+ +NV IG  QEY A KTMN+L+ 
Sbjct: 69   ILLKQMCNAMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKD 128

Query: 121  LSSPNAHVIRNGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESL 180
            LS+P+A VIRNG   V+ S               T+PADLRLV   N ETDEALLTGE+L
Sbjct: 129  LSTPSARVIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEAL 188

Query: 181  PVSKDANEIFDDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNEL 240
            PV+KD   +F+ +TPVGDR+NLAF+SSTV KGRA GI ++TGL +EIGKIA+SL+G   L
Sbjct: 189  PVAKDPAAVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSL 248

Query: 241  ISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQK 300
            ISRD  K+  QN  ++ K +VG+FLGT  GTPLHRKL+KLA++LF IAV+FA++VMA+QK
Sbjct: 249  ISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFALIVMATQK 308

Query: 301  FDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDI 360
            F V+R VAIYA+CVALSMIPSSLVVVLTITMS GA VM++RNVI+R+LDSLEALGAVNDI
Sbjct: 309  FIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDI 368

Query: 361  CSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETED 420
            CSDKTGTLTQGKMI KQ+WVP+FGT+ V  SN P +P  GD++ IP  SP+EY H+E ED
Sbjct: 369  CSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEED 428

Query: 421  VGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAI 480
            VGI+ NFK +++  S+P     + F+ WL TA+LANIA+VF D ++KEW+AHGDPTEIAI
Sbjct: 429  VGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAI 488

Query: 481  QVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMS 540
            QVFATRMD P H LT E+D+ D D      S  + DA      + HAAEFPFDS+IKRMS
Sbjct: 489  QVFATRMDHPHHALTTEQDEEDSD------SSQQNDAARI---YEHAAEFPFDSSIKRMS 539

Query: 541  SVY-ESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXX--XXXIKENIDSMSS 597
            +VY   RD  T  ++TKGAFE VL CCT W   DP               I++N+D++S+
Sbjct: 540  AVYINLRDKNTRHVFTKGAFERVLKCCTRW-KLDPGTGVTHPLTEDDLEIIQKNVDTLSN 598

Query: 598  EGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKF 657
            EGLRVLAFA K+ P  +  E   +++ K+RD+ E+ L F GL+GIYDPPR ETAGAVKK 
Sbjct: 599  EGLRVLAFATKTIPAEEA-ESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKC 657

Query: 658  HQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDN 717
            H+AGINV MLTGDFPGTAKAIAQEVGILP NLYHY KEVVDIMVMT  QFD+L+++E+D 
Sbjct: 658  HRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQ 717

Query: 718  LPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVA 777
            LPVLPLVIARC+PQTKVRMI+ALHRREKFCAMTGDGVNDSPSLK ANVGIAMGINGSDVA
Sbjct: 718  LPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVA 777

Query: 778  KDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGK 837
            KDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLA NVAQA+YL++GL F D++  
Sbjct: 778  KDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAANVAQAIYLMLGLTFLDEDKL 837

Query: 838  SVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGV 897
            SVFPL+PVEVLWIIVVTSC PAMGLGLEKAA D+M++PPNDSKAGIFTWE+IVDM VYG+
Sbjct: 838  SVFPLSPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGL 897

Query: 898  WMAASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVI 957
             MA  C+  FV+IIY   HGNLG NCN +YS+SC  VF  R+A FATMTWCALILAWEVI
Sbjct: 898  VMAVCCLGCFVSIIYKDGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVI 957

Query: 958  DLRRSFFRMHPDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPI 1017
            D+RRSFF M P+TD P  Q FKDI+ NKFLF+SV+FGF SVFPVVYIPVINT VFLH  I
Sbjct: 958  DMRRSFFAMKPETDTPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGI 1017

Query: 1018 GWEWGIAIAFSVCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPFDAY 1071
            G+EWGIA AFS+ FW+  E  K+ KR YYRNK RAINPE+DLEN+    PF+ Y
Sbjct: 1018 GYEWGIAFAFSLVFWLVAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPFEKY 1071

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 1411 bits (3652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1064 (65%), Positives = 826/1064 (77%), Gaps = 18/1064 (1%)

Query: 11   SDYHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAX 70
            +D+H L+       L T  ++G++  +   RL+  GEN+LGDD KI+ K +LI QICNA 
Sbjct: 17   NDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAM 76

Query: 71   XXXXXXXXXXXFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIR 130
                        AI+DWI+GGV+ FV+GINV+IG  QEY ASKTMN+L++LS+P+AHVIR
Sbjct: 77   IMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIR 136

Query: 131  NGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKDANEIF 190
            +GN   + S               T+PADLRL+   N ETDEALLTGESLPV+K  +E++
Sbjct: 137  DGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAKSHSEVY 196

Query: 191  DDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWY 250
            + +TPVGDR+NLAF++STV KGRA GI IKT LNTEIGKIAKSL+     IS+D  K++ 
Sbjct: 197  EKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFG 256

Query: 251  QNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIY 310
            QN WI+ K T+G+FLGT  GTPLHRKLS+LA+LLF +AV+FAIVVM +QK+ V++ VAIY
Sbjct: 257  QNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKYRVNKQVAIY 316

Query: 311  AVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQ 370
            A+CVA+SMIPSSLVVVLTITMS GA VMA+RNVI+RKLDSLEALGAVNDICSDKTGTLTQ
Sbjct: 317  AICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQ 376

Query: 371  GKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQNFKDK 430
            GKMIAKQ+W+P+FGT+ V  SNEP NP  G+I+ IP  SPY+Y H++ EDVGI+ +FK K
Sbjct: 377  GKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSK 436

Query: 431  YEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFATRMDLP 490
            Y    + G     LFD+WL TA+LANIA+VF D ET++WKAHGDPTEIAIQVFATRMDLP
Sbjct: 437  YLAGEL-GPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLP 495

Query: 491  RHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESRD--- 547
            RHVLTGE  D             EKDA A N+ F H AEFPFDS++KRMS++Y++ +   
Sbjct: 496  RHVLTGEDKD------------DEKDARA-NSSFEHVAEFPFDSSVKRMSAIYKNTEDPA 542

Query: 548  YKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFAN 607
               YE++TKGAFE VL CC  WY                 I++N+D++SSEGLRVLAFA 
Sbjct: 543  TPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAK 602

Query: 608  KSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRML 667
            KS+ +S+ N  K  K+LKERD+ E  LTFLGLIGIYDPPR+E+  AVKK HQAGINV ML
Sbjct: 603  KSFNESEFNANK-DKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHML 661

Query: 668  TGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIAR 727
            TGDFPGTAK+IAQEVGILP NLYHY KEVV+ MVM    FD LS+ EID+L VLPLVIAR
Sbjct: 662  TGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIAR 721

Query: 728  CSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSD 787
            C+PQTKVRMIEALHRR KFCAMTGDGVNDSPSLK+ANVGIAMGINGSDVAKDASDIVLSD
Sbjct: 722  CAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSD 781

Query: 788  DNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPLAPVEV 847
            DNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYL+VGL F DKEG SVFPL+PVEV
Sbjct: 782  DNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEV 841

Query: 848  LWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWMAASCMATF 907
            LWIIVVTSCFPAMGLGLEKA+ D+M++PP D+KA +FTWE+I+DM VYGV MAA CMA F
Sbjct: 842  LWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMACF 901

Query: 908  VTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVIDLRRSFFRMH 967
            VT++YG   GNLG +CN    E+CH VFR R+AAFATMTWCALILAWEV+D+RRSFF M+
Sbjct: 902  VTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMMN 961

Query: 968  PDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPIGWEWGIAIAF 1027
            P+++ P  Q FKDI+ N+FLF+S+V GF SVFPVVYIPVIN  VFLH  I +EWG AI F
Sbjct: 962  PESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIGF 1021

Query: 1028 SVCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPFDAY 1071
            S  FW G EL+KY KR Y+  K R  NPENDLE +A   PF+ Y
Sbjct: 1022 SFAFWAGVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPFEQY 1065

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 1390 bits (3598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/1063 (64%), Positives = 820/1063 (77%), Gaps = 18/1063 (1%)

Query: 12   DYHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAXX 71
            D+H+LSV      L T  ++G++  +   RL   GEN+LGDD+KI+ K + I QICNA  
Sbjct: 18   DFHSLSVSRVETLLSTHINQGLNTTQIAERLGLIGENTLGDDSKINIKGIFISQICNAMI 77

Query: 72   XXXXXXXXXXFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRN 131
                      FAI+DWI+GGVI FV+ INV+IG  QEY ASKTMN+L++LS+P+AHVIR 
Sbjct: 78   MVLIISMVISFAIKDWISGGVIAFVVFINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRA 137

Query: 132  GNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKDANEIFD 191
            GN   ++S               T+PADLRL    N ETDEALLTGESLPV+K   E+++
Sbjct: 138  GNDLTIESKELVPGDICIIRVGDTVPADLRLFEAINLETDEALLTGESLPVAKSHGEVYE 197

Query: 192  DETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQ 251
             +TPVGDR+NLAF++STV KGRA GI IKT LNTEIGKIAKSL+    LISRD +K++ +
Sbjct: 198  QDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSEASLISRDKSKSFGR 257

Query: 252  NAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYA 311
            N WI+ + ++G FLGT+ GTPLHRKLS+LA+LLF +AV+FAIVVM +QKF V++ VAIYA
Sbjct: 258  NLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKFKVNKQVAIYA 317

Query: 312  VCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQG 371
            +CVALSMIPSSLVVVLTITMS GA VMA+R+VIIRKLDSLEALGAVNDICSDKTGTLTQG
Sbjct: 318  ICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEALGAVNDICSDKTGTLTQG 377

Query: 372  KMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQNFKDKY 431
            KMIAKQ+W+P+FGT+ V  SNEP NP  G+I  IP  SPY+Y H++ EDVG++ +FK KY
Sbjct: 378  KMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEEDVGMITDFKSKY 437

Query: 432  EGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFATRMDLPR 491
                + G     LF +WL TA+LANIA+VF DPET++WKAHGDPTEIAIQVFATRMDLPR
Sbjct: 438  YADEL-GPLNVSLFTQWLYTATLANIATVFRDPETQDWKAHGDPTEIAIQVFATRMDLPR 496

Query: 492  HVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVY---ESRDY 548
             VLTGE +D DE  I + ++            F H AE+PFDS++KRMS++Y   E    
Sbjct: 497  RVLTGEDND-DEKNIHNDIT------------FEHVAEYPFDSSVKRMSAIYKNVEEPKA 543

Query: 549  KTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFANK 608
              YE++TKGAFE VL CC  WY                 +++N+D++SSEGLRVLAFA K
Sbjct: 544  PIYEVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKK 603

Query: 609  SYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLT 668
            ++ +S     K  K+LKERD+ E  LTFLGL+GIYDPPR E+  AVKK H AGINV MLT
Sbjct: 604  TFNESQFTINK-DKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLT 662

Query: 669  GDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIARC 728
            GDFPGTAK+IAQEVGILP NLYHY KEVV+ MVMT   FD LS+ EID LPVLPLVIARC
Sbjct: 663  GDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMTATDFDALSDKEIDELPVLPLVIARC 722

Query: 729  SPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDD 788
            +PQTKVRMIEALHRR +FCAMTGDGVNDSPSLK+ANVGIAMGINGSDVAKDASDIVLSDD
Sbjct: 723  APQTKVRMIEALHRRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDD 782

Query: 789  NFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPLAPVEVL 848
            NFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYL+VGL F D+EG SVFPL+PVEVL
Sbjct: 783  NFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGFSVFPLSPVEVL 842

Query: 849  WIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWMAASCMATFV 908
            W+IVVTSCFPAMGLGLEKA  D+M++PP D+KA IFTWE+IVDM VYGV +AA CMA FV
Sbjct: 843  WVIVVTSCFPAMGLGLEKANVDVMEKPPKDAKAVIFTWEVIVDMLVYGVIIAACCMACFV 902

Query: 909  TIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVIDLRRSFFRMHP 968
            T+IYG   GNLG+ CN  + +SC  VF+ R+AAFATMTWCALILAWEV+D+RRSFF M+P
Sbjct: 903  TVIYGTGDGNLGRGCNNGFDDSCRLVFKGRAAAFATMTWCALILAWEVVDMRRSFFMMNP 962

Query: 969  DTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPIGWEWGIAIAFS 1028
            +T+ P  Q FKD++ N+FLF+S+V GF SVFPVVYIPVIN  VFLH  I +EWG ++ FS
Sbjct: 963  ETETPYTQVFKDVWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYDITYEWGFSLGFS 1022

Query: 1029 VCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPFDAY 1071
            + FW G EL+KY KR Y+ +K R  NPE+DLE ++   PF+ Y
Sbjct: 1023 LAFWAGAELYKYGKRRYFGSKDRVENPESDLEKRSVQDPFEQY 1065

>Scas_569.0d
          Length = 468

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/373 (80%), Positives = 336/373 (90%), Gaps = 1/373 (0%)

Query: 700  MVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPS 759
            MVMTG QFD L+ ++IDNLPVLPLVIARCSPQTKVRMIEALHRR+KFCAMTGDGVNDSPS
Sbjct: 80   MVMTGSQFDELTPEQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDSPS 139

Query: 760  LKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENV 819
            LKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNA+EEGRRMSDNIQKFVLQLLAENV
Sbjct: 140  LKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGRRMSDNIQKFVLQLLAENV 199

Query: 820  AQALYLIVGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDS 879
            AQALYLI GLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAA DLMDRPPNDS
Sbjct: 200  AQALYLICGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDS 259

Query: 880  KAGIFTWEIIVDMFVYGVWMAASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARS 939
            K+GIFTWEIIVDMFVYG+ MA  CM +F T++YG+D GNLG NCN+ Y+E+CHDVFR RS
Sbjct: 260  KSGIFTWEIIVDMFVYGIIMAGCCMGSFTTVVYGKDGGNLGFNCNKSYNETCHDVFRGRS 319

Query: 940  AAFATMTWCALILAWEVIDLRRSFFRMHPDTDAPVKQFFKDIYGNKFLFYSVVFGFASVF 999
            +AFA MTWCALILAWEV+DLRRSFFRM P+TD PV++FF+DI+ NKFLF+S++FGF S F
Sbjct: 320  SAFAVMTWCALILAWEVVDLRRSFFRMQPETDTPVREFFRDIWSNKFLFWSLIFGFVSTF 379

Query: 1000 PVVYIPVINTDVFLHKPIGWEWGIAIAFSVCFWIGCELHKYFKRIYYRN-KSRAINPEND 1058
            PV+YIPVIN  VFLHK I +EWGIA AF++ FW+GCEL+K+ KR Y+R   ++A NPE+D
Sbjct: 380  PVIYIPVINDKVFLHKGITFEWGIAFAFTIIFWMGCELYKFMKRRYFRRMMNKAQNPESD 439

Query: 1059 LENKAGTHPFDAY 1071
            LE +    PF+AY
Sbjct: 440  LEKRTRRDPFEAY 452

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 5  QIDFEFSDYHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAK 55
          QID+E++++H L  ++T   L TD+SKG+  E+FQAR +  GENSLGDD K
Sbjct: 23 QIDYEYNEFHTLQSQETANLLQTDASKGLDDEKFQARKSAVGENSLGDDMK 73

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score =  334 bits (857), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 266/930 (28%), Positives = 432/930 (46%), Gaps = 149/930 (16%)

Query: 13  YHALSVEDTCARLVTDSSKGISPEEFQARLAQC-GENSLG-DDAKIDYKAMLIHQICNAX 70
           +  LSV +T   L TD   G+S EE   +  +  G N    DD +   K  L+  + +  
Sbjct: 48  FCTLSVGETVENLETDVDNGLSSEEEVVKRREIHGRNDFEEDDDESMIKKFLMSFVEDRL 107

Query: 71  XXXXXXXXXXXFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIR 130
                      FAI        I   I I V +G IQEY++ K++ AL  L     H+IR
Sbjct: 108 ILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGFIQEYRSEKSLEALNKLVPTKCHLIR 167

Query: 131 NGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKDANEIF 190
            G      ++               IPAD+R++   +   DE+ LTGE+ P+ KDA  I 
Sbjct: 168 YGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLSIDESNLTGETEPLHKDAQTID 227

Query: 191 DDE-----TPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDP 245
            +E      PV +R  +A+  + V +G  +GI I TG NT  G I + +           
Sbjct: 228 PEEYDNRNVPVSERSCIAYMGTLVKEGHGKGIVIGTGTNTSYGAIFEMV----------- 276

Query: 246 AKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDR 305
                 N+    K            TPL   + +L   L +I+     ++        + 
Sbjct: 277 ------NSIEKPK------------TPLQETMDRLGTELSYISFFIIAIISIVGIIRGNS 318

Query: 306 GVAIYAVCVALSM--IPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSD 363
            + ++ V V+L++  IP  L +++T+T+++G   M  +N I+R+L S+E LG+VN IC+D
Sbjct: 319 LLMMFQVSVSLAVAAIPEGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTD 378

Query: 364 KTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGI 423
           KTGTLT   M      V K   L   G+ E              +SP E S  +  D   
Sbjct: 379 KTGTLTTNHM-----TVSKLFCLDSSGTYENA------------ISPEEDSEFDVHD--- 418

Query: 424 MQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAH----GDPTEIA 479
                                 +   ET ++ANI +       K  + H    G+PT++A
Sbjct: 419 ----------------------NDVKETLTIANICN-----NAKYSEEHNLYIGNPTDVA 451

Query: 480 IQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRM 539
           +    T+  +P        D  D  E M  +S + K                     ++ 
Sbjct: 452 LIEVLTKFGIP--------DQRDSHEKMEELSFNSK---------------------RKY 482

Query: 540 SSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEG 599
            ++  S++   + +Y KGAFE +L+  +++  +               + E   S +S+G
Sbjct: 483 MAIKSSKESGEHVLYIKGAFERILDKSSYYLDK-AGEVREFDEHSKVMVLEAAHSCASDG 541

Query: 600 LRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQ 659
           LR +A A K     +V        + E D    GLTF GL G+ DPPR     +++K H+
Sbjct: 542 LRTIACAFKPTDSDNV--------ISEDDI--NGLTFTGLFGLADPPRPNVKASIEKLHR 591

Query: 660 AGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLP 719
            G+++ M+TGD   TA +IA+++G+        S +  +  VMTG +   L+EDE+  + 
Sbjct: 592 GGVHIIMITGDSVNTAVSIAEKIGL--------SVQDRESSVMTGDKVSELTEDELSKVI 643

Query: 720 VLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKD 779
               + AR +P+ K+ +++AL +R    AMTGDGVND+P+LK+A++GIAMGI+G+DVAK+
Sbjct: 644 DKVNIFARATPENKLNIVKALRKRGDIVAMTGDGVNDAPALKLADIGIAMGISGTDVAKE 703

Query: 780 ASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQ-ALYLIVGLAFQDKEGKS 838
            SD++L+DD+F+SIL A+EEG+ + +NI+ F+   L+ +VA  +L  I  +A      K 
Sbjct: 704 VSDMILTDDDFSSILTAIEEGKGIFNNIRNFLTFQLSISVATLSLIAITTIA------KL 757

Query: 839 VFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVW 898
             PL P+++LWI ++    PA  LG+E    D+MD+PP   +  I    I++ +    + 
Sbjct: 758 PAPLNPMQILWINIIMDGPPAQSLGVEPVDSDVMDKPPRSREERILNMNILLRLLYLAIC 817

Query: 899 MAASCMATFVTIIYGRDHGNLGQNCNRDYS 928
           +    + TF   + G D     Q  ++D +
Sbjct: 818 I---LVGTFYIFLKGMDENQ--QTTSKDIT 842

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score =  334 bits (856), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 285/1051 (27%), Positives = 477/1051 (45%), Gaps = 168/1051 (15%)

Query: 12   DYHALSVEDTCARLVTDSSKGI-SPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAX 70
            +Y  ++V++T  +L TDS+KG+   ++ +A   + G N    +  +D +  +  +  +  
Sbjct: 43   EYCTMTVDETLRQLNTDSAKGLCDQQQVRASEQEWGTN----EVTVDGEDPVWKRFMSTF 98

Query: 71   XXXXXXXXXXXFAIRDWITGGV-----ICFVIGINVIIGLIQEYKASKTMNALRALSSPN 125
                        A+  ++ G +     I   + I V +G +QEY++ K++ AL  L   +
Sbjct: 99   VEDPLILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPAS 158

Query: 126  AHVIRNGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKD 185
             H+IR G    V ++               IPAD+R++   +   DE+ LTGE+ PV K 
Sbjct: 159  CHLIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKS 218

Query: 186  ANEI----FDDE----TPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGG 237
               +    + D      P+G+R ++A+  + V +G  +GI + TG +T  G + + +   
Sbjct: 219  CTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMN-- 276

Query: 238  NELISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMA 297
                S +  KT  Q A  +                L R LS +  +L  I  +  ++   
Sbjct: 277  ----SIEKPKTPLQMAMDT----------------LRRDLSYVRFVLSGIIFLLGVIQGR 316

Query: 298  S--QKFDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALG 355
            S  + F +       +V +A++ IP  L +++T+T+++G   MA+R  I+R+L S+E LG
Sbjct: 317  SWLEMFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLG 369

Query: 356  AVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSH 415
            +VN ICSDKTGTLT   M A +IW    G++     N  L+ E      +P         
Sbjct: 370  SVNVICSDKTGTLTANHMTASKIWC--LGSM--ANKNNVLSLEAKSSGGLP--------- 416

Query: 416  NETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDP 475
                  G + N K+ Y    +            L   S+ N AS       +  K  G+P
Sbjct: 417  ------GKLPNLKN-YLSDDVKAT---------LRIGSICNNASF----SHEHGKYLGNP 456

Query: 476  TEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDST 535
            T+IA+     + DL     T  R D                            E  F+S 
Sbjct: 457  TDIALLEVLQKFDLVDERPTTTRVD----------------------------ELTFNSK 488

Query: 536  IKRMSSVYES-RDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDS 594
             K M+   +S  +   + IY KGAFE +L     + G                I +   S
Sbjct: 489  RKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIG-GAGKVEKLSDSHKSLINDCAKS 547

Query: 595  MSSEGLRVLAFAN-KSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGA 653
            ++SEGLR LAFA  +      +N+  +Q            LTF+GLIG+ DPPR     A
Sbjct: 548  LASEGLRTLAFAQLECSTNKPMNDSTIQN-----------LTFVGLIGMKDPPRSTVRPA 596

Query: 654  VKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSED 713
            +++  Q G++V M+TGD   TA  IA+++GI   N         +I V+TG + D +++D
Sbjct: 597  IEELLQGGVHVIMITGDAENTAVNIARQIGIPVIN--------PEISVLTGDRLDQMTDD 648

Query: 714  EIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGING 773
            ++  +     + AR +P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G+AMG  G
Sbjct: 649  QLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMG 708

Query: 774  SDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQD 833
            +DVAK+ASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +  AF+ 
Sbjct: 709  TDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKL 768

Query: 834  KEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMF 893
            +      PL  +++LWI ++    PA  LG+E   H++M +PP      I T +++  + 
Sbjct: 769  QN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLL 823

Query: 894  VYGVWMAASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILA 953
            +   ++    +  F+     ++    GQ   RD                 TMT+   +  
Sbjct: 824  INAAFIIGGTIYVFI-----KEMTEDGQVTARD----------------TTMTFTCFVF- 861

Query: 954  WEVIDLRRSFFRMHPDTDAPVKQFFK-DIYGNKFLFYSVVFGFASVFPVVYIPVINTDVF 1012
                D+  +    H       K  F+  I+ NK   Y+V F        +YIP       
Sbjct: 862  ---FDMFSALACRH-----ATKSIFEIGIFNNKMFNYAVGFSLLGQLCAIYIPFFQNIFK 913

Query: 1013 LHKPIGWEWGIAIAFSVCFWIGCELHKYFKR 1043
              +    +    I  S   +I  E+ KY+ +
Sbjct: 914  TERLSLGDLIYLIVISSSVFIADEVRKYYAK 944

>Kwal_14.1498
          Length = 939

 Score =  333 bits (854), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 286/1056 (27%), Positives = 472/1056 (44%), Gaps = 171/1056 (16%)

Query: 12   DYHALSVEDTCARLVTDSSKGI-SPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAX 70
            ++ +LSVE+T   L TD+  G+ +    + R AQ G+N +  +        L  +     
Sbjct: 32   EFCSLSVEETAQSLGTDTQNGLPTMSVVEERRAQYGKNEISSEED----EPLWWKFVTTF 87

Query: 71   XXXXXXXXXXXFAIRDWITGGV-----ICFVIGINVIIGLIQEYKASKTMNALRALSSPN 125
                        A+  +I G +     I   I I V +G +QEY++ K++ AL  L    
Sbjct: 88   VGDPLILLLIGSAVISFIMGNIDDAVSITLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQ 147

Query: 126  AHVIRNGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKD 185
             H+IR G    + ++               IPADLR++   +   +E+ LTGE+ PV K 
Sbjct: 148  CHLIRCGQESKLLASVLVPGDVVRFRVGDRIPADLRIIEAVDLSIEESNLTGENEPVHKS 207

Query: 186  A---NEIFDDE-----TPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGG 237
                N+ F  E      PV +R  +AF  + V +G  +GI I T  NT  GK+ + +   
Sbjct: 208  TATVNKEFYKENLGSIVPVSERSCIAFMGTLVREGHGRGIVIGTAKNTAFGKVFEMMN-- 265

Query: 238  NELISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMA 297
                + +  KT  Q A                   L + LS ++ ++  I  +  ++   
Sbjct: 266  ----AIEKPKTPLQTAM----------------DKLGKDLSFMSFIVIGIICLIGVIQGR 305

Query: 298  S--QKFDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALG 355
            S  + F +       +V +A++ IP  L +++T+T+++G   MA R  IIR+L S+E LG
Sbjct: 306  SWLEMFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRAIIRRLPSVETLG 358

Query: 356  AVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSH 415
            +VN ICSDKTGTLT   M   ++W    G++            K +I  +   +   +  
Sbjct: 359  SVNVICSDKTGTLTANHMSVNKVWC--LGSMS----------NKSNILKLDKATSGSFKK 406

Query: 416  NETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDP 475
            N TED                            L T +L N  S ++    K     G+P
Sbjct: 407  NLTED------------------------LRATLRTGNLCN-NSTYSHEHAKYL---GNP 438

Query: 476  TEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDST 535
            T+IA+     +  L             EDE                 +   + E  F+S 
Sbjct: 439  TDIALLEVLHKFGL-------------EDE---------------RPQVTRSDEISFNSK 470

Query: 536  IKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSM 595
             K M+   +  + K + ++ KGA+E +L   TH+   + N            I ++ D++
Sbjct: 471  RKFMAVKVKEANGK-FVVHVKGAYEKILEKSTHFINAE-NKVVKLDSNLRQAITDSADAL 528

Query: 596  SSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVK 655
            +S+GLR LAFA      S+ N +KL     E D    GLTF GL+G+ DPPR     AV+
Sbjct: 529  ASDGLRTLAFAQLEL--SNGNSKKLT----EDDI--NGLTFAGLLGMNDPPRPSVKAAVE 580

Query: 656  KFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEI 715
            +  +  +++ M+TGD   TA +IA+++GI   N         +  V+TG + D++SED++
Sbjct: 581  RLSEGSVHIIMITGDAENTAVSIARQIGIPVVN--------PETAVLTGDKLDHMSEDQL 632

Query: 716  DNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSD 775
             ++     + AR +P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G++MG  G+D
Sbjct: 633  ASIIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTD 692

Query: 776  VAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKE 835
            VAK+ASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +  AF    
Sbjct: 693  VAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAIATAF---- 748

Query: 836  GKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVY 895
             K   PL  +++LWI ++    PA  LG+E   H++M +PP      I T  +   +   
Sbjct: 749  -KLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRADKILTKAVFQRLLQS 807

Query: 896  GVWMAASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWE 955
               +    +  F+     ++    G+   RD                 TMT+   +    
Sbjct: 808  AALIIIGTIYVFI-----KEMAEDGEVTARD----------------TTMTFTCFVF--- 843

Query: 956  VIDLRRSFFRMHPDTDAPVKQFFK-DIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLH 1014
              D+  +    H       K  F+  I+ NK   Y+V          +Y+P   +     
Sbjct: 844  -FDMFNALACRH-----STKSIFEVGIFANKMFNYAVGCSLLGQVCAIYVPFFQSIFKTE 897

Query: 1015 KPIGWEWGIAIAFSVCFWIGCELHKYFKRIYYRNKS 1050
            +    +    +  S   +I  EL K + R    N S
Sbjct: 898  RLSLGDLAFLLLLSSTVFIADELRKLYNRKKRLNDS 933

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score =  330 bits (847), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 287/1049 (27%), Positives = 470/1049 (44%), Gaps = 178/1049 (16%)

Query: 12   DYHALSVEDTCARLVTDSSKGISP-EEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAX 70
            +Y  LSVE+T  +L TD+  G+S  EE   R    G N +     +D    L+ +  +  
Sbjct: 45   EYCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEIS----VDDDESLVKKFLSNF 100

Query: 71   XXXXXXXXXXXFAIRDWITGGV-----ICFVIGINVIIGLIQEYKASKTMNALRALSSPN 125
                        AI     G +     I   I I V +G +QEY++ K++ AL  L    
Sbjct: 101  VEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQE 160

Query: 126  AHVIRNGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKD 185
             H+IR G    V +T               IPAD+R++   +   DE+ LTGE+ PV K 
Sbjct: 161  CHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKS 220

Query: 186  ----ANEIFDDE----TPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGG 237
                + + ++D+     PV +R N+A+  + V +G  +GI + TG  T  G + + +   
Sbjct: 221  YKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMS-- 278

Query: 238  NELISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMA 297
                S +  KT                       PL   + KL   L   + V   ++  
Sbjct: 279  ----SIEKPKT-----------------------PLQLTMDKLGKDLSLASFVVIGIICV 311

Query: 298  SQKFDVDRGVAIYAVCVALSM--IPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALG 355
                     + ++ + V+L++  IP  L +++T+T+++G   MA R  I+R+L S+E LG
Sbjct: 312  VGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLG 371

Query: 356  AVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSH 415
            +VN ICSDKTGTLT   M   +IW    G++        LN    D N   NL  Y    
Sbjct: 372  SVNVICSDKTGTLTSNHMTVSKIWC--LGSMA-----NKLNVLSLDKNKGGNLKNY---- 420

Query: 416  NETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDP 475
                         D  +   + GN              L N AS       +  K  G+P
Sbjct: 421  -----------LTDDVKTTLLCGN--------------LCNNASY----SQEHAKYLGNP 451

Query: 476  TEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDST 535
            T++A+                        E +    L++       +++    E  F+S 
Sbjct: 452  TDVALL-----------------------EQLQKFELAD-----VRSEYTKVKELSFNSK 483

Query: 536  IKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSM 595
             K M++  +  + KT  ++ KGAFE +L+  +  Y  +              I +  +++
Sbjct: 484  RKMMATKIQDNEKKT-TLFIKGAFERILDKSSS-YLTEKGKIEKLTAGHRETIIDCANTL 541

Query: 596  SSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVK 655
            +SEGLRVLAFA ++   S          L E D ++  L F GLIG+ DPPR     A+ 
Sbjct: 542  ASEGLRVLAFAKRAMTDSSSK-------LVEDDISD--LVFTGLIGMNDPPRSSVKFAID 592

Query: 656  KFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVD--IMVMTGKQFDNLSED 713
            +F Q GI++ M+TGD   TA  IA+++GI           V+D  + V++G + + +++D
Sbjct: 593  QFLQGGIHIIMITGDSENTAVNIARQIGI----------PVIDPKLSVLSGDKLNEMTDD 642

Query: 714  EIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGING 773
            ++ N+     + AR +P+ K+ ++ AL RR    AMTGDGVND+P+LK+A++G++MG  G
Sbjct: 643  QLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMG 702

Query: 774  SDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQD 833
            +DVAK+ASD++L+DD+F++IL A+EEG+ + +NIQ F+   L+ ++A    + +  AF  
Sbjct: 703  TDVAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFML 762

Query: 834  KEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMF 893
                   PL  +++LWI ++    PA  LG+E   H++M +PP      I T E++  + 
Sbjct: 763  PN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLI 817

Query: 894  VYGVWMAASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILA 953
                   ASC+      ++ ++    GQ   RD                 TMT+   +  
Sbjct: 818  -----GTASCIILGTVYVFVKEMAEDGQVTARD----------------TTMTFTCFVF- 855

Query: 954  WEVIDLRRSFFRMHPDTDAPVKQFFK-DIYGNKFLFYSVVFGFASVFPVVYIPVINTDVF 1012
                D+  +    H       K  F+   + NK    +V F        +YIP     +F
Sbjct: 856  ---FDMFNALACRH-----TTKSIFEIGFFTNKMFNLAVGFSLLGQMCAIYIPFFQA-IF 906

Query: 1013 LHKPIGWEWGIAIAF-SVCFWIGCELHKY 1040
              + + +   I +A  S   +I  E+ KY
Sbjct: 907  KTESLAFSDLIFLAMISSSVFIIDEIRKY 935

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score =  329 bits (844), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 272/1012 (26%), Positives = 464/1012 (45%), Gaps = 167/1012 (16%)

Query: 12   DYHALSVEDTCARLVTDSSKGI-SPEEFQARLAQCGEN--SLGDDAKIDYKAMLIHQICN 68
            +Y  LSV++   +L TD + G+ S  E   R +  G N  ++ DD  + +K  L + I +
Sbjct: 37   EYCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESL-FKKFLSNFIED 95

Query: 69   AXXXXXXXXXXXXFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHV 128
                           + +      I   I I V +G +QEY++ K++ AL  L     H+
Sbjct: 96   RMILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHL 155

Query: 129  IRNGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKDANE 188
            +R G    V ++               IPAD+R++   +   DE+ LTGE+ PV K +  
Sbjct: 156  MRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQT 215

Query: 189  I----FDDE----TPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNEL 240
            I    F+D+     P+ +R  +A+  + V +G  +GI + TG NT  G + + +      
Sbjct: 216  IEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMN----- 270

Query: 241  ISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMAS-- 298
             + +  KT  Q                     L + LS ++ ++  +  +  I+   S  
Sbjct: 271  -NIEKPKTPLQLTM----------------DKLGKDLSLVSFIVIGMICLVGIIQGRSWL 313

Query: 299  QKFDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVN 358
            + F +       +V +A++ IP  L +++T+T+++G   MA R  I+R+L S+E LG+VN
Sbjct: 314  EMFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVN 366

Query: 359  DICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNET 418
             ICSDKTGTLT   M   ++W               L+     +N + +L   + + N  
Sbjct: 367  VICSDKTGTLTSNHMTVSKLWC--------------LDSMSNKLNVL-SLDKNKKTKNSN 411

Query: 419  EDVGIMQNF--KDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPT 476
               G ++N+  +D  E  +I   C           AS +   ++F           G+PT
Sbjct: 412  ---GNLKNYLTEDVRETLTIGNLCN---------NASFSQEHAIFL----------GNPT 449

Query: 477  EIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTI 536
            ++A+       ++P              +I ++V              +   E PF+S  
Sbjct: 450  DVALLEQLANFEMP--------------DIRNTV--------------QKVQELPFNSKR 481

Query: 537  KRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMS 596
            K M++   +       +Y KGAFE +L   T +                  I E  +SM+
Sbjct: 482  KLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMA 541

Query: 597  SEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKK 656
            SEGLRV  FA  +   SD +    + ++K+       LTF GLIG+ DPPR     A+++
Sbjct: 542  SEGLRVFGFAKLTL--SDSSTPLTEDLIKD-------LTFTGLIGMNDPPRPNVKFAIEQ 592

Query: 657  FHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVD--IMVMTGKQFDNLSEDE 714
              Q G+++ M+TGD   TA  IA+++GI           V+D  + V++G + D +S+D+
Sbjct: 593  LLQGGVHIIMITGDSENTAVNIAKQIGI----------PVIDPKLSVLSGDKLDEMSDDQ 642

Query: 715  IDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGS 774
            + N+     + AR +P+ K+ ++ AL +R    AMTGDGVND+P+LK++++G++MG  G+
Sbjct: 643  LANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGT 702

Query: 775  DVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDK 834
            DVAK+ASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +  AF   
Sbjct: 703  DVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAF--- 759

Query: 835  EGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFV 894
              K   PL  +++LWI ++    PA  LG+E   H++M +PP      I T +++  +  
Sbjct: 760  --KLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLT 817

Query: 895  YGVWMAASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAW 954
                  A+C+      I+ ++    G+   RD                 TMT+   +   
Sbjct: 818  -----TAACIIVGTVYIFVKEMAEDGKVTARD----------------TTMTFTCFVF-- 854

Query: 955  EVIDLRRSFFRMHPDTDAPVKQFFK-DIYGNKFLFYSVVFGFASVFPVVYIP 1005
               D+  +    H       K  F+   + NK   Y+V          +YIP
Sbjct: 855  --FDMFNALACRH-----NTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIP 899

>Scas_707.48*
          Length = 741

 Score =  294 bits (752), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 238/818 (29%), Positives = 388/818 (47%), Gaps = 140/818 (17%)

Query: 12  DYHALSVEDTCARLVTDSSKGI-SPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAX 70
           +Y  +SV++T  +L TD   G+ S  E   R    G N +     I+    L  +  ++ 
Sbjct: 37  EYCTMSVDETLRKLETDPKSGLGSIAEASRRKLVYGANEI----VIEEDESLWKKFLSSF 92

Query: 71  XXXXXXXXXXXFAIRDWITGGV-----ICFVIGINVIIGLIQEYKASKTMNALRALSSPN 125
                       A+  +I G +     I   I I V +G +QEY++ K++ AL  L    
Sbjct: 93  VEDRLILLLIGSAVVSFIMGNIDDAVSITLAIVIVVSVGFVQEYRSEKSLEALNKLVPAE 152

Query: 126 AHVIRNGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKD 185
            H+IR G    V ++               IPADLR++   +   DE+ LTGE+ PV K 
Sbjct: 153 CHLIRCGQESHVLASGLVPGDLVHFKIGDRIPADLRIIEAVDLSIDESNLTGENEPVHKS 212

Query: 186 ANEI----FDDE----TPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGG 237
           A E+    F+D+     P+ DR  +A+  + V +G  +GI +  G NT  G I + L   
Sbjct: 213 AKEVNKDSFNDQPNSIIPISDRTCVAYMGTLVKEGHGKGIVVGIGKNTSFGAIFEMLS-- 270

Query: 238 NELISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMA 297
               + +  KT  QNA                   L + LS  + ++  +  +  I+   
Sbjct: 271 ----NIEKPKTPLQNAM----------------DKLGKDLSLFSFIVIGLICLVGILQGR 310

Query: 298 S--QKFDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALG 355
           S  + F +       +V +A++ IP  L +++T+T+++G   MA R  I+R+L S+E LG
Sbjct: 311 SWLEMFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLG 363

Query: 356 AVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSH 415
           +VN ICSDKT     G + +  +   K   L  + +               N+   E   
Sbjct: 364 SVNVICSDKT-----GTLTSNHMTASKIWCLDSMANK-------------ANVLSLE--- 402

Query: 416 NETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDP 475
                             KS  G+ +  L +    T ++ NI +  +  + +  K  G+P
Sbjct: 403 ------------------KSKSGSLKNYLTEDVKSTLTIGNICNNASFSQ-EHGKYLGNP 443

Query: 476 TEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDST 535
           T+IA+                        E +S   LS+   T     F+   E PF+S 
Sbjct: 444 TDIALL-----------------------EQLSKFDLSDIRPT-----FKKVQEIPFNSK 475

Query: 536 IKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSM 595
            K M+    + + K Y +  KGAFE VL+ C+H+  +               I E  +S+
Sbjct: 476 RKFMAVKIVNSEGK-YSLCVKGAFEKVLSQCSHYLNQKGKTEKLTQGQRDVII-ETANSL 533

Query: 596 SSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVK 655
           +SEGLR+LAFA  + P S         +L E    +  L F GLIG+ DPPR     A++
Sbjct: 534 ASEGLRMLAFAKTTLPDSPT-------LLTEESVGD--LIFTGLIGMNDPPRPTVKPAIE 584

Query: 656 KFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVD--IMVMTGKQFDNLSED 713
           +  Q G+++ M+TGD   TA  IA+++GI           V+D  + V++G + + +S+D
Sbjct: 585 QLLQGGVHIIMITGDSENTAVNIARQIGI----------PVLDPKLSVLSGDKLNEMSDD 634

Query: 714 EIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGING 773
           ++ N+     + AR +P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G++MG  G
Sbjct: 635 QLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLADIGVSMGRMG 694

Query: 774 SDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFV 811
           +DVAK+ASD+VL+DD+F++IL A+EEG+ + +NIQ F+
Sbjct: 695 TDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFL 732

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
            Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score =  217 bits (552), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 158/536 (29%), Positives = 262/536 (48%), Gaps = 71/536 (13%)

Query: 529  EFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXI 588
            E PF+S  K M+      + K   +Y KGAFE ++    ++ GRD              I
Sbjct: 462  EIPFNSKRKFMAVKTIDANDKVV-VYVKGAFEKIVEKSINYIGRD-GKVHKLKPNDKAII 519

Query: 589  KENIDSMSSEGLRVLAFA----NKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYD 644
             +   +++SEGLR LAFA    + ++   + NE+ ++           GLTF GLI + D
Sbjct: 520  NDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVE-----------GLTFTGLIAMND 568

Query: 645  PPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTG 704
            PPR     A+++  Q  ++V M+TGD   TA +IA+++GI P     YS       V++G
Sbjct: 569  PPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGI-PVINPEYS-------VLSG 620

Query: 705  KQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMAN 764
             + D +++D++ ++     V AR +P+ K+ ++ AL +R    AMTGDGVND+P+LK+A+
Sbjct: 621  DKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLAD 680

Query: 765  VGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALY 824
            +G++MG  G+DVAK+ASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    
Sbjct: 681  IGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSL 740

Query: 825  LIVGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIF 884
            + +  +      K   PL  +++LWI ++    PA  LG+E   H++M +PP      I 
Sbjct: 741  VAISTSL-----KLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRTDKIL 795

Query: 885  TWEIIVDMFVYGVWMAASCMATFVTIIYGRDHGNLGQNCNRDYSE--SC---HDVFRARS 939
            T  ++  + +   ++    +  FV     ++    GQ  +RD +   +C    D+F A S
Sbjct: 796  TDAVLKRVLISACFIIVGTIYVFV-----KEMAEDGQVTSRDTTMTFTCFVFFDMFNALS 850

Query: 940  AAFATMTWCALILAWEVIDLRRSFFRMHPDTDAPVKQFFKDIYGNKFLFYSVVFGFASVF 999
               AT                +S F +               + NK   Y+V        
Sbjct: 851  CRHAT----------------KSIFEI-------------GFFANKMFNYAVSLSLLGQL 881

Query: 1000 PVVYIPVINTDVFLHKPIGWEWGIAIAFSVCFWIGCELHKYF--KRIYYRNKSRAI 1053
              +YIP              +    +  S   +IG E+ KY+  K  Y  + S +I
Sbjct: 882  CAIYIPFFQGIFKTESLSLGDLLFLLTLSSSVFIGDEIRKYYVKKNRYLDSYSSSI 937

 Score =  141 bits (355), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 114/380 (30%), Positives = 174/380 (45%), Gaps = 41/380 (10%)

Query: 12  DYHALSVEDTCARLVTDSSKGIS-PEEFQARLAQCGENSLGDDAKID-YKAMLIHQICNA 69
           +Y  +SVEDT A+L TD   G+S P E   R +  G N +  D K+  +K  L   I + 
Sbjct: 32  EYCTVSVEDTIAQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDP 91

Query: 70  XXXXXXXXXXXXFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVI 129
                       F + +      I   I I V +G +QEYK+ K++ AL  L     H+ 
Sbjct: 92  LILLLIGSAVISFLMGNIDDSISIALAIIIVVTVGFVQEYKSEKSLEALNKLVPAECHLT 151

Query: 130 RNGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKDA--- 186
           R+G    V ++               IPADLR+V   +   DE+ LTGE+ PV K +   
Sbjct: 152 RSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAV 211

Query: 187 -----NEIFDDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELI 241
                + I     PVGDR  + F  + V +G  +GI I TG +T  G + + + G ++  
Sbjct: 212 DPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDK-- 269

Query: 242 SRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKF 301
                                        TPL   + KL   L +++ V   ++      
Sbjct: 270 ---------------------------PKTPLQTAMDKLGQDLSYMSFVLIGIICLIGII 302

Query: 302 DVDRGVAIY--AVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVND 359
                + ++  AV +A++ IP  L +++T+T+++G   MA R  I+R+L S+E LG+VN 
Sbjct: 303 QGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNV 362

Query: 360 ICSDKTGTLTQGKMIAKQIW 379
           ICSDKTGTLT   M   +IW
Sbjct: 363 ICSDKTGTLTANHMTVSKIW 382

>Kwal_47.17547
          Length = 1240

 Score =  215 bits (547), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 244/1031 (23%), Positives = 422/1031 (40%), Gaps = 178/1031 (17%)

Query: 86   DWITGGVICFVIGINVIIGLIQEYKASKTMNALR-ALSSPNAHVIRNGNSEVVDSTXXXX 144
            DW+ G  I   + + +++G   +Y+     + L    +     V+RNG+  ++       
Sbjct: 147  DWVEGVAIMIAVLVVILVGSANDYQKELQFSKLNDKKNDREVIVLRNGDEHLISIHDILV 206

Query: 145  XXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKDANEI--------------F 190
                       +PAD  LV + + E DE+ LTGES  + K A ++               
Sbjct: 207  GDILSLQTGDVVPADCILV-KGSCECDESALTGESATIKKAAIDVCYEKYKQLSATDAAI 265

Query: 191  DDETPVGDRIN--LAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKT 248
            D  TP  +++   +  S S ++ G  + +    G+N+  G                    
Sbjct: 266  DIGTPGAEKVPDPMLISGSKLLSGLGRAVVTSVGVNSMHG-------------------- 305

Query: 249  WYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLA-----------VLLFWIAVVFAIV--- 294
                      RT+ A     + TPL  +L  LA           +LLF+I  +  +    
Sbjct: 306  ----------RTLMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLK 355

Query: 295  -------VMASQKFDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRK 347
                   +  +QK      + I  + V +  +P  L + +T+ ++     MA    ++R 
Sbjct: 356  KGGELHDLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRV 415

Query: 348  LDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPK--FGTLQVVG------------SNE 393
            L + E +G+   +CSDKTGTLT+ +M   + ++    F   + VG            +NE
Sbjct: 416  LRACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDEAESVGPSDSETDVDLAIANE 475

Query: 394  PLNPEKGDI--NFIPNLSPYEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLET 451
                 K D+  N   N + +E   NE + V     F  K      P    +   +K  + 
Sbjct: 476  CSEELKKDVLTNITLNSTAFENKENEEDKVSNENPFH-KPRKSLFP----WSRNNKSKKP 530

Query: 452  ASLANIASVFTDPETKEWKAHGDPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVS 511
            A+   +       + KE    G  TE A+  FA + +L    L   RD+ D   I   V 
Sbjct: 531  ATAKELVENAAADQPKE-PFLGSKTETALLAFAQK-NLGMQNLHHYRDEPDCLGIEKIVQ 588

Query: 512  LSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYG 571
            +                  PF+S+ K    V + ++   +  Y KGA E +L  C     
Sbjct: 589  I-----------------IPFESSRKWGGIVVKYKN-GLHRFYIKGAAELLLRRCMQKRA 630

Query: 572  RDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFANKSYP-------------------- 611
             D                + I ++++E LR ++ A++ YP                    
Sbjct: 631  SDSKLTLISQKDFDEE-SQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAAS 689

Query: 612  ----------KSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAG 661
                      +SD   E  Q+++       + +   G++GI DP R+    +V++  +AG
Sbjct: 690  PDLLFGDEVSRSDSVSEPAQELV-------SPMVLDGIVGIQDPLRKGVRKSVEQCQKAG 742

Query: 662  INVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVL 721
            + VRM+TGD   TA AIA++  IL        +       M G +F  LS  E   + +L
Sbjct: 743  VTVRMVTGDNILTATAIAKKCSILSEEQAENPESS-----MEGPRFRKLSNKE--RVRIL 795

Query: 722  P--LVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKD 779
            P   V+AR SP+ K  ++E L +     A+TGDG ND+P+LK+A+VG +MGI G++VA++
Sbjct: 796  PNLRVLARSSPEDKRILVETLKKMGDVVAVTGDGTNDAPALKLADVGFSMGIAGTEVARE 855

Query: 780  ASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSV 839
            ASDI+L  D+F++I+NA++ GR +S +I+KF+   L  NV   +   V  A    E  SV
Sbjct: 856  ASDIILMTDDFSAIVNAIKWGRCVSTSIKKFIQFQLTVNVTAVVLTFVS-AVASSEEASV 914

Query: 840  FPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKA---GIFTWEIIVDMFVYG 896
              L  V++LW+ ++     A+ L  +K   ++++R P   +A    + TW++I+      
Sbjct: 915  --LTAVQLLWVNLIMDTLAALALATDKPDENILERKPKGREAVLITVSTWKMILGQSTL- 971

Query: 897  VWMAASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCAL--ILAW 954
                   + TF+    G+     G+      + + H+  +  +  F    W     ++  
Sbjct: 972  -----QLIVTFILHFAGKQIFFPGK-----ATITGHEQQQLNAMTFNAFVWLQFFKLIVT 1021

Query: 955  EVIDLRRSFFRMHPDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLH 1014
              +D       +     A    FF+D++ N +    +V      F V+ + V      + 
Sbjct: 1022 RKLDEADGISNVKDRITASNLNFFQDLFRNYYFLAIIV--LIGGFQVLIMYVGGAAFSIA 1079

Query: 1015 KPIGWEWGIAI 1025
            K  G  W  AI
Sbjct: 1080 KQTGAMWATAI 1090

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  207 bits (528), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 219/854 (25%), Positives = 366/854 (42%), Gaps = 140/854 (16%)

Query: 128  VIRNGNSEVVDSTXXXXXXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSKDA- 186
            VIRNG+  ++                  +PAD  L+S  + E DE+ LTGES  + K A 
Sbjct: 243  VIRNGDEHLISIHDLLVGDVISLQTGDVVPADAVLISG-SCECDESALTGESDTIKKVAL 301

Query: 187  -------NEIFDDETP-------VGDRIN--LAFSSSTVVKGRAQGIAIKTGLNTEIGKI 230
                    +IF+ +         VG+++   L  S S ++ G    +    G N+  G+I
Sbjct: 302  KPALEKYKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKLLSGIGNAVITSVGENSVNGRI 361

Query: 231  AKSLRGGNELISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLA--------- 281
              +L+  +E                               TPL  +LS LA         
Sbjct: 362  MMALKTESE------------------------------STPLQERLSNLADNISIYGCM 391

Query: 282  ---VLLFWIAVVFAIVVMASQKFD----VDRGVAIYAV-----CVALSMIPSSLVVVLTI 329
               VL   + + F   +   +K+       +G     +      V +  +P  L + +T+
Sbjct: 392  AALVLFIILFIRFLTYLPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTL 451

Query: 330  TMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVV 389
             ++     M     ++R L + E +G+   ICSDKTGTLT+ +M   + +    G L   
Sbjct: 452  ALAFATTRMTKDGNLVRVLRACETMGSATAICSDKTGTLTENRMTVVKGFA---GNLGFD 508

Query: 390  GSNEPLNPE-KGDINFIPNLSP---YEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQLF 445
             +    N E K  +    N       +   N + +    +N + +++ K +  N  Y   
Sbjct: 509  DTTHAENKEIKSAVVLRSNCDASLLTDILSNISLNSTAFENKESQHKDKDVDEN-PYHKS 567

Query: 446  DKWLETASLANIASVFTDPETKEWKAH--GDPTEIAIQVFATR----MDLPRHVLTGERD 499
             K L   S  N  S       KE      G  TE A+  FA +     D+  H L  +  
Sbjct: 568  RKSLFPWSRNNRTSQLIADAMKENDEQFLGSKTETALLAFAQKSLGMKDV--HKLRTKPS 625

Query: 500  DMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAF 559
            D+  D+++  +                    PF+S+ K  +   +  D K Y  Y KGA 
Sbjct: 626  DLGIDKVVQVI--------------------PFESSRKWGAIAVQLADNKGYRFYAKGAA 665

Query: 560  ESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFAN---KSYPKSDVN 616
            E +L  C++    D +             K+ I  M+S  LR ++  +   K +P  +  
Sbjct: 666  EILLKVCSNQRNSDNSIVPMNQDLYDESFKK-IQDMASHALRTISLVHRDFKEWPPKEFA 724

Query: 617  EEKLQKI----------LKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRM 666
            +     I          L  ++ +  G+T   ++G+ DP RE    +V++  +AG+ VRM
Sbjct: 725  DSTDPSIASPDLVMGHELDHKNLSSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRM 784

Query: 667  LTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLP--LV 724
            +TGD   TA+AI++   IL    Y+  +       M G  F  L   ++  L V+P   V
Sbjct: 785  VTGDNILTARAISRNCNILSEEGYNDPE-----CAMEGPTFRKLPYKKM--LRVIPKLRV 837

Query: 725  IARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIV 784
            +AR SP+ K  ++E L +  +  A+TGDG ND+P+LK+A+VG +MGI+G++VA++ASDI+
Sbjct: 838  LARSSPEDKRILVETLKKMGEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDII 897

Query: 785  LSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPLAP 844
            L  D+F +I+NA++ GR +S +I+KF+   L  N+   +   V  A    E  SV  L  
Sbjct: 898  LMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLTVNITAVILTFVS-AVASAEETSV--LTA 954

Query: 845  VEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKA---GIFTWEIIVDMFVYGVWMAA 901
            V++LW+ ++     A+ L  +K    ++DR P    A    + TW++I+         A 
Sbjct: 955  VQLLWVNLIMDTLAALALATDKPDEFILDRKPKGRDAPLIAVSTWKMILGQ------AAL 1008

Query: 902  SCMATFVTIIYGRD 915
                TFV    G++
Sbjct: 1009 QLTVTFVLHFRGKE 1022

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  206 bits (525), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 247/998 (24%), Positives = 405/998 (40%), Gaps = 184/998 (18%)

Query: 86   DWITGGVICFVIGINVIIGLIQEYKASKTMNAL-RALSSPNAHVIRNGNSEVVDSTXXXX 144
            DWI G  I   + + V++    +Y+       L R        V+R+    ++       
Sbjct: 118  DWIEGLAIMMAVLVVVLVSAANDYQKELQFQQLNRKREDRQVVVVRDAAESLISIHNLLV 177

Query: 145  XXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSK----DANEIFDDE--TPVGD 198
                       +PAD  LV  +  ETDE+ LTGES  + K    DA E         +GD
Sbjct: 178  GDLLKLQTGDVVPADCVLVRGE-CETDESALTGESNTIKKLPLADALEYHSAHGGRDIGD 236

Query: 199  RIN---------------LAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISR 243
                              +  S S V+ G A  I    G+N+  GK   SL+  +E    
Sbjct: 237  TSASGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVGVNSVHGKTMASLKEDSE---- 292

Query: 244  DPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKL-----------AVLLFWI--AVV 290
                                       TPL  +LS+L           A+ LF +  A  
Sbjct: 293  --------------------------DTPLQMRLSQLTDNISVYGCVAAITLFVVLFARY 326

Query: 291  FAIVVMASQKFD----VDRG-----VAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASR 341
             + ++ +  K+      ++G     + I A+ V +  +P  L + +T+ ++     M   
Sbjct: 327  LSYILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKD 386

Query: 342  NVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNE-PLNPEKG 400
              ++R L S E +G+   +CSDKTGTLT+  M   +      GTL   G ++   +P K 
Sbjct: 387  GNLVRVLRSCETMGSATAVCSDKTGTLTENIMTVVR------GTLGRAGFDDIGADPSKS 440

Query: 401  DINFIPNLSPYEYS---HNETEDVGIMQN--FKDKYEGKSIPGNCQYQLFDKWLETASLA 455
            ++ F    S    +    N   +    +N  +KD     SI  +   +L  +  +T    
Sbjct: 441  NLVFKKKCSDLLRTVIYDNIVLNSTAFENKDYKDPNNYNSIDDSQPRRLIRRITQTLQKK 500

Query: 456  NIASVFTDPETKEWKAHGDPTEIAIQVFATRMDLPRHVLTGERD----DMDEDEIMSSVS 511
                    P+ +E                   +L  H   G ++       E  ++S   
Sbjct: 501  K-------PDDEE-------------------NLLAHAAEGRQEPYIGSKTETALLSLAR 534

Query: 512  LSEKDATAANAKFR-HAAEFPFDSTIKRMSSVYESRDY---------------KTYEIYT 555
             S      A   FR H  + P   TI ++     SR +               K + +Y 
Sbjct: 535  KSFGLKFGALQSFRGHPEKLPTVETIVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYV 594

Query: 556  KGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFANKSYPKSDV 615
            KGA E V   CT                    I+E I S++ + LR ++ A+  +   DV
Sbjct: 595  KGAAEIVAKACT-LKNVCNEGISEIDQKSKDDIEEQIFSLAKDALRAISLAHMDF---DV 650

Query: 616  NE-------------EKLQ-KILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAG 661
            NE             E L  K++  +     GLT   ++GI DP RE    +V +  +AG
Sbjct: 651  NEWPPKELADPENSHEALAVKLIDPKKPHLEGLTLDAIVGIQDPLRENVKNSVAQCQKAG 710

Query: 662  INVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVL 721
            + VRM+TGD   TAKAIA+  GIL +   + S        M G  F  LS+ E   +   
Sbjct: 711  VTVRMVTGDNLLTAKAIARNCGILSSKSLNDSA-----CAMEGPAFRKLSDSERKRILPK 765

Query: 722  PLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDAS 781
              V+AR SP+ K  ++ AL    +  A+TGDG ND+P+LK+A+VG +MGI G++VA++AS
Sbjct: 766  LRVLARSSPEDKKILVRALKEMGEVVAVTGDGTNDAPALKLADVGFSMGITGTEVAREAS 825

Query: 782  DIVLSDDNFASILNAVEEGRRMSDNIQKFV-LQLLAENVAQALYLIVGLAFQDKEGKSVF 840
            DI+L  D+F++I+NA++ GR ++ +I+KF+  QL+    A  L  +  +   D   KSV 
Sbjct: 826  DIILMTDDFSAIVNAIKWGRCVAASIKKFIQFQLIVNVTAVLLTFVTSVISSDV--KSV- 882

Query: 841  PLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIF---TWEIIVDMFVYGV 897
             L  V++LW+ ++     A+ L  +K   ++MDR P      +    TW++I+   +  +
Sbjct: 883  -LTAVQLLWVNLIMDTLAALALATDKPDPNIMDRKPKGRSTPLITPSTWKMIIGQAILQL 941

Query: 898  WMAASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVI 957
             +  +  +      +G+   +L            H+  +  +  F T  W    L W  +
Sbjct: 942  SVTFTLYSHGAQYFFGKPKEDL----------PGHEHQQINAMIFNTFVW----LQWFTL 987

Query: 958  DLRRSFFRMHPDTD------APVKQFFKDIYGNKFLFY 989
             + R         D      A    FF+D++ N +  +
Sbjct: 988  LVSRKLDEADGIKDWRKRLTASNLNFFQDLFRNYYFIF 1025

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score =  181 bits (460), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 169/622 (27%), Positives = 280/622 (45%), Gaps = 84/622 (13%)

Query: 320 PSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIW 379
           P  L + +T+ ++     M     ++R L + E +G+   +CSDKTGTLTQ KM+  + +
Sbjct: 387 PEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGF 446

Query: 380 VPKFGTLQVVGSNEPLNPEKGDI-----------NFIPN--LSPYEYSHNETEDVGIMQN 426
           +   G+      +E  N  + D            + + N  L+   + + +  D  I +N
Sbjct: 447 L---GSSHFDDISEDSNCAQSDALRQDMSQHTLNDILANIALNSTAFENKQVADPVITEN 503

Query: 427 FKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFATR 486
              K      P          W         A   +  ++ E+   G  TE A+   A +
Sbjct: 504 PYHKPRRSLFP----------WSRNNKPKYPAPKDSSVQSAEFFI-GSKTEAALLSLA-K 551

Query: 487 MDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESR 546
             L    L   RDD     I S V +                  PF+S+ K    V    
Sbjct: 552 GSLGLESLQALRDDPHHIGIASIVQM-----------------IPFESSRKWAGLVVRLV 594

Query: 547 DYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFA 606
           D   Y  + KGA E++   C H+     +            I   I++++S+ LR ++ A
Sbjct: 595 D-GNYRFFIKGASETIFKSC-HYMRSSNDDVIKLSPQKHGEIFGLINNLASDALRTISLA 652

Query: 607 NK------SYPKSDVNEEK-----LQKILKERDYAET-------------GLTFLGLIGI 642
           +K      S+P +++ +          +L   +Y  T             GL   G++GI
Sbjct: 653 HKDFTDISSWPPAELRDASDPSTASPDLLLGDEYVPTATDRPSIITNNNSGLILDGVVGI 712

Query: 643 YDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVM 702
           +DP R     +VK   Q+G+ VRM+TGD   T +AIA+  GIL  + Y   +       M
Sbjct: 713 HDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILSESEYADHE-----CAM 767

Query: 703 TGKQFDNLSEDEI-DNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLK 761
            G  F  LS  ++ D  P L  V+AR SP+ K   ++ L +  +  A+TGDG ND+P+L 
Sbjct: 768 EGPVFRKLSRRQMMDAAPKLK-VLARSSPEDKRIFVDILKKMNEVVAVTGDGTNDAPALT 826

Query: 762 MANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQ 821
           +A+VG +MGI+G+ VA++ASDI+L  D+F SI+NA++ GR +S +I+KF+   L  N+  
Sbjct: 827 LADVGFSMGISGTGVAREASDIILMTDDFTSIVNAIKWGRCVSLSIKKFIQFQLTVNIT- 885

Query: 822 ALYLIVGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKA 881
           A+ L    A    E   V  L  V++LW+ ++     A+ L  +K    +++R P    +
Sbjct: 886 AVTLTCVTAVTSTEENPV--LTAVQLLWVNLIMDTLAALALATDKPDPHILERIPTGRDS 943

Query: 882 ---GIFTWEIIVDMFVYGVWMA 900
               + TW++I+   V  + +A
Sbjct: 944 PLIAVSTWKMILGQAVLQLIIA 965

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score =  179 bits (454), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 131/400 (32%), Positives = 213/400 (53%), Gaps = 34/400 (8%)

Query: 531 PFDSTIKRMSSVYESRDYKT----YEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXX 586
           PF+S+ K    V + ++ K     Y  + KGA E V   C++    D +           
Sbjct: 614 PFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSD-DTLEEINEDNKK 672

Query: 587 XIKENIDSMSSEGLRVLAFANK------SYPKSDVNEEKLQKI--LKERDYAETGLTFLG 638
              + I +++S+ LR ++ A+K      S+P   + ++    I  L     ++ GL   G
Sbjct: 673 ETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQKGLILDG 732

Query: 639 LIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVD 698
           L+GI DP R     +V++  +AG+ VRM+TGD   TAKAIA+   IL T++   S E   
Sbjct: 733 LLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDI---SSEAYS 789

Query: 699 IMVMTGKQFDNLSEDE-IDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDS 757
              M G +F  L+++E I  LP L  V+AR SP+ K  ++E L       A+TGDG ND+
Sbjct: 790 --AMEGTEFRKLTKNERIRILPNLR-VLARSSPEDKRLLVETLKGMGDVVAVTGDGTNDA 846

Query: 758 PSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFV-LQLLA 816
           P+LK+A+VG +MGI+G++VA++ASDI+L  D+F++I+NA++ GR +S +I+KF+  QL+ 
Sbjct: 847 PALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQFQLIV 906

Query: 817 ENVAQALYLIVGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPP 876
              A  L  +  +A  D+       L  V++LWI ++     A+ L  +K   ++MDR P
Sbjct: 907 NITAVILTFVSSVASSDETS----VLTAVQLLWINLIMDTLAALALATDKPDPNIMDRKP 962

Query: 877 ---NDSKAGIFTWEIIVDMFVYGVWMAASCMATFVTIIYG 913
              + S   + TW++I+             + TF+   YG
Sbjct: 963 RGRSTSLISVSTWKMILSQ------ATLQLIVTFILHFYG 996

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/336 (21%), Positives = 124/336 (36%), Gaps = 81/336 (24%)

Query: 86  DWITGGVICFVIGINVIIGLIQEYKASKTMNAL-RALSSPNAHVIRNGNSEVVDSTXXXX 144
           DWI G  I   + + V++    +Y+       L +   +    VIRN    ++       
Sbjct: 153 DWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVIRNDQEILISIHHVLV 212

Query: 145 XXXXXXXXXXTIPADLRLVSQQNFETDEALLTGESLPVSK-------------------- 184
                      +PAD  ++S +  E DE+ +TGES  + K                    
Sbjct: 213 GDVISLQTGDVVPADCVMISGK-CEADESSITGESNTIQKFPVDNSLRDFKKFNSIDSHN 271

Query: 185 -----DANEIFDDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNE 239
                D  ++ +D   + D   +  S S ++ G  +G+    G+N+  G+   SL    E
Sbjct: 272 HSKPLDIGDVNEDGNKIAD--CMLISGSRILSGLGRGVITSVGINSVYGQTMTSLNAEPE 329

Query: 240 LISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLA-----------VLLFWIA 288
                                          TPL   LS+LA           ++LF + 
Sbjct: 330 ------------------------------STPLQLHLSQLADNISVYGCVSAIILFLVL 359

Query: 289 V---VFAIVVMASQKFDVD--------RGVAIYAVCVALSMIPSSLVVVLTITMSVGAAV 337
               +F I+    +  D+D          + I ++ V +  +P  L + +T+ ++     
Sbjct: 360 FTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTR 419

Query: 338 MASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM 373
           M     ++R L S E +G+   +CSDKTGTLT+  M
Sbjct: 420 MTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVM 455

>Scas_297.1
          Length = 800

 Score =  134 bits (337), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 155/285 (54%), Gaps = 28/285 (9%)

Query: 669 GDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDE-IDNLPVLPLVIAR 727
           GD   TA+AIA+   IL    Y   +  ++     G +F  L++ E I  LP L  V+AR
Sbjct: 1   GDNILTARAIARNCNILSEETYLIPECAIE-----GPKFRTLTKQERIKMLPNL-RVMAR 54

Query: 728 CSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSD 787
            SP+ K  ++E L       A+TGDG ND+P+LK+A+VG +MGI+G++VA++ASDI+L  
Sbjct: 55  SSPEDKRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMT 114

Query: 788 DNFASILNAVEEGRRMSDNIQKFV-LQLLAENVAQALYLIVGLAFQDKEGKSVFPLAPVE 846
           D+FA+I++A++ GR +S +I+KF+  QL+    A  L  +  +A +D+       L  V+
Sbjct: 115 DDFAAIVDAIKWGRCVSISIKKFIQFQLIVNITAVILAFVSSIASEDETSV----LTAVQ 170

Query: 847 VLWIIVVTSCFPAMGLGLEKAAHDLMDRPPND-SKAGIF--TWEIIVDMFVYGVWMAASC 903
           +LWI ++     A+ L  +K   ++MDR P   S   IF  TW++I         ++ SC
Sbjct: 171 LLWINLIMDTLAALALATDKPDPNIMDRKPRGRSTPLIFPSTWKMI---------LSQSC 221

Query: 904 MATFVTIIYGRDHGNLGQNCNRDYSE-SCHDVFRARSAAFATMTW 947
           +   VT I    H N  +   R   E + H+  +  +  F T  W
Sbjct: 222 LQLIVTFIL---HFNGKEIFFRGRDEITGHEQQQLNAMTFNTFVW 263

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 72/184 (39%), Gaps = 66/184 (35%)

Query: 156 IPADLRLVSQQNFETDEALLTGESLPVSK----DANEIFDD---------------ETPV 196
           IPAD  LV  Q  E DE+ +TGES  + K    +A + FD                +TP 
Sbjct: 630 IPADGVLVEGQ-CEVDESSITGESDTIKKVKVFNALKTFDVINEGKSNDQILDIGFKTPN 688

Query: 197 GDRIN--LAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAW 254
           GD+I   +  S S ++ G  + I    G N        S+ G                  
Sbjct: 689 GDKIPDCMLISGSKLLSGLGKAIITSVGTN--------SIHG------------------ 722

Query: 255 ISTKRTVGAFLGTTQGTPLHRKLSKL-----------AVLLF---WIAVVFAIVVMASQK 300
               RT+ A     + TPL ++LS+L           A+LLF   +I  +F I+    + 
Sbjct: 723 ----RTMMALKVEPESTPLQQRLSQLADSISVYGCVAAILLFLVLFIRFLFYILAPNGRF 778

Query: 301 FDVD 304
            D+D
Sbjct: 779 HDLD 782

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score =  115 bits (288), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 162/353 (45%), Gaps = 48/353 (13%)

Query: 25  LVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAXXXXXXXXXXXXFAI 84
           L TD S G++ +E   R  + G N + ++ +  +   L+  I                 +
Sbjct: 61  LQTDPSYGLTSDEVTKRRKKYGLNQMSEETENLFVKFLMFFI-GPIQFVMEAAAILAAGL 119

Query: 85  RDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTXXXX 144
            DW+  GVIC ++ +N  +G IQEY+A   ++ L+   + +A VIR+GN   V S     
Sbjct: 120 EDWVDFGVICGLLFLNAAVGFIQEYQAGSIVDELKKTLANSAVVIRDGNLVEVPSNEVVP 179

Query: 145 XXXXXXXXXXTIPADLRLVSQQNF-ETDEALLTGESLPVSKDANEIFDDETPVGDRINLA 203
                      IPAD RLV++  F + D++ +TGESL V K     F D T         
Sbjct: 180 GDILQLEDGVVIPADGRLVTEDCFIQIDQSAITGESLAVDKR----FGDST--------- 226

Query: 204 FSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTVGA 263
           FSSSTV +G A  I   TG +T +G+ A  +                           G 
Sbjct: 227 FSSSTVKRGEAFMIVTATGDSTFVGRAAALVN--------------------KAAAGSGH 266

Query: 264 FLGTTQGT-PLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMI--P 320
           F     G   +   L  + +LL W+A  +            ++ V I    +A++++  P
Sbjct: 267 FTEVLNGIGTILLILVIVTLLLVWVASFY----------RTNKIVRILRYTLAITIVGVP 316

Query: 321 SSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM 373
             L  V+T TM+VGAA +A +  I++KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 317 VGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 369

 Score =  110 bits (274), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 91/328 (27%), Positives = 155/328 (47%), Gaps = 48/328 (14%)

Query: 512 LSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYG 571
           +S   A AA  K++     PFD   K+++++ ES + +   I  KGA   VL      + 
Sbjct: 412 ISYPRAKAALTKYKLLEFHPFDPVSKKVTAIVESPEGERI-ICVKGAPLFVLKTVEEEHP 470

Query: 572 RDPNXXXXXXXXXXXXIKENIDS----MSSEGLRVLAFANKSYPKSDVNEEKLQKILKER 627
              +            ++EN ++    ++S G R L  A K                   
Sbjct: 471 IPED------------VRENYENKVAELASRGFRALGVARKR------------------ 500

Query: 628 DYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPT 687
              E     LG++   DPPR++TA  V +    G+ V+MLTGD  G AK   +++G L T
Sbjct: 501 --GEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLG-LGT 557

Query: 688 NLYHYSKEVVDIMV-MTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKF 746
           N+Y+  +  +     M G +  +  E+  D         A   PQ K  ++E L +R   
Sbjct: 558 NIYNAERLGLGGGGDMPGSELADFVENA-DGF-------AEVFPQHKYNVVEILQQRGYL 609

Query: 747 CAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDN 806
            AMTGDGVND+PSLK A+ GIA+    +D A+ A+DIV      ++I++A++  R++   
Sbjct: 610 VAMTGDGVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHR 668

Query: 807 IQKFVLQLLAENVAQALYLIVGLAFQDK 834
           +  +V+  +A ++   ++L + +A  ++
Sbjct: 669 MYSYVVYRIALSLHLEIFLGLWIAILNR 696

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score =  115 bits (288), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 93/354 (26%), Positives = 157/354 (44%), Gaps = 50/354 (14%)

Query: 25  LVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAXXXXXXXXXXXXFAI 84
           L TD S G++ +E   R  + G N + D+ K       +                    +
Sbjct: 80  LQTDPSYGLTSDEVLKRRKKYGLNQMADE-KESLVVKFVMFFVGPIQFVMEAAAILAAGL 138

Query: 85  RDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTXXXX 144
            DW+  GVIC ++ +N  +G +QE++A   ++ L+   +  A VIR+G    + +     
Sbjct: 139 SDWVDFGVICGLLMLNAGVGFVQEFQAGSIVDELKKTLANTAVVIRDGQLVEIPANEVVP 198

Query: 145 XXXXXXXXXXTIPADLRLVSQQNF-ETDEALLTGESLPVSKDANEIFDDETPVGDRINLA 203
                      IP D R+V++  F + D++ +TGESL V K     + D+T         
Sbjct: 199 GDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESLAVDKH----YGDQT--------- 245

Query: 204 FSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTVGA 263
           FSSSTV +G    +   TG NT +G+ A                               A
Sbjct: 246 FSSSTVKRGEGFMVVTATGDNTFVGRAA-------------------------------A 274

Query: 264 FLGTTQGTPLH--RKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAI--YAVCVALSMI 319
            +    G   H    L+ + ++L  + +   ++V  +  +  +  V I  Y + + +  +
Sbjct: 275 LVNKAAGGQGHFTEVLNGIGIILLVLVIATLLLVWTACFYRTNGIVRILRYTLGITIIGV 334

Query: 320 PSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM 373
           P  L  V+T TM+VGAA +A +  I++KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 335 PVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 388

 Score =  108 bits (271), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 91/320 (28%), Positives = 148/320 (46%), Gaps = 44/320 (13%)

Query: 517 ATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCT--HWYGRDP 574
           A  A  K++     PFD   K++++V ES + +   +  KGA   VL      H    D 
Sbjct: 436 AKDALTKYKVLEFHPFDPVSKKVTAVVESPEGERI-VCVKGAPLFVLKTVEEDHPIPEDV 494

Query: 575 NXXXXXXXXXXXXIKENIDSMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGL 634
           +             +  +  ++S G R L  A K                      E   
Sbjct: 495 HENY----------ENKVAELASRGFRALGVARKR--------------------GEGHW 524

Query: 635 TFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSK 694
             LG++   DPPR++TA  V +    G+ V+MLTGD  G AK   +++G L TN+Y+  +
Sbjct: 525 EILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAER 583

Query: 695 EVVDIMV-MTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDG 753
             +     M G +  +  E+  D         A   PQ K R++E L  R    AMTGDG
Sbjct: 584 LGLGGGGDMPGSELADFVENA-DGF-------AEVFPQHKYRVVEILQNRGYLVAMTGDG 635

Query: 754 VNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQ 813
           VND+PSLK A+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+ 
Sbjct: 636 VNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVY 694

Query: 814 LLAENVAQALYLIVGLAFQD 833
            +A ++   ++L + +A  D
Sbjct: 695 RIALSLHLEIFLGLWIAILD 714

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score =  113 bits (283), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 93/354 (26%), Positives = 157/354 (44%), Gaps = 50/354 (14%)

Query: 25  LVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAXXXXXXXXXXXXFAI 84
           L TD + G++ +E   R  + G N + ++ +      L+                    +
Sbjct: 109 LSTDPAYGLTSDEVARRRKKYGLNQMAEENESLIVKFLMF-FVGPIQFVMEAAAILAAGL 167

Query: 85  RDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTXXXX 144
            DW+  GVIC ++ +N  +G IQE++A   ++ L+   +  A VIR+G    + +     
Sbjct: 168 SDWVDVGVICALLLLNASVGFIQEFQAGSIVDELKKTLANTATVIRDGQLIEIPANEVVP 227

Query: 145 XXXXXXXXXXTIPADLRLVSQQNF-ETDEALLTGESLPVSKDANEIFDDETPVGDRINLA 203
                       PAD R+V++  F + D++ +TGESL   K     + DE          
Sbjct: 228 GEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAAEKH----YGDEV--------- 274

Query: 204 FSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTVGA 263
           FSSSTV  G A  +   TG NT +G+ A                               A
Sbjct: 275 FSSSTVKTGEAFMVVTATGDNTFVGRAA-------------------------------A 303

Query: 264 FLGTTQGTPLH--RKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAI--YAVCVALSMI 319
            +G   G   H    L+ + ++L  + +   ++V  +  +     V+I  Y + + +  +
Sbjct: 304 LVGQASGVEGHFTEVLNGIGIILLVLVIATLLLVWTACFYRTVGIVSILRYTLGITIIGV 363

Query: 320 PSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM 373
           P  L  V+T TM+VGAA +A +  I++KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 364 PVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 417

 Score =  106 bits (264), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 87/312 (27%), Positives = 144/312 (46%), Gaps = 44/312 (14%)

Query: 517 ATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCT--HWYGRDP 574
           A  A  K++     PFD   K++++V ES + +   +  KGA   VL      H    D 
Sbjct: 465 AKDALTKYKVLEFHPFDPVSKKVTAVVESPEGERI-VCVKGAPLFVLKTVEEDHPIPEDV 523

Query: 575 NXXXXXXXXXXXXIKENIDSMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGL 634
           +             +  +  ++S G R L  A                    R   E   
Sbjct: 524 HENY----------ENKVAELASRGFRALGVA--------------------RKRGEGHW 553

Query: 635 TFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSK 694
             LG++   DPPR++TA  + +    G+ ++MLTGD  G AK   +++G L TN+Y+  +
Sbjct: 554 EILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLG-LGTNIYNAER 612

Query: 695 EVVDIMV-MTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDG 753
             +     M G +  +  E+  D         A   PQ K R++E L  R    AMTGDG
Sbjct: 613 LGLGGGGDMPGSELADFVENA-DGF-------AEVFPQHKYRVVEILQNRGYLVAMTGDG 664

Query: 754 VNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQ 813
           VND+PSLK A+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+ 
Sbjct: 665 VNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVY 723

Query: 814 LLAENVAQALYL 825
            +A ++   ++L
Sbjct: 724 RIALSLHLEIFL 735

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score =  111 bits (278), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 102/357 (28%), Positives = 164/357 (45%), Gaps = 56/357 (15%)

Query: 25  LVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQI---CNAXXXXXXXXXXXX 81
           L TD S G++ +E   R  + G N + D+     ++M++  +                  
Sbjct: 64  LQTDPSYGLTSDEVAHRRKKYGLNQMADE----RESMIVKFVMFFVGPIQFVMEAAAILA 119

Query: 82  FAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTX 141
             + DW+  GVIC ++ +N  +G IQE++A   ++ L+   +  A VIR+G    V +  
Sbjct: 120 AGLSDWVDFGVICGLLMLNACVGFIQEFQAGSIVDELKKTLANVAVVIRDGQLVEVPANE 179

Query: 142 XXXXXXXXXXXXXTIPADLRLVSQQNF-ETDEALLTGESLPVSKDANEIFDDETPVGDRI 200
                         IPAD RLV++  F + D++ +TGESL V K     + D+T      
Sbjct: 180 VVPGDILQLEDGTIIPADGRLVTENCFLQVDQSAITGESLAVDKG----YGDQT------ 229

Query: 201 NLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRT 260
              FSSSTV +G A  +   TG NT +G+ A                             
Sbjct: 230 ---FSSSTVKRGEAFMVVTATGDNTFVGRAA----------------------------- 257

Query: 261 VGAFLGTTQGTPLH--RKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSM 318
             A +    G   H    L+ + +LL  + +V  + V A+  +  D  V I    + +++
Sbjct: 258 --ALVNKASGGQGHFTEVLNGIGILLLVLVIVTLLGVWAACFYRTDNIVKILRFTLGITI 315

Query: 319 I--PSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM 373
           I  P  L  V+T TM+VGAA +A +  I++KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 316 IGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 372

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 90/312 (28%), Positives = 145/312 (46%), Gaps = 44/312 (14%)

Query: 517 ATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCT--HWYGRDP 574
           A  A  K++     PFD   K++++V ES + +   +  KGA   VL      H    D 
Sbjct: 420 AKDALTKYKVIEFHPFDPVSKKVTAVVESPEGERI-VCVKGAPLFVLKTVEEDHPIPEDV 478

Query: 575 NXXXXXXXXXXXXIKENIDSMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGL 634
           +             +  +  ++S G R L  A K                      E   
Sbjct: 479 HENY----------ENKVAELASRGFRALGVARKR--------------------GEGHW 508

Query: 635 TFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSK 694
             LG++   DPPR++TA  V +  + G+ V+MLTGD  G AK   +++G L TN+Y+  +
Sbjct: 509 EILGVMPCMDPPRDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAER 567

Query: 695 EVVDIMV-MTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDG 753
             +     M G +  +  E+  D         A   PQ K +++E L  R    AMTGDG
Sbjct: 568 LGLGGGGDMPGSELADFVENA-DGF-------AEVFPQHKYKVVEILQNRGYLVAMTGDG 619

Query: 754 VNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQ 813
           VND+PSLK A+ GIA+    SD A+ A+DIV      ++I++A++  R++   +  +V+ 
Sbjct: 620 VNDAPSLKKADTGIAVE-GASDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVY 678

Query: 814 LLAENVAQALYL 825
            +A ++   L+L
Sbjct: 679 RIALSLHLELFL 690

>Scas_710.41
          Length = 904

 Score =  111 bits (278), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 93/356 (26%), Positives = 161/356 (45%), Gaps = 50/356 (14%)

Query: 23  ARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAXXXXXXXXXXXXF 82
           ++L TD   G++ +E   R  + G N + ++ + ++    +                   
Sbjct: 65  SQLKTDPGIGLTTDEVVRRRKKYGLNQMKEENE-NFIVKFLMYFVGPIQFVMEAAAILAA 123

Query: 83  AIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTXX 142
            + DW+  GVIC ++ +N  +G IQE++A   +  L+   +  A VIR+G  + + +   
Sbjct: 124 GLSDWVDFGVICGLLMLNASVGFIQEFQAGSIVEELKKTLANTARVIRDGTLQEIPANEI 183

Query: 143 XXXXXXXXXXXXTIPADLRLVSQQNF-ETDEALLTGESLPVSKDANEIFDDETPVGDRIN 201
                        IPAD RLV++  F + D++ +TGESL V K+  ++            
Sbjct: 184 VPGDILELDEGTIIPADGRLVTENRFLQVDQSAITGESLAVDKNYGDV------------ 231

Query: 202 LAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTV 261
             FSSSTV  G +  +   TG NT +G+ A                              
Sbjct: 232 -TFSSSTVKTGTSVMVVTATGDNTFVGRAA------------------------------ 260

Query: 262 GAFLGTTQGTPLHRK--LSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMI 319
            A +G   G   H    L+ +  +L  + ++  ++V  +  +  D  V I    + +++I
Sbjct: 261 -ALVGEASGGQGHFTDILNDIGTILLVLVIITLLLVWTACFYRTDGIVMILRFTLGITII 319

Query: 320 --PSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM 373
             P  L  V+T TM+VGAA +A +  I++KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 320 GVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 375

 Score =  102 bits (253), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 84/329 (25%), Positives = 157/329 (47%), Gaps = 33/329 (10%)

Query: 590 ENIDSMSSEGLRVLAFANKSYP-KSDVNEEKLQKI--LKERDYAETGLT---------FL 637
           E I  +    L VL    + +P   DV+E    K+  L  R +   G+           L
Sbjct: 455 ETITCVKGAPLFVLKTVEEDHPVPEDVHENYENKVAELASRGFRSLGVARKRGEGYWEIL 514

Query: 638 GLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVV 697
           G++   DPPR++TA  + +    G+ V+MLTGD  G AK  ++++G L  N+Y+  K  +
Sbjct: 515 GVMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLG-LGVNIYNAEKLGL 573

Query: 698 DIMV-MTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVND 756
                M G +  +  E+  D         A   PQ K +++E L  R    AMTGDGVND
Sbjct: 574 GGGGDMPGSELADFVENA-DGF-------AEVFPQHKYKVVEILQNRGYLVAMTGDGVND 625

Query: 757 SPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLA 816
           +PSLK A+ GIA+    +D A+ A+DIV      ++I++ ++  R++   +  +V+  +A
Sbjct: 626 APSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDGLKTSRQIFHRMYSYVVYRIA 684

Query: 817 ENVAQALYLIVGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPP 876
            ++   ++  + +A  ++          +E++  I + +    + +  + A +  M  P 
Sbjct: 685 LSLHLEIFFGLWIAILNRS-------LNIELIVFIAIFADVATLAIAYDNAPYSQM--PV 735

Query: 877 NDSKAGIFTWEIIVDMFV-YGVWMAASCM 904
             +   ++   +++ +F+  G W+  + M
Sbjct: 736 KWNLPRLWGMSVVLGIFLAIGSWITLTTM 764

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score =  109 bits (273), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 92/325 (28%), Positives = 152/325 (46%), Gaps = 52/325 (16%)

Query: 517 ATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCC--THWYGRDP 574
           A AA  K++     PFD   K+++++ ES + +   +  KGA   VL      H    D 
Sbjct: 417 AKAALTKYKVLEFHPFDPVSKKVTAIVESPEGERI-VCVKGAPLFVLKTVEENHLIPED- 474

Query: 575 NXXXXXXXXXXXXIKEN----IDSMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYA 630
                        +KEN    +  ++S G R L  A K                      
Sbjct: 475 -------------VKENYENKVAELASRGYRALGVARKR--------------------G 501

Query: 631 ETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLY 690
           E     LG++   DPPR++TA  V +    G+ V+MLTGD  G AK   +++G L TN+Y
Sbjct: 502 EGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLG-LGTNIY 560

Query: 691 HYSKEVVDIMV-MTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAM 749
           +  +  +     M G +  +  E+  D         A   PQ K  ++E L +R    AM
Sbjct: 561 NAERLGLGGGGDMPGSELADFVENA-DGF-------AEVFPQHKYNVVEILQQRGYLVAM 612

Query: 750 TGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQK 809
           TGDGVND+PSLK A+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  
Sbjct: 613 TGDGVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYS 671

Query: 810 FVLQLLAENVAQALYLIVGLAFQDK 834
           +V+  +A ++   ++L + +A  ++
Sbjct: 672 YVVYRIALSLHLEIFLGLWIAILNQ 696

 Score =  106 bits (264), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 92/350 (26%), Positives = 159/350 (45%), Gaps = 42/350 (12%)

Query: 25  LVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAXXXXXXXXXXXXFAI 84
           L TD S G++ +E   R  + G N +  +A        +                    +
Sbjct: 61  LQTDPSYGLTSDEVSRRRKKYGLNQM-SEANESMILKFVMFFVGPIQFVMEAAAILAAGL 119

Query: 85  RDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTXXXX 144
            +WI  G+IC ++ +N  +G IQE++A   +  L+   + +A VIR+G+   + +     
Sbjct: 120 EEWIDFGIICALLLLNAAVGFIQEFQAGSIVEELKKTLANSAVVIRDGSLVEIPANEVVP 179

Query: 145 XXXXXXXXXXTIPADLRLVSQQNF-ETDEALLTGESLPVSKDANEIFDDETPVGDRINLA 203
                      IPAD R+V++  F + D++ +TGESL V K     + D T         
Sbjct: 180 GDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESLAVDKR----YGDAT--------- 226

Query: 204 FSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTVGA 263
           FSSSTV +G    I   TG +T +G+ A        L+++  A + +    ++       
Sbjct: 227 FSSSTVKRGEGFMIVTATGDSTFVGRAAA-------LVNKASAGSGHFTEVLNG------ 273

Query: 264 FLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMIPSSL 323
            +GT     +   L  + V  F+ ++    ++              Y + + +  +P  L
Sbjct: 274 -IGTILLILVILTLLVVYVACFYRSIDIVTILR-------------YTLAITVVGVPVGL 319

Query: 324 VVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM 373
             V+T TM+VGAA +A +  I++KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 320 PAVVTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 369

>Kwal_47.17522
          Length = 899

 Score =  108 bits (270), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 100/352 (28%), Positives = 162/352 (46%), Gaps = 46/352 (13%)

Query: 25  LVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAXXXXXXXXXXXXFAI 84
           L TD S G++ +E   R  + G N + ++++      L+  I                 +
Sbjct: 61  LQTDPSYGLTSDEVTKRRKKYGLNQMAEESESLVVKFLMFFI-GPIQFVMEAAAILAAGL 119

Query: 85  RDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTXXXX 144
            DW+  GVI  ++ +N  +G IQEY+A   ++ L+   + +A V+R+GN   + +     
Sbjct: 120 EDWVDFGVILGLLFLNAGVGFIQEYQAGSIVDELKKSLANSAVVVRDGNLVEIPANEVVP 179

Query: 145 XXXXXXXXXXTIPADLRLVSQQNF-ETDEALLTGESLPVSKDANEIFDDETPVGDRINLA 203
                      I AD RLV+++ F + D++ +TGESL V K     + D T         
Sbjct: 180 GDIMQLEDGVVICADGRLVTEECFLQIDQSAITGESLAVDKH----YGDTT--------- 226

Query: 204 FSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTVGA 263
           FSSSTV +G    I   TG NT +G+ A        L+++       Q  +      +G 
Sbjct: 227 FSSSTVKRGEGFMIVTATGDNTFVGRAAA-------LVNQAAGD---QGHFTEVLNGIGT 276

Query: 264 FLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAI--YAVCVALSMIPS 321
                    +   L  + +LL W A  +            DR V I  Y + + +  +P 
Sbjct: 277 ---------ILLVLVIVTLLLVWTACFY----------RTDRIVRILRYTLGITIIGVPV 317

Query: 322 SLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM 373
            L  V+T TM+VGAA +A +  I++KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 318 GLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 369

 Score =  106 bits (264), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 90/321 (28%), Positives = 150/321 (46%), Gaps = 44/321 (13%)

Query: 517 ATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCT--HWYGRDP 574
           A  A  K++     PFD   K++++V ES + +   I  KGA   VL      H    D 
Sbjct: 417 AKNALTKYKVLDFHPFDPVSKKVTAVVESPEGERI-ICVKGAPLFVLKTVEEDHPIPEDV 475

Query: 575 NXXXXXXXXXXXXIKENIDSMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGL 634
           +             +  +  ++S G R L  A K                      E   
Sbjct: 476 HENY----------ENKVAELASRGFRALGVARKR--------------------GEGHW 505

Query: 635 TFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSK 694
             LG++   DPPR++TA  V +  + G+ V+MLTGD  G AK   +++G L TN+Y+  +
Sbjct: 506 EILGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAER 564

Query: 695 EVVDIMV-MTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDG 753
             +     M G +  +  E+  D         A   PQ K  ++E L +R    AMTGDG
Sbjct: 565 LGLGGGGDMPGSELADFVENA-DGF-------AEVFPQHKYSVVEILQQRGYLVAMTGDG 616

Query: 754 VNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQ 813
           VND+PSLK A+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+ 
Sbjct: 617 VNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVY 675

Query: 814 LLAENVAQALYLIVGLAFQDK 834
            +A ++   ++L + +A  ++
Sbjct: 676 RIALSLHLEIFLGLWIAILNQ 696

>Scas_688.1
          Length = 913

 Score =  103 bits (258), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 92/316 (29%), Positives = 145/316 (45%), Gaps = 52/316 (16%)

Query: 517 ATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCT--HWYGRDP 574
           A  A  K++     PFD   K++++V ES + +   I  KGA   VL      H    D 
Sbjct: 431 AKNALTKYKVLEFHPFDPVSKKVTAVVESPEGERI-ICVKGAPLFVLKTVEEDHPIPED- 488

Query: 575 NXXXXXXXXXXXXIKEN----IDSMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYA 630
                        I EN    +  ++S G R L  A K                      
Sbjct: 489 -------------IHENYENKVAELASRGFRALGVARKR--------------------G 515

Query: 631 ETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLY 690
           E     LG++   DPPR++T   V +  + G+ V+MLTGD  G AK   +++G L TN+Y
Sbjct: 516 EGHWEILGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNVY 574

Query: 691 HYSK-EVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAM 749
           +  +  +     M G +  +  E+  D         A   PQ K R++E L  R    AM
Sbjct: 575 NAERLGLSGGGDMPGSELADFVENA-DGF-------AEVFPQDKYRVVEILQTRGYLVAM 626

Query: 750 TGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQK 809
           TGDGVND+PSLK A+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  
Sbjct: 627 TGDGVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYS 685

Query: 810 FVLQLLAENVAQALYL 825
           +V+  +A ++   ++L
Sbjct: 686 YVVYRIALSIHLEIFL 701

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 94/208 (45%), Gaps = 15/208 (7%)

Query: 25  LVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAXXXXXXXXXXXXFAI 84
           L TD + G+S +E   R  + G N + ++ +       I                    +
Sbjct: 75  LQTDPAYGLSSDEVARRRKKYGLNQMSEENE-SLVVKFIMFFVGPIQFVMEAAAILAAGL 133

Query: 85  RDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTXXXX 144
            DW+  GVIC ++ +N  +G +QE++A   +  L+   + +A VIR+G    V +     
Sbjct: 134 SDWVDFGVICGLLLLNAGVGFVQEFQAGSIVEELKKTLANSAIVIRDGQLVEVPANEVVP 193

Query: 145 XXXXXXXXXXTIPADLRLVSQQNF-ETDEALLTGESLPVSKDANEIFDDETPVGDRINLA 203
                      IPAD R+V++  F + D++ +TGESL   K     + D+T         
Sbjct: 194 GDILQLEDGVIIPADGRIVTEDCFVQIDQSAITGESLAADKH----YGDQT--------- 240

Query: 204 FSSSTVVKGRAQGIAIKTGLNTEIGKIA 231
           FSSSTV +G A  +   TG NT +G+ A
Sbjct: 241 FSSSTVKRGEAFMVITATGDNTFVGRAA 268

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 44/64 (68%)

Query: 310 YAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLT 369
           Y + + +  +P  L  V+T TM+VGAA +A +  I++KL ++E+L  V  +CSDKTGTLT
Sbjct: 320 YTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLT 379

Query: 370 QGKM 373
           + K+
Sbjct: 380 KNKL 383

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the
           Drs2p-like ATPases family in the superfamily of P-type
           ATPases, overproduction confers neomycin resistance
           [3456 bp, 1151 aa]
          Length = 1151

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 146/611 (23%), Positives = 238/611 (38%), Gaps = 124/611 (20%)

Query: 317 SMIPSSLVVVLTITMSVGAAVMASRNVI----IRKLDSLEALGAVNDICSDKTGTLTQGK 372
           ++IP SL V L +  SV A  +     I    +R     E LG +  + SDKTGTLTQ  
Sbjct: 453 TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 512

Query: 373 MIAKQIWVPKFGTLQVVGSNEPLNPEKGDI--NFIPNLSPYEYSHNETEDVGIMQNFKDK 430
           M  K+I     GT+           E  DI  +++ +L   +        V +    KD 
Sbjct: 513 MQLKKI---HLGTVSYTS-------ETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKD- 561

Query: 431 YEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFATRMDLP 490
                      +++ D  L  A   N+   F D E     A   P EIAI  F   + L 
Sbjct: 562 ---------MSFRVRDMILTLAICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGLS 610

Query: 491 RHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKT 550
                 +RD         S+SL   + +     +     FPF+S  KRM  +        
Sbjct: 611 LF----KRD-------RHSISLLH-EHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDE 658

Query: 551 YEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFANKSY 610
           Y    KGA                +            ++E   +M+ EGLR L    K  
Sbjct: 659 YWFMQKGA----------------DTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKL 702

Query: 611 PKS-------DVNEEKLQKILKERD-------YAETGLTFLGLIGIYDPPREETAGAVKK 656
            K        + N+  L  + +++        Y E  L  LGL G+ D  +++   +++ 
Sbjct: 703 NKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIEL 762

Query: 657 FHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVD------------------ 698
              AGI + MLTGD   TA+ ++    ++    Y ++   V                   
Sbjct: 763 LRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNA 822

Query: 699 IMVMTGKQ----FDNLSEDEIDNLPVLPLVIA-RCSPQTKVRMIEALHRR--EKFCAMTG 751
            +++ G+       +  ++  D +  LP VIA RC+PQ K  +   + +   ++ C + G
Sbjct: 823 CLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCI-G 881

Query: 752 DGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVE----EGR---RMS 804
           DG ND   ++ A+VG+  GI G +  K AS  + +D +     +  E     GR   + S
Sbjct: 882 DGGNDVSMIQCADVGV--GIVGKE-GKQAS--LAADFSITQFCHLTELLLWHGRNSYKRS 936

Query: 805 DNIQKFVLQL-LAENVAQALYLIVGLAFQDKEGKSVFPLAPVEVLWIIVVTSCF---PAM 860
             + +FV+   L   + QA+Y I  L F+        P+A  +   ++   +C+   P  
Sbjct: 937 AKLAQFVMHRGLIIAICQAVYSICSL-FE--------PIALYQGWLMVGYATCYTMAPVF 987

Query: 861 GLGLEKAAHDL 871
            L L+   HD+
Sbjct: 988 SLTLD---HDI 995

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 90/413 (21%), Positives = 177/413 (42%), Gaps = 74/413 (17%)

Query: 530  FPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIK 589
            F F S ++RMS + +  +   Y  YTKGA E +++ C                       
Sbjct: 920  FEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICN-------------PATLPSDYD 966

Query: 590  ENIDSMSSEGLRVLAFANKSYPKSD-VNEEKLQKILKERDYAETGLTFLGLIGIYDPPRE 648
            + ++  +  G RV+A A K+ PK+  +  +K++     R+  E+ + FLG I   +  ++
Sbjct: 967  DILNFYTHSGYRVIACAGKTLPKNTWLYSQKVR-----REEVESNMEFLGFIIFQNKLKD 1021

Query: 649  ETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGIL-------PTNLY---------HY 692
             T+  + K   A I   M TGD   TA ++ +E  ++       PT  Y         H+
Sbjct: 1022 ATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHW 1081

Query: 693  -----SKEVVDI--------------MVMTGKQF-------DNLSEDEIDNLPVLPLVIA 726
                 ++ ++D               + +TG+ F       DN SE+ ++ + +   + A
Sbjct: 1082 NEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFA 1141

Query: 727  RCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLS 786
            R SP  K  ++E L + +      GDG ND  +LK A+VGI++    + VA   +  +  
Sbjct: 1142 RMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF- 1200

Query: 787  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPLAPVE 846
              +   +L+ ++EGR  +  +  F         +   ++ + + +        F    ++
Sbjct: 1201 --DITCVLDVIKEGR--ASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLYID 1256

Query: 847  VLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWM 899
            +L II +     A+ +   K  H+L  + P+   A + + +I+V + +  V++
Sbjct: 1257 LLLIIPI-----AVTMSWSKPYHELAKKRPS---ANLVSPKILVPLILDIVFL 1301

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/316 (20%), Positives = 133/316 (42%), Gaps = 74/316 (23%)

Query: 87  WITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTXXXXXX 146
           +   G I  +  ++++  LI+  K S+T+  +   +     V+R G    + S+      
Sbjct: 503 YYYAGCIFLISLLSILDTLIETKKISRTLAEMSHFNC-EVRVLREGFWSSIHSSEL---- 557

Query: 147 XXXXXXXXTIPADLRLVSQQNFE--------------TDEALLTGESLPVSK-DANE--- 188
                    +P D+  +S  N                 +E++LTGES+PVSK  A+E   
Sbjct: 558 ---------VPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSKYPASEETI 608

Query: 189 --IFDD--ETPVGDRI--NLAFSSSTVVKGR-------AQGIAIKTGLNTEIGKIAKSLR 235
             +FDD   T +   +  +  F+ +T+++ +       A  +A++TG +T  G + +S+ 
Sbjct: 609 LQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTKGSLIRSM- 667

Query: 236 GGNELISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVV 295
               +  +     +Y +++                    + +  +A++ F+    F+I  
Sbjct: 668 ----VFPKPSGFKFYSDSF--------------------KYIGFMAIIAFF---GFSISC 700

Query: 296 MASQKFDVD-RGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEAL 354
           +   K  +D R + + A+ +   ++P +L   LTI  S     +  + +       +   
Sbjct: 701 INFIKLGLDKRTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIG 760

Query: 355 GAVNDICSDKTGTLTQ 370
           G ++ +C DKTGTLT+
Sbjct: 761 GKIDVMCFDKTGTLTE 776

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 161/688 (23%), Positives = 278/688 (40%), Gaps = 154/688 (22%)

Query: 255 ISTKRTVGAFLGTTQGTP----LHRKLSKLAVLLFWIAVVFAIVVMASQKF-------DV 303
           + T R     L TT+       L  +++ L+ +L     + +I+++A   F       D+
Sbjct: 388 VYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDI 447

Query: 304 DRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMAS----RNVIIRKLDSLEALGAVND 359
            R + +++     ++IP SL V L +  SV A  +       + I+R     E LG +  
Sbjct: 448 MRYLILFS-----TIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEY 502

Query: 360 ICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETE 419
           + SDKTGTLTQ  M  K+I     GT+                             NET 
Sbjct: 503 LLSDKTGTLTQNDMQLKKI---HLGTVSYT--------------------------NETM 533

Query: 420 DV--GIMQNFKDKYEGKSIPGNCQYQLFDKWLE-TASLA---NIASVFTDPETKEWKAHG 473
           D+    +Q+   +    S P   +  + D+ ++   +LA   N+   F D E     A  
Sbjct: 534 DIVTDFIQSMNSR-TSNSTPTTTRKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAA-- 590

Query: 474 DPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFD 533
            P EIAI  F   + L        RD         S+SL   D +    ++     FPF+
Sbjct: 591 SPDEIAIVKFTESVGLSLF----RRD-------RHSISLFH-DHSGMKLEYDIKILFPFN 638

Query: 534 STIKRMSSVYESRDYKTYEIYTKGAFESVLNCCT---HWYGRDPNXXXXXXXXXXXXIKE 590
           S  KRM  +   +  + Y    KGA ++V++       W                  ++E
Sbjct: 639 SDSKRMGVIIFDKLKQEYWFLQKGA-DTVMSSIVVRNDW------------------LEE 679

Query: 591 NIDSMSSEGLRVLAFANKSYP-------KSDVNEEKLQKILKE-------RDYAETGLTF 636
              +M++EGLR L    K          + + +E  L  + +E       R + E  L  
Sbjct: 680 ETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLEL 739

Query: 637 LGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEV 696
           LGL G+ D  +++   +++    AGI + MLTGD   TA+ ++    ++    Y ++   
Sbjct: 740 LGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTK 799

Query: 697 VD------------------IMVMTGKQ---FDNLSEDEIDNLPV-LPLVIA-RCSPQTK 733
           V+                   +++ G+    +     DE  ++ V LP V+A RC+PQ K
Sbjct: 800 VNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQK 859

Query: 734 VRMIEALHRR--EKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFA 791
             +   + +   ++ C + GDG ND   ++ A+VG+  GI G +  + +     S   F 
Sbjct: 860 ADVAVFIRQATGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKEGKQASLAADFSITQFC 916

Query: 792 SILNAVE-EGR---RMSDNIQKFVLQL-LAENVAQALYLIVGLAFQDKEGKSVFPLAPVE 846
            +   +   GR   + S  + +FV+   L  +V QA+Y I  + F+        PLA  +
Sbjct: 917 HLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSM-FE--------PLALYQ 967

Query: 847 VLWIIVVTSCF---PAMGLGLEKAAHDL 871
              ++   +C+   P   L L+   HD+
Sbjct: 968 GWLMVGYATCYTMAPVFSLTLD---HDI 992

>Scas_704.38
          Length = 1161

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 146/580 (25%), Positives = 225/580 (38%), Gaps = 112/580 (19%)

Query: 251 QNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIY 310
           + A  +T  TV   L   +   + + L      L  I VVFA    +    DV R + ++
Sbjct: 402 RQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILF 461

Query: 311 AVCVALSMIPSSLVVVLTITMSVGAAVMASRNVI----IRKLDSLEALGAVNDICSDKTG 366
           +     ++IP SL V L +  SV A  +   + I    +R     E LG +  + SDKTG
Sbjct: 462 S-----TIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTG 516

Query: 367 TLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQN 426
           TLTQ  M  K+I     GT  V  ++E L+     ++ + N S    S N +        
Sbjct: 517 TLTQNDMQLKKI---HLGT--VSYTSETLDIVSDYVDALVNSSN---SANPS-------- 560

Query: 427 FKDKYEGKSIPGNCQYQLF----DKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQV 482
                 GKS+P   +  L     D  +  A   N+   F D E     A   P EIAI  
Sbjct: 561 ------GKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAA--SPDEIAIVK 612

Query: 483 FATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSV 542
           F   + L       +RD         S+SL    + +    +     FPF+S  KRM  +
Sbjct: 613 FTESVGLSLF----KRD-------RHSISLLHGHSGSI-LTYEILQVFPFNSDSKRMGII 660

Query: 543 YESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGLRV 602
                   Y    KGA                +            ++E   +M+ EGLR 
Sbjct: 661 VHDEQKDEYWFMQKGA----------------DTVMARIVENNDWLEEETGNMAREGLRT 704

Query: 603 LAFANKSYP-------KSDVNEEKLQKILKERD-------YAETGLTFLGLIGIYDPPRE 648
           L    K          K D ++  L  + +++        Y E  L  LGL G+ D  + 
Sbjct: 705 LVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQN 764

Query: 649 ETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLY-HYSKEVVD--------- 698
           +   +++    AGI + MLTGD   TA+ ++    ++    Y H   ++           
Sbjct: 765 DVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLE 824

Query: 699 --------IMVMTGKQFDNL----SEDEIDNLPVLPLVIA-RCSPQTKVRMIEALHRRE- 744
                    +++ G+           +  D +  LP V+A RC+PQ K  +  AL  RE 
Sbjct: 825 YLKVNKGACLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADV--ALVIREF 882

Query: 745 ---KFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDAS 781
              + C + GDG ND   ++ A+VG+  GI G +  K AS
Sbjct: 883 TGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 918

>Scas_665.30
          Length = 1439

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/317 (23%), Positives = 135/317 (42%), Gaps = 66/317 (20%)

Query: 530  FPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIK 589
            F F S ++RMS + +  +   Y  +TKGA E +   C                      +
Sbjct: 708  FEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNK-------------ATLPANFE 754

Query: 590  ENIDSMSSEGLRVLAFANKSYPKSD-VNEEKLQKILKERDYAETGLTFLGLIGIYDPPRE 648
            E ++  + +G RV+A A +  P++  +  +K+      R+  E+ + FLG I   +  ++
Sbjct: 755  EMLNYYTHKGYRVIACAGRVLPRNTWLYSQKVS-----REEVESNMEFLGFIIFENKLKK 809

Query: 649  ETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPT-NLYHYSKEVVD--------- 698
            ETA  ++   +A I   M TGD   TA ++ ++  ++ +  +Y  S E +D         
Sbjct: 810  ETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIW 869

Query: 699  --------------------------IMVMTGKQF--------DNLSEDEIDNLPVLPLV 724
                                       + +TG  F        +++SED I+ + +   +
Sbjct: 870  RDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTI 929

Query: 725  IARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIV 784
             AR SP  K  ++E L R        GDG ND  +LK A+VGI++    + VA   +  V
Sbjct: 930  YARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQV 989

Query: 785  LSDDNFASILNAVEEGR 801
                + + +L+ ++EGR
Sbjct: 990  F---DISCVLDVIKEGR 1003

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 108/244 (44%), Gaps = 47/244 (19%)

Query: 157 PADLRLVSQQNFETDEALLTGESLPVSKDANE------IFDD--ETPVGDRI--NLAFSS 206
           P D  L+S      +E++LTGES+PVSK   E      + DD   T +   +  +  F+ 
Sbjct: 362 PCDSLLLSGDCI-VNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNG 420

Query: 207 STVVKGR-------AQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKR 259
           +T+++ R       A  + ++TG +T  G + +S+     +  +     +Y++++     
Sbjct: 421 TTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSM-----VFPKPTGFKFYEDSF----- 470

Query: 260 TVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMI 319
               ++G          ++ +A+  F I+ +  I +   ++  + R + I  + V     
Sbjct: 471 ---KYIGV---------MALIALFGFSISCIQFIKIGLDKRTMILRALDIITIVV----- 513

Query: 320 PSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM--IAKQ 377
           P +L   LTI      + +  + +       +   G ++ +C DKTGTLT+  +  +  Q
Sbjct: 514 PPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQ 573

Query: 378 IWVP 381
           + VP
Sbjct: 574 LCVP 577

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 140/553 (25%), Positives = 215/553 (38%), Gaps = 121/553 (21%)

Query: 280 LAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMA 339
           L++LL    VVFA +       D+ R + +++     ++IP SL V L +  SV A  + 
Sbjct: 419 LSILL----VVFAGLHNDDWYVDIMRYLILFS-----TIIPVSLRVNLDLAKSVYAHQIE 469

Query: 340 SRNVI----IRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPL 395
               I    +R     E LG +  + SDKTGTLTQ  M  K++ +           N   
Sbjct: 470 HDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHL----------GNVSY 519

Query: 396 NPEKGDINFIPNLSPYEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLA 455
             E  DI     +S Y     E+++  +  N   +   +    +    + D     A   
Sbjct: 520 TTETADI-----VSDYIQGMIESKNDSV-TNLGPRSTTRK---DAATHVIDLITTLAICH 570

Query: 456 NIASVFTDPETKEWKAHGDPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEK 515
           N+   F D E     A   P EIAI  F   + L   +   +R  M          L E 
Sbjct: 571 NVTPTFEDDELTYQAA--SPDEIAIVKFTESVGLS--LFKRDRHSMS--------LLHEH 618

Query: 516 DATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLN---CCTHWYGR 572
             T  N  +     FPF+S  KRM  +   +    Y    KGA ++V+N       W   
Sbjct: 619 SGTILN--YDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGA-DTVMNRIVANNDW--- 672

Query: 573 DPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFANKSYPKSDVNE-----EKLQKILKER 627
                          ++E   +M+ EGLR L    K   K    +     E++   +  R
Sbjct: 673 ---------------LEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNR 717

Query: 628 D---------YAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAI 678
           +         Y E  L  LGL G+ D  +++   +++    AGI + MLTGD   TA+ +
Sbjct: 718 EQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCV 777

Query: 679 AQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLS-------------------------ED 713
           +    ++    Y +   VV  +      F+ L                          ++
Sbjct: 778 SISAKLISRGQYVH---VVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQE 834

Query: 714 EIDNLPVLPLVIA-RCSPQTKVRMIEALHRRE----KFCAMTGDGVNDSPSLKMANVGIA 768
             D +  LP VIA RC+PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+ 
Sbjct: 835 FFDVVVHLPTVIACRCTPQQKADV--ALIIRELTGKRVCCI-GDGGNDVSMIQCADVGV- 890

Query: 769 MGINGSDVAKDAS 781
            GI G +  K AS
Sbjct: 891 -GIVGKE-GKQAS 901

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 145/575 (25%), Positives = 236/575 (41%), Gaps = 111/575 (19%)

Query: 257 TKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKF-DVDRGVAIYAVCVA 315
           T++ +   + + +   L  +++ L+ +L     V +IV++A   F + D  V I    + 
Sbjct: 387 TRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLIL 446

Query: 316 LS-MIPSSLVVVLTITMSVGAAVMASR----NVIIRKLDSLEALGAVNDICSDKTGTLTQ 370
            S +IP SL V L +  SV A  +       + I+R     E LG +  + SDKTGTLTQ
Sbjct: 447 FSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQ 506

Query: 371 GKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQNFKDK 430
             M  K++     GT+               ++ +  ++ Y      +     M     K
Sbjct: 507 NDMQLKKL---HLGTVSYT------------MDTMDIVTDYVQELVSSSTTTPMPQSTAK 551

Query: 431 YEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFATRMDLP 490
              K +P   +    D  +  A   N+   F D E     A   P EIAI  F   + L 
Sbjct: 552 ---KDLPNRVR----DLVVTLAICHNVTPTFEDGELTYQAA--SPDEIAIVKFTESVGLS 602

Query: 491 RHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKT 550
                 +RD         SVSL  + + A N ++     FPF+S  KRM  +        
Sbjct: 603 LF----KRD-------RHSVSLFHQHS-ATNFEYDILQVFPFNSDTKRMGII-------- 642

Query: 551 YEIYTKGAFESVLNCCTHWY-GRDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFANKS 609
             +Y K   E       HW+  +  +            + E + +M+ EGLR L    K 
Sbjct: 643 --VYDKVKGE-------HWFMQKGADTVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKK 693

Query: 610 Y-PKS---------DVN------EEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGA 653
             PKS         D +      +E +  ++K+  + E  L  LGL G+ D  + +   +
Sbjct: 694 LSPKSYEQFRKEYHDASLSMLNRDETMSSVIKK--HLEHNLELLGLTGVEDKLQNDVKSS 751

Query: 654 VKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYS-------------KEVVDI- 699
           ++    AG+ + MLTGD   TA+ ++    ++    Y ++              E + I 
Sbjct: 752 IELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKIN 811

Query: 700 ----MVMTGKQ---FDNLSEDEIDNLPV-LPLVIA-RCSPQTKVRMIEALHRRE----KF 746
               +++ G+    F    + E  ++ V LP VIA RC+PQ K  +  AL  RE    + 
Sbjct: 812 KSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADV--ALLIREITGKRV 869

Query: 747 CAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDAS 781
           C + GDG ND   ++ A+VG+  GI G +  K AS
Sbjct: 870 CCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 900

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 144/655 (21%), Positives = 263/655 (40%), Gaps = 140/655 (21%)

Query: 257  TKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIV-------VMASQKFDVD----R 305
            TK T  A     + T + R ++   V LF + +  +++       VM +QK ++     +
Sbjct: 420  TKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQ 479

Query: 306  GVAIYAV---------CVALSMIPSSLVVVLTITMSVGAAVMAS----------RNVIIR 346
            G  + A+          +  +++P SL V + +     A ++AS             ++R
Sbjct: 480  GTNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVR 539

Query: 347  KLDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIP 406
                +E LG +  I SDKTGTLTQ  M  K   +     +Q +       PE  D  F  
Sbjct: 540  TSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSI-------PEDKDAAF-- 590

Query: 407  NLSPYEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLAN-IASVFTDPE 465
                     +E  +VG  + + D +E    PG+    + D++L   S+ + +   F +  
Sbjct: 591  ---------DEGIEVG-YRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENG 640

Query: 466  TKEWKAHGDPTEIAIQVFATRMDL------PRHVLTGERDDMDEDEIMSSVSLSEKDATA 519
            + +++A   P E A+   A  +        P  V T  R+D+ E+ +   +++ E     
Sbjct: 641  SIKYQA-ASPDEGALVQGAADLGYKFIIRKPNSV-TILREDITEEVVYELLNICE----- 693

Query: 520  ANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXX 579
                        F+ST KRMS+++   D  +  +  KGA   +L                
Sbjct: 694  ------------FNSTRKRMSAIFRFPD-NSIRLLCKGADTVILE-----------RLAA 729

Query: 580  XXXXXXXXIKENIDSMSSEGLRVLAFANKSYPKSDVNE-------------EKLQKILKE 626
                       +++  ++EGLR L  A+++ P+S+  E              + +++ K 
Sbjct: 730  TSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKV 789

Query: 627  RDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTA-------KAIA 679
             +  E GL  LG   I D  ++     +    QAGI V +LTGD   TA       K ++
Sbjct: 790  AEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLS 849

Query: 680  QEVGIL-------------------PTNLYHYSKEVVDIM--VMTGKQFDNLSEDEIDNL 718
            +++ +L                     N +  S++ ++ +  V+ GK      E +++  
Sbjct: 850  EDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEF 909

Query: 719  PVL------PLVIARCSPQTKVRMIEALHRREKFCAMT-GDGVNDSPSLKMANVGIAM-G 770
             +        ++  R SP  K  +++ + RR K   +  GDG ND   ++ A+VG+ + G
Sbjct: 910  LLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISG 969

Query: 771  INGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYL 825
            + G   A+ A D  L    +   L  V  G      I + +L    +N+  ALY+
Sbjct: 970  MEGMQAARSA-DFALGQFKYLKKLLLV-HGSWSYQRISQAILYSFYKNI--ALYM 1020

>Kwal_26.9207
          Length = 1469

 Score = 79.7 bits (195), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 149/724 (20%), Positives = 277/724 (38%), Gaps = 160/724 (22%)

Query: 155  TIPADLRLVSQQNFETDEALLTGESLPVSK------DANEIFDD--ETPVGDRI--NLAF 204
            T P D  L+S      +E++LTGES+PVSK         ++ +D  +T + + +  +  F
Sbjct: 590  TFPCDSLLLSGDCI-VNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSFLF 648

Query: 205  SSSTVVKGRAQG-------IAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWIST 257
            + + +++ R  G       + ++TG +T  G + +S+     +  +     +Y++++   
Sbjct: 649  NGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSM-----IFPKPSGFKFYEDSF--- 700

Query: 258  KRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALS 317
                  ++G          ++ +A+  F I+ +  I +  + K  + R + I  + V   
Sbjct: 701  -----KYIGF---------MTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVV--- 743

Query: 318  MIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQ 377
              P +L   L+I  S   A +  + +       +   G ++ +C DKTGTLT+  +    
Sbjct: 744  --PPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLG 801

Query: 378  IWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQNFKDKYEGKSIP 437
            + V +    Q       +   +G  N        +YS N   D G   +FK +       
Sbjct: 802  VHVAEPQGHQNFRFGALITNVRGLFN--------KYSLN---DCGSPIDFKSR------- 843

Query: 438  GNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFAT------RMDLPR 491
                       L   SL  +          + +  GDP +  +  F          D   
Sbjct: 844  -----NFLVSLLTCHSLRVV----------DGELLGDPLDFKMFQFTNWSYAEDFQDFKF 888

Query: 492  HVLTGERDD---MDEDEIMSSVSLSEKDATAANAKFRH---------AAEFPFDSTIKRM 539
            H L  ER++   + E+  ++  ++   +A +   KF              F F S ++RM
Sbjct: 889  HSLNEERNNKSTLPENAGIAP-AVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRM 947

Query: 540  SSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEG 599
            S + +      +  +TKGA E +   C                      ++ +   +  G
Sbjct: 948  SVIVKPYGENVFWGFTKGAPEVISEICNK-------------STLPANYEQILQQYTHNG 994

Query: 600  LRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQ 659
             RV+A A K+ PK        QK+   R+  E+ + FLG +   +  +  T   +     
Sbjct: 995  YRVIACAGKTLPKR--TWRFAQKV--SREEVESNMEFLGFVVFENKLKPSTTPTLASLQD 1050

Query: 660  AGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIM------------------- 700
            AGI   M TGD   TA ++ +E G++ T  + +  ++ D M                   
Sbjct: 1051 AGIRSIMCTGDNVLTAISVGRESGLI-TESHVFVPQINDNMDPNEDLIIWRDVDDCDLIL 1109

Query: 701  ----------------VMTGKQF-------DNLSEDEIDNLPVLPLVIARCSPQTKVRMI 737
                             +TG  F       + L E  I+ + +   + AR SP  K  ++
Sbjct: 1110 DGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELV 1169

Query: 738  EALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAV 797
              L   +      GDG ND  +LK A+VG+++    + VA   +  V      + IL+ +
Sbjct: 1170 GQLQGLDYVVGFCGDGANDCGALKAADVGVSLSEAEASVAAPFTSSVF---EISCILDVI 1226

Query: 798  EEGR 801
            +EGR
Sbjct: 1227 KEGR 1230

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 130/315 (41%), Gaps = 64/315 (20%)

Query: 530  FPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIK 589
            F F S ++RMS + +     TY  +TKGA E + + C                       
Sbjct: 907  FEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICN-------------PATIPKDFH 953

Query: 590  ENIDSMSSEGLRVLAFANKSYPKSD-VNEEKLQKILKERDYAETGLTFLGLIGIYDPPRE 648
            E +   +  G R++A A K+ PKS  +  +K+      R+  E  L FLG I   +  + 
Sbjct: 954  ELLHHYTHNGFRIIACAGKTLPKSSWLYSQKVS-----REEVEDNLEFLGFIVFENKLKS 1008

Query: 649  ETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPT----------NL----YHYSK 694
             T  A+K+   A I   M TGD   TA ++ ++ G++ +          NL    +  S 
Sbjct: 1009 RTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSW 1068

Query: 695  EVVD---------------------IMVMTGKQF-------DNLSEDEIDNLPVLPLVIA 726
              VD                      + +TG  F       + L +D I  + +   + A
Sbjct: 1069 RDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYA 1128

Query: 727  RCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLS 786
            R SP  K  ++E L + +      GDG ND  +LK AN+GI++    + VA   +  V  
Sbjct: 1129 RMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF- 1187

Query: 787  DDNFASILNAVEEGR 801
              + + +L+ ++EGR
Sbjct: 1188 --DISCVLDVIKEGR 1200

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 103/232 (44%), Gaps = 45/232 (19%)

Query: 156 IPADLRLVSQQNFETDEALLTGESLPVSKDA------NEIFDD--ETPVGDRI--NLAFS 205
           +P D  L+S      +E++LTGES+PVSK A       ++  D   + V   +  +  F+
Sbjct: 572 LPCDAVLISGDCI-VNESMLTGESVPVSKYAATEATMAQLLQDFKSSQVSSFVSKSFLFN 630

Query: 206 SSTVVKGR---AQGIA----IKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTK 258
            + +++ R    QG+A    I+TG +T  G + +S+     +  +     +Y++++    
Sbjct: 631 GTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSM-----VFPKPVGFKFYEDSF---- 681

Query: 259 RTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSM 318
                ++G          ++ +A+  F I+ +  I +    K  + R + I  + V    
Sbjct: 682 ----KYIGF---------MTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVV---- 724

Query: 319 IPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQ 370
            P +L   LTI  S     +  + +       +   G V+ +C DKTGTLT+
Sbjct: 725 -PPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTE 775

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH]
           (544854..548354) [3501 bp, 1166 aa]
          Length = 1166

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 147/621 (23%), Positives = 250/621 (40%), Gaps = 148/621 (23%)

Query: 277 LSK-LAVLLFWIAVVFAIVV-MASQKFDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVG 334
           LSK L + +F ++++  ++  +   K+ VD  +  Y +  + ++IP SL V L +  SV 
Sbjct: 431 LSKILCICVFTLSILLVVIGGLDDDKWYVD--IMRYLILFS-TIIPVSLRVNLDLGKSVY 487

Query: 335 AAVMASR----NVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVG 390
           A  + S     + I+R     E LG +  + SDKTGTLTQ  M  ++I     GT+    
Sbjct: 488 ARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKI---HLGTVSYT- 543

Query: 391 SNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQNFKDKYEGKSIPGN---CQYQLFDK 447
                      +  +  ++ Y  +     ++G          G ++ G+      ++ D 
Sbjct: 544 -----------METMDMVTDYIQTLTSPANMGA--------AGVAVTGSRKEVSQRVRDL 584

Query: 448 WLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFATRMDLP-----RHVLTGERDDMD 502
            +  A+  N+   F D E     A   P EIAI  F  R+ L      RH LT       
Sbjct: 585 VVTLATCHNVTPNFEDNELAYQAA--SPDEIAIVKFTERVGLSLFKRDRHSLT------- 635

Query: 503 EDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESV 562
                        + +  N ++     FPF S  KRM  +   R         KGA ++V
Sbjct: 636 ----------LFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGA-DTV 684

Query: 563 LNCCTH---WYGRDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFA------------N 607
           ++       W                  ++E + +M+ EGLR L  A            +
Sbjct: 685 MSKIVQSNDW------------------LEEEVSNMAREGLRTLVIARKKLSTRLYEQFS 726

Query: 608 KSYPKSDVN----EEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGIN 663
           K Y  + ++    +E + +++K   + E  L  LGL G+ D  +++   +++    AG+ 
Sbjct: 727 KEYKDASLSMLNRDEAMNEVVKR--HLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVK 784

Query: 664 VRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEI-------- 715
           + MLTGD   TA+ +     ++    Y      V  +    ++   LS  E         
Sbjct: 785 IWMLTGDKVETARCVCVSAKLISRGQY------VHTITKLTRRDGALSRLEYLKANRNSC 838

Query: 716 -----DNLPV---------------LPLVIA-RCSPQTKVRMIEALHRRE----KFCAMT 750
                D+L +               LP+VIA RC+PQ K  +  AL  RE    + C + 
Sbjct: 839 LLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADV--ALLIREMTGKRVCCI- 895

Query: 751 GDGVNDSPSLKMANVGIAM-GINGSDVAKDASDIVLSDDNFASILNAVEEGR---RMSDN 806
           GDG ND   ++ A+VG+ + G  G   +  A   +    +   +L  +  GR   + S  
Sbjct: 896 GDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLL--LWHGRNSYKRSAK 953

Query: 807 IQKFVLQL-LAENVAQALYLI 826
           + +FV+   L  +V QA+Y I
Sbjct: 954 LSQFVIHRGLLISVCQAVYSI 974

>Scas_583.14*
          Length = 875

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 85/315 (26%), Positives = 136/315 (43%), Gaps = 71/315 (22%)

Query: 521 NAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYT--KGAFESVLNCCTHWYGRDPNXXX 578
             K +    F F S +KR SSV   +D    +++T  KGA E++                
Sbjct: 225 TGKLQILRRFQFSSALKRSSSVASHKD----KLFTAVKGAPETI---------------- 264

Query: 579 XXXXXXXXXIKENID----SMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGL 634
                    + +N D    S +  G RVLA A+KS P  +++ ++L  +  +RD  ETGL
Sbjct: 265 ---RERLAVVPKNYDEIYKSFTRSGSRVLALASKSLP--NLSSKQLDDL--DRDEIETGL 317

Query: 635 TFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTN------ 688
           TF G +  + P + +    +K  +++     M+TGD P TA  +A+EV I+         
Sbjct: 318 TFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLILDK 377

Query: 689 ---------LYHYSKEVVDI-------------------MVMTGKQFDNLSED--EIDNL 718
                    L+   +E + I                   + +TG    NL ED  ++ +L
Sbjct: 378 SETVGDGKLLFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYAL-NLLEDHSQLKDL 436

Query: 719 PVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAK 778
                V AR SP  K  ++  L        M GDG ND  +LK A+VG+A+ +NG++ + 
Sbjct: 437 IRHTWVYARVSPSQKEFILNNLKEMGYQTLMCGDGTNDVGALKQAHVGVAL-LNGTEESM 495

Query: 779 DASDIVLSDDNFASI 793
            A      D+N  S+
Sbjct: 496 TAMAQKRRDENMKSM 510

>Kwal_23.5789
          Length = 1133

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 138/628 (21%), Positives = 242/628 (38%), Gaps = 122/628 (19%)

Query: 257 TKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKF-------DVDRGVAI 309
           T++ +   + + +   L  +++ L+ +L     + ++ ++A   F       D+ R + +
Sbjct: 377 TRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLIL 436

Query: 310 YAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVI----IRKLDSLEALGAVNDICSDKT 365
           ++     ++IP SL V L +  SV A  +   + I    +R     E LG +  + SDKT
Sbjct: 437 FS-----TIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKT 491

Query: 366 GTLTQGKMIAKQIWVPKFG----TLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDV 421
           GTLTQ  M  K++ +        T+ +V        +  + + +P+ S            
Sbjct: 492 GTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASK----------- 540

Query: 422 GIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQ 481
                       K +PG  +    D  L  A    +   F D E     A   P EIAI 
Sbjct: 541 ------------KDLPGRVR----DLVLTLALCHQVTPTFEDGELTYQAA--SPDEIAIV 582

Query: 482 VFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSS 541
            F   + L     T  R D     ++        D +  N ++     FPF+S  KRM  
Sbjct: 583 KFTESVGL-----TLFRRDRHSITLL-------HDQSGTNFEYDILHVFPFNSDNKRMGI 630

Query: 542 VYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGLR 601
           V   +    Y    KGA                +            ++E   +++ EGLR
Sbjct: 631 VIFDKQKDEYWFLQKGA----------------DVVMSKIVQKNDWLEEETGNLAREGLR 674

Query: 602 VLAFANKSYPKS-------DVNEEKLQKILKE-------RDYAETGLTFLGLIGIYDPPR 647
            L    K   K        D  +  L  + +E         + E  L  LGL G+ D  +
Sbjct: 675 TLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQ 734

Query: 648 EETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVD--------- 698
           E+   +++    AGI + MLTGD   TA+ ++    ++    Y ++   V+         
Sbjct: 735 EDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHL 794

Query: 699 ---------IMVMTGKQ----FDNLSEDEIDNLPVLPLVIA-RCSPQTKVRMIEALHR-- 742
                     +++ G+      +   +   + +  LP VIA RC+PQ K  +   +    
Sbjct: 795 ELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVT 854

Query: 743 REKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR- 801
            ++ C + GDG ND   ++ A+VG+ +       A  A+D  ++     S L  +  GR 
Sbjct: 855 GKRVCCI-GDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKL-LLWHGRN 912

Query: 802 --RMSDNIQKFVLQL-LAENVAQALYLI 826
             + S  + +FV+   L  +V QA+Y I
Sbjct: 913 SYKRSAKLAQFVIHRGLLISVCQAVYSI 940

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 73/323 (22%), Positives = 129/323 (39%), Gaps = 72/323 (22%)

Query: 530  FPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIK 589
            F F S ++RMS + ++ +   Y  +TKGA E +   C                      +
Sbjct: 932  FEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNK-------------STLPADFE 978

Query: 590  ENIDSMSSEGLRVLAFANKSYPKSD-VNEEKLQKILKERDYAETGLTFLGLIGIYDPPRE 648
            E +   +  G RV+A A K+ PK   +  +K+      R+  E+ L FLG I   +  ++
Sbjct: 979  EVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVS-----REEVESNLEFLGFIIFQNKLKK 1033

Query: 649  ETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGIL----------------------- 685
            ET+  +K    A I   M TGD   TA ++ +E G++                       
Sbjct: 1034 ETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVW 1093

Query: 686  ----------------PTNLYHYSKEVV-----------DIMVMTGKQFDNLSEDEIDNL 718
                            P  L + S E +           D+  +  +  + + E+ ++ +
Sbjct: 1094 RDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEI 1153

Query: 719  PVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAK 778
             +   + AR SP  K  ++  L + +      GDG ND  +LK A+VGI++    + VA 
Sbjct: 1154 LLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAA 1213

Query: 779  DASDIVLSDDNFASILNAVEEGR 801
              +  +    N + +L+ + EGR
Sbjct: 1214 PFTSKIF---NISCVLDVIREGR 1233

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 113/256 (44%), Gaps = 53/256 (20%)

Query: 156 IPADLRLVSQQNFETDEALLTGESLPVSK------DANEIFDD--ETPVGDRINLAF--S 205
           +P D  L+S      +E++LTGES+PVSK         ++ DD   T +   ++ +F  +
Sbjct: 585 LPCDSILLSSDCI-VNESMLTGESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYN 643

Query: 206 SSTVVKGR-------AQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTK 258
            + +++ R       A  + ++TG +T  G + +S+     +  +     +Y++++    
Sbjct: 644 GTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSM-----VFPKPTGFKFYRDSF---- 694

Query: 259 RTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSM 318
                ++G          +S +A+  F ++ V  I +   +K  + R + I  + V    
Sbjct: 695 ----KYIGF---------MSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVV---- 737

Query: 319 IPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM--IAK 376
            P +L   LTI  +   + +  + +       L   G ++ +C DKTGTLT+  +  +  
Sbjct: 738 -PPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGV 796

Query: 377 QIWVP------KFGTL 386
           QI  P      KFG L
Sbjct: 797 QISEPNGVRGQKFGEL 812

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 122/285 (42%), Gaps = 65/285 (22%)

Query: 530 FPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIK 589
           F F S +KR +S+    D     +  KGA E++    +                    I 
Sbjct: 580 FQFSSALKRSASIASHNDALFAAV--KGAPETIRERLSD-------------------IP 618

Query: 590 ENID----SMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDP 645
           +N D    S +  G RVLA A+KS PK  +++ K+  +   RD  E+ LTF G +  + P
Sbjct: 619 KNYDEIYKSFTRSGSRVLALASKSLPK--MSQSKIDDL--NRDDVESELTFNGFLIFHCP 674

Query: 646 PREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTN---------------LY 690
            +++    +K  +++     M+TGD P TA  +A+EVGI+                  L+
Sbjct: 675 LKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFGETLILDRAGKSDDNQLLF 734

Query: 691 HYSKEVVDI-------------------MVMTGKQFDNLS-EDEIDNLPVLPLVIARCSP 730
              +E V I                   + +TG   + L    ++ +L     V AR SP
Sbjct: 735 RDVEETVSIPFDPSKDTFDHSKLFDRYDIAVTGYALNALEGHSQLRDLLRHTWVYARVSP 794

Query: 731 QTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSD 775
             K  ++  L        M GDG ND  +LK A+VGIA+ +NG++
Sbjct: 795 SQKEFLLNTLKDMGYQTLMCGDGTNDVGALKQAHVGIAL-LNGTE 838

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 91/233 (39%), Gaps = 47/233 (20%)

Query: 156 IPADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDETPVG----DRINLAFSSSTVVK 211
           IP DL L+       +EA+L+GES P+ K++ ++   E  +     D+I +    +  ++
Sbjct: 289 IPCDLILLDGSAI-VNEAMLSGESTPLLKESIKLRPSEDNLQLDGVDKIAVLHGGTKALQ 347

Query: 212 ---------------GRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWIS 256
                          G A  I  KTG  T  G + + +    E +S D  +      ++ 
Sbjct: 348 VTPPEHKSDIPPPPDGGALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFILFLL 407

Query: 257 TKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVAL 316
               + ++    +GT + R  SKL                            +  + +  
Sbjct: 408 IFAVIASWYVWVEGTKMGRIQSKL---------------------------ILDCILIIT 440

Query: 317 SMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLT 369
           S++P  L + LT+ ++   A +A   V   +   +   G ++  C DKTGTLT
Sbjct: 441 SVVPPELPMELTMAVNSSLAALAKFYVYCTEPFRIPFAGRIDVCCFDKTGTLT 493

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 98/217 (45%), Gaps = 40/217 (18%)

Query: 594 SMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGA 653
           S +  G RVLA A K  PK  ++  ++  I  +RD  ETGLTF   +  + P +++    
Sbjct: 625 SFTRSGSRVLALAYKDLPK--MSNSQIDNI--DRDEIETGLTFGAFLVFHCPLKDDAIET 680

Query: 654 VKKFHQAGINVRMLTGDFPGTAKAIAQEVGIL---------PTNLYHYSKEVVDIMVMTG 704
           +K  +++     M+TGD P TA  +A+EVGI+         P +   ++  + D+     
Sbjct: 681 IKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDRETLILDEPIDGSSHALVMRDVNETIV 740

Query: 705 KQF----DNLSEDEI----------DNLPVL------------PLVIARCSPQTKVRMIE 738
           K F    D   E EI            L +L              + AR SP  K  ++ 
Sbjct: 741 KPFNPDADTFDEKEIFQKYDLAVTGHALKLLQGHKQLRDVIRHTWIYARVSPSQKEFILI 800

Query: 739 ALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSD 775
            L        M GDG ND  +LK A+VGIA+ +NG++
Sbjct: 801 TLKDMGYQTLMCGDGTNDVGALKQAHVGIAL-LNGTE 836

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 101/226 (44%), Gaps = 23/226 (10%)

Query: 156 IPADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDETPVGDRINL-AFSSSTVVKGRA 214
           IP DL L+       +EA+L+GES P+ K++ ++     P  D++ L     + V+ G  
Sbjct: 288 IPCDLLLIDGSCI-VNEAMLSGESTPLLKESIKL----RPANDQLQLDGVDKNAVLHGGT 342

Query: 215 QGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLH 274
           + + + T      G I     G   +++    KT ++ +  S  R +   + + +   + 
Sbjct: 343 KALQV-TAPENRTGVITPPDGGALAVVT----KTGFETSQGSLVRVM---IFSAERVDVG 394

Query: 275 RKLSKLAVLLFWIAVVFAIVVM------ASQKFDVDRGVAIYAVCVALSMIPSSLVVVLT 328
            K   L  +LF +  +FAIV         ++   +   + +  + +  S++P  L + LT
Sbjct: 395 NK-EALYFILFLL--IFAIVASWYVWKEGTRMGRIQSKLILDCILIITSVVPPELPMELT 451

Query: 329 ITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMI 374
           + ++   A ++   V   +   +   G ++  C DKTGTLT   ++
Sbjct: 452 MAVNSSLAALSKFYVYCTEPFRIPYAGRIDVCCFDKTGTLTAEDLV 497

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 98/219 (44%), Gaps = 44/219 (20%)

Query: 594 SMSSEGLRVLAFANKSYPKSDVNE-EKLQKILKERDYAETGLTFLGLIGIYDPPREETAG 652
           S +  G RVLA A+K  P   + + EKL     ER+  E+ L F G +  + P +++   
Sbjct: 628 SFTRAGSRVLALASKKLPSMSIKQIEKL-----EREAVESDLEFKGFLVFHCPLKDDAIE 682

Query: 653 AVKKFHQAGINVRMLTGDFPGTAKAIAQEVGIL--------------------------- 685
            +K  +++     M+TGD P TA  +A+EV I+                           
Sbjct: 683 TIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLILDEPIDGSSHALVFRNIEETI 742

Query: 686 --PTN----LYHYSKEVV--DIMVMTGKQFDNLS-EDEIDNLPVLPLVIARCSPQTKVRM 736
             P N     + +SK     DI V TG     LS   +++ L     V AR SP  K  +
Sbjct: 743 VNPFNPEKDTFEHSKLFAKYDIAV-TGHALQLLSGHSQLNELIRHTWVYARVSPAQKEFI 801

Query: 737 IEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSD 775
           + +L        M GDG ND  +LK A+VGIA+ +NG++
Sbjct: 802 MNSLKDMGYQTLMCGDGTNDVGALKQAHVGIAL-LNGTE 839

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 103/246 (41%), Gaps = 54/246 (21%)

Query: 171 DEALLTGESLPVSKDANEIFDDETPVG----DRINLAFSSSTVVK--------------- 211
           +EA+L+GES P+ K++ ++   E  +     D+ ++    + V++               
Sbjct: 303 NEAMLSGESTPLLKESVKLRSSEEKLQVEGLDKNSVLHGGTKVLQVTAPEKGSSSIPAPP 362

Query: 212 -GRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTVGAFLGTTQG 270
            G A  +  KTG  T  G + + +   +E +S    +  Y             F+     
Sbjct: 363 DGGALAVVSKTGFETSQGALVRVMIYSSERVSVGNKEALY-------------FI----- 404

Query: 271 TPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMIPSSLVVVLTIT 330
                    L +L+F IA  + + V  ++   V   + +  + +  S++PS L + LT+ 
Sbjct: 405 ---------LFLLIFAIAASWYVWVEGTRMGRVQSKLILDCILIITSVVPSELPMELTMA 455

Query: 331 MSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVG 390
           ++   AV++   V   +   +   G ++  C DKTGTLT   ++ +       G   + G
Sbjct: 456 VNNSLAVLSKFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLVFE-------GLAGLAG 508

Query: 391 SNEPLN 396
            N+P+N
Sbjct: 509 KNQPVN 514

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2 P-type
           amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 121/529 (22%), Positives = 215/529 (40%), Gaps = 115/529 (21%)

Query: 317 SMIPSSLVVVLTITMSVGAAVMAS----------RNVIIRKLDSLEALGAVNDICSDKTG 366
           +++P SL V + +     A ++ S             ++R    +E LG +  I SDKTG
Sbjct: 508 NLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTG 567

Query: 367 TLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKG-DINFIPNLSPYEYSHNETEDVGIMQ 425
           TLT+  M  K + +     ++ +  +     E G +I F          H+        +
Sbjct: 568 TLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGF----------HS-------FE 610

Query: 426 NFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETK-----EWKAHGDPTEIAI 480
           + KDK    + P + +  +  ++L    LA   +V   PET+     +++A   P E A+
Sbjct: 611 SLKDKM---TDPEDDEAGIVIEFLTL--LATCHTVI--PETQSDGTIKYQA-ASPDEGAL 662

Query: 481 QVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMS 540
              A  +        G R D+      +SVS+S   +     +  +  EF  +ST KRMS
Sbjct: 663 VQGAADL--------GFRFDIRRP---NSVSISTPFSEQLEYQLLNICEF--NSTRKRMS 709

Query: 541 SVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGL 600
           +++   D  + +++ KGA   +L      +  +P                +++  ++EGL
Sbjct: 710 AIFRMPD-GSIKLFCKGADTVILERLDSEF--NPYVQSTL---------RHLEDYAAEGL 757

Query: 601 RVLAFANKSYPKSDVNE-----EKLQKILKER--------DYAETGLTFLGLIGIYDPPR 647
           R L  A+++ P+ +  E     E     +K+R        +  E  L FLG   I D  +
Sbjct: 758 RTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQ 817

Query: 648 EETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILP-----------------TNL- 689
           E     +    +AG+ V +LTGD   TA  I     +L                  TNL 
Sbjct: 818 EGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQ 877

Query: 690 --------YHYSKEVVD--IMVMTGKQFD-NLSEDEIDNLPVL-----PLVIARCSPQTK 733
                   +  S++ ++   +V+ GK     L ED  D    +      ++  R SP  K
Sbjct: 878 SKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQK 937

Query: 734 VRMIEALHRREKFCAMT-GDGVNDSPSLKMANVGIAM-GINGSDVAKDA 780
             +++ + R+     +  GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 938 ALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 986

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/315 (22%), Positives = 124/315 (39%), Gaps = 63/315 (20%)

Query: 530  FPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIK 589
            F F S ++RMS + +      +  +TKGA E +   C+                     +
Sbjct: 916  FEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSK-------------QTLPLDYE 962

Query: 590  ENIDSMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREE 649
              +   +  G RV+A A K   +    +  L      R+  E+ L FLG I   +  +  
Sbjct: 963  ALLHHYTHNGYRVIACAGKKLTR----QSWLYSQKVSREEIESNLEFLGFIIFENKLKGT 1018

Query: 650  TAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPT---------------------- 687
            T   ++  H+A I   M TGD   TA ++ +E G++ +                      
Sbjct: 1019 TKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITW 1078

Query: 688  -NLYHYSKEVVDI-------------MVMTGKQFDNLS-------EDEIDNLPVLPLVIA 726
             N+ + S  +  +             + +TG+ F  L        E+ I+N+ +   + A
Sbjct: 1079 QNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYA 1138

Query: 727  RCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLS 786
            R SP  K  ++E L          GDG ND  +LK A++GI++    + VA   +  +  
Sbjct: 1139 RMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF- 1197

Query: 787  DDNFASILNAVEEGR 801
                + +L+ ++EGR
Sbjct: 1198 --EISCVLDVMKEGR 1210

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 103/232 (44%), Gaps = 45/232 (19%)

Query: 156 IPADLRLVSQQNFETDEALLTGESLPVSKDAN------EIFDD--ETPVGDRI--NLAFS 205
           +P D  L+S      +E++LTGES+PVSK A       ++ DD  +T +   +  +  F+
Sbjct: 573 LPCDSILISGDCL-VNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFN 631

Query: 206 SSTVVKGRAQ-------GIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTK 258
            + +++ RA        G+  +TG +T  G + +S+     +  +     +Y++++    
Sbjct: 632 GTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSM-----VFPKPTGFKFYEDSF---- 682

Query: 259 RTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSM 318
                ++G          +S +A+  F ++ +  + +   ++  + R + I  V V    
Sbjct: 683 ----KYIG---------YISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVV---- 725

Query: 319 IPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQ 370
            P +L   L+I        +  + +       +   G ++ +C DKTGTLT+
Sbjct: 726 -PPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTE 776

>Scas_615.9
          Length = 942

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 70/160 (43%), Gaps = 37/160 (23%)

Query: 627 RDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILP 686
           + Y     T +G   I D  +E+ A  ++       ++ M+TGD  G A  +AQ+VGI  
Sbjct: 685 KSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAA 744

Query: 687 TNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRRE-K 745
            N+Y                                   +  +P  K  ++E+L      
Sbjct: 745 NNVY-----------------------------------SGVTPSGKCEIVESLQADSVG 769

Query: 746 FCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVL 785
             A  GDG+NDSP L  +++G+A+   G+D+A +A+DIV+
Sbjct: 770 GVAFVGDGINDSPVLVTSDIGVALS-TGTDIAMEAADIVV 808

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 119/303 (39%), Gaps = 57/303 (18%)

Query: 156 IPADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDETPVGDRINLAFSSSTVVKGRAQ 215
           IPAD  ++ Q   E DE+L+TGES+ V K                      S V+ G   
Sbjct: 393 IPAD-GIIIQGESEIDESLMTGESILVHKQ-------------------KGSQVIAGSLN 432

Query: 216 G------IAIKTGLNTEIGKIAKSLRGGNELISRDPAKT---WYQNAWISTKRTVGAFLG 266
           G       AI  G +T++ +I ++++     +++ P +    +  + ++ T   +     
Sbjct: 433 GPGHFYFKAINIGDDTKLAQIIQTMKSAQ--LNKAPIQNNADYLASIFVPTILCLSIITF 490

Query: 267 TTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMIPSSLVVV 326
            T  T        L+ LL    V+F      + KF     +AI  + VA    P +L + 
Sbjct: 491 ITWIT--------LSNLLTKPPVIFT--NNNNGKFYTSFQIAISVIVVAC---PCALGLA 537

Query: 327 LTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIW------V 380
               + VG  + A   V+I+  D LE    +  I  DKTGT+T G+M  ++        +
Sbjct: 538 TPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSNDDL 597

Query: 381 PKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQNFKDKYEGKSIPGNC 440
           P    +    S       K  +N+    S       +  D G++    +   GK +   C
Sbjct: 598 PVLPCIMAAQSISEHPVAKAIVNYCGESS-------QDCDAGVIVTKSEIIIGKGVRCEC 650

Query: 441 QYQ 443
           +YQ
Sbjct: 651 EYQ 653

>CAGL0G06270g 598357..602343 highly similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2, start by
           similarity
          Length = 1328

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 120/301 (39%), Gaps = 67/301 (22%)

Query: 532 FDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKEN 591
           F+ST KRMS+++   D  + ++  KGA   +L   +                       +
Sbjct: 679 FNSTRKRMSAIFRFPD-DSIKLLCKGADSVILERLSE-----------TGNFYVDATTRH 726

Query: 592 IDSMSSEGLRVLAFANKSYPKSDVNE----------------EKLQKILKERDYAETGLT 635
           ++  ++EGLR L  A K  P+ + N                 EKL  + +E    E+GLT
Sbjct: 727 LEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEE---IESGLT 783

Query: 636 FLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILP--TNLYHYS 693
            +G   I D  +E     ++   +AGI + +LTGD   TA  I     +L    NL   S
Sbjct: 784 LIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIIS 843

Query: 694 KEVVDIM------VMTGKQFDNLSEDEIDNLPVL-------------------------- 721
           +E  +         +      +LSE +++ L ++                          
Sbjct: 844 EETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCK 903

Query: 722 PLVIARCSPQTKVRMIEALHRREKFCAMT-GDGVNDSPSLKMANVGIAM-GINGSDVAKD 779
            ++  R SP  K  +++ + R+     +  GDG ND   ++ A+VG+ + G+ G   A+ 
Sbjct: 904 AVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARS 963

Query: 780 A 780
           A
Sbjct: 964 A 964

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 86/191 (45%), Gaps = 44/191 (23%)

Query: 637 LGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEV 696
            GL  I D  + ++   V+   + G    M+TGD    AK +A+EVGI            
Sbjct: 756 FGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI------------ 803

Query: 697 VDIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRRE--KFCAMTGDGV 754
                     F+N+  D               SP  K  +++ +  +E     A+ GDG+
Sbjct: 804 ---------SFENVYSD--------------VSPTGKCDLVKKIQDKEGNNKVAVVGDGI 840

Query: 755 NDSPSLKMANVGIAMGINGSDVAKDASDIV------LSDDNFASILNAVEEGRRMSDNIQ 808
           ND+P+L ++++GIA+   G+++A +A+DIV      L+ ++   + NA++   +    I+
Sbjct: 841 NDAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIK 899

Query: 809 KFVLQLLAENV 819
             +   L  N+
Sbjct: 900 LNLFWALCYNI 910

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 96/234 (41%), Gaps = 49/234 (20%)

Query: 156 IPADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDETPV-GDRIN----LAFSSSTVV 210
           IPAD  ++++   E DE+L+TGES+ V K          PV    +N      F ++TV 
Sbjct: 445 IPAD-GIITRGESEIDESLMTGESILVPKKTG------FPVIAGSVNGPGHFYFRTTTV- 496

Query: 211 KGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTVGAFLGTTQG 270
                      G  T++  I K ++     +S+ P + +    ++++    G  +     
Sbjct: 497 -----------GEETKLANIIKVMKEAQ--LSKAPIQGYAD--YLASIFVPGILI----- 536

Query: 271 TPLHRKLSKLAVLLFWI-AVVFAIVVMASQKFDVDRGVAIYAVC------VALSMIPSSL 323
                    LAVL F+I   +  I       F  +     + +C      V +   P +L
Sbjct: 537 ---------LAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCAL 587

Query: 324 VVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQ 377
            +     + VG  V A   V+I+  + LE   ++     DKTGTLT G M+ K+
Sbjct: 588 GLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKK 641

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/306 (23%), Positives = 124/306 (40%), Gaps = 65/306 (21%)

Query: 509 SVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTH 568
           +V   +K     N +      F F S +KR SSV  + D K Y    KGA E++      
Sbjct: 557 TVEKGDKVFNEKNGQVTILRRFQFSSALKRSSSV-ATHDGKLYSA-VKGAPETI------ 608

Query: 569 WYGRDPNXXXXXXXXXXXXIKENID----SMSSEGLRVLAFANKSYPKSDVNEEKLQKIL 624
                              I  N D    S +  G RVLA A+K   K  +++ +++   
Sbjct: 609 -------------RERLFTIPANYDEIYKSFTRSGSRVLALASKKLEK--MSQSQIED-- 651

Query: 625 KERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGI 684
            +R++ E  L F G +  + P + +    ++  +++     M+TGD P TA  +A+EVGI
Sbjct: 652 ADREHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGI 711

Query: 685 LPTN---------------LYHYSKEVVDI-------------------MVMTGKQFDNL 710
           +                  ++   +E +                     + +TG   + L
Sbjct: 712 VKGETLIVDMVDNGNDDKLVFRNVEETLSFEFVVSKDSFEKYGIFDKYDLAVTGHALEAL 771

Query: 711 S-EDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAM 769
               ++ +L     + AR SP  K  ++  L        M GDG ND  +LK A+VG+A+
Sbjct: 772 KGHHQLQDLIRHAWIYARVSPAQKEFILNNLKDMGYQTLMCGDGTNDVGALKQAHVGVAL 831

Query: 770 GINGSD 775
            +NG++
Sbjct: 832 -LNGTE 836

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 93/235 (39%), Gaps = 51/235 (21%)

Query: 156 IPADLRLVSQQNFETDEALLTGESLPVSKDA------NEIFDDETPVGDRINLAFSSSTV 209
           +P DL LV       +EA+L+GES P+ K++      NE    E    D+I++    + V
Sbjct: 287 LPCDLILVDGTCI-VNEAMLSGESTPLLKESIRLRPGNEELQIEG--TDKISVLHGGTKV 343

Query: 210 VK---------------GRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAW 254
           ++               G A  I  KTG  T  G + + +   +E +  D  +  Y   +
Sbjct: 344 LQVTTPEKTGKVPSPPDGGAIAIVTKTGFETSQGSLVRVMIYSSERVGVDNKEALYFILF 403

Query: 255 ISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCV 314
           +     V ++    +GT + R  SKL                            +  + +
Sbjct: 404 LLIFAVVASWYVWVEGTKMGRVQSKLI---------------------------LDCILI 436

Query: 315 ALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLT 369
             S++P  L + LT+ ++   + ++   V   +   +   G ++  C DKTGTLT
Sbjct: 437 ITSVVPPELPMELTMAVNSSLSALSKFYVYCTEPFRIPFAGRIDVCCFDKTGTLT 491

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type
           copper-transporting ATPase, involved in resistance to
           cadmium [3651 bp, 1216 aa]
          Length = 1216

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 89/223 (39%), Gaps = 42/223 (18%)

Query: 156 IPADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDETPVGDRINLAFSSSTVVKGRAQ 215
           IP D  ++S  + E DEAL+TGES+PV K    I                   VV G   
Sbjct: 728 IPTDGTVISGSS-EVDEALITGESMPVPKKCQSI-------------------VVAGSVN 767

Query: 216 GIAIKTGLNTEIGKIAKSLRGGNELISR-----DPAKTWYQNAWISTKRTVGAFLGTTQG 270
           G      L  ++ K+      GN  IS      D AK           +    F+ T  G
Sbjct: 768 GTGT---LFVKLSKLP-----GNNTISTIATMVDEAKLTKPKIQNIADKIASYFVPTIIG 819

Query: 271 TPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMIPSSLVVVLTIT 330
                    + V+ F + +   I V    + D      IYA+ V +   P  + + + I 
Sbjct: 820 ---------ITVVTFCVWIAVGIRVEKQSRSDAVIQAIIYAITVLIVSCPCVIGLAVPIV 870

Query: 331 MSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM 373
             + + V A R VI +  +S+E     + +  DKTGTLT+GK+
Sbjct: 871 FVIASGVAAKRGVIFKSAESIEVAHNTSHVVFDKTGTLTEGKL 913

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 73/160 (45%), Gaps = 38/160 (23%)

Query: 644  DPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHY------SKEVV 697
            D  R +    +    Q GI++ +L+GD  G  +++A  +GI  +N+  +      S+ + 
Sbjct: 1024 DSLRADAVSTINLLRQRGISLHILSGDDDGAVRSMAARLGIESSNIRSHATPAEKSEYIK 1083

Query: 698  DIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDS 757
            DI  + G+  D+ S+ +       P+V+                    FC   GDG ND+
Sbjct: 1084 DI--VEGRNCDSSSQSK------RPVVV--------------------FC---GDGTNDA 1112

Query: 758  PSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAV 797
              L  A +G+ +   GS+VAK A+D+V+      +IL  +
Sbjct: 1113 IGLTQATIGVHIN-EGSEVAKLAADVVMLKPKLNNILTMI 1151

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 67/149 (44%), Gaps = 45/149 (30%)

Query: 644  DPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMT 703
            D  R E    +K+  ++GI   M++GD   TA+A+AQE+                     
Sbjct: 929  DEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVAQEL--------------------- 967

Query: 704  GKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHR-------REKFCAMTGDGVND 756
                      +IDN      VIA   P+ K   ++ +           K  AM GDG+ND
Sbjct: 968  ----------DIDN------VIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGIND 1011

Query: 757  SPSLKMANVGIAMGINGSDVAKDASDIVL 785
            +P+L  A+VGIA+  +GS++A  + D VL
Sbjct: 1012 APALAAADVGIALA-SGSELAMTSCDFVL 1039

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 94/374 (25%), Positives = 149/374 (39%), Gaps = 59/374 (15%)

Query: 590  ENIDSMSSEGLRVLAFANKSYPKSDVNE-------------EKLQKILKERDYAETGLTF 636
            E+I+S S+EGLR L FA+K     D  +             E+ QKI +     E  L  
Sbjct: 963  EDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQIEDELYL 1022

Query: 637  LGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIA---------QEVGILPT 687
            LG   I D  +E  + A++K  +AGI + MLTGD   TA  I            V IL T
Sbjct: 1023 LGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDYSTVVILTT 1082

Query: 688  N-------LYHYSKEVVD------IMVMTGKQFDNLSEDEIDNLPVL--------PLVIA 726
            +       +   S+EV        ++V+ G     + ED    + V          +V  
Sbjct: 1083 SDENIISKMNAISQEVDSGNVAHCVIVIDGATL-AMFEDNPTLMSVFTELCTKTDSVVCC 1141

Query: 727  RCSPQTKVRMIEALHRREK--FCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIV 784
            R SP  K  M+  +   +K       GDG ND   ++ A++G+  GI G +  + +    
Sbjct: 1142 RASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGV--GIAGKEGLQASRSAD 1199

Query: 785  LSDDNFASILN-AVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPLA 843
             S   F  IL   +  GR       KF+L    + +   L  ++   +    G S++   
Sbjct: 1200 YSIGQFRFILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLIYQRYTMFSGTSLY--E 1257

Query: 844  PVEVLWIIVVTSCFPAMGLGL-EKAAH--DLMDRPPNDSKAGI---FTWEIIVDMFVYGV 897
            P  +     + +  P + +G+ EK      L+  P   S   +   F W I  +    G 
Sbjct: 1258 PWSLSMYNTLFTSLPVLCVGMFEKDLKPVTLLTVPELYSMGRLSKAFNWSIFAEWVFLGT 1317

Query: 898  WMAASCMATFVTII 911
              A + + TF+ I+
Sbjct: 1318 --ANALIITFLNIV 1329

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 317 SMIPSSLVVVLTITMSVGAAVM----------ASRNVIIRKLDSLEALGAVNDICSDKTG 366
           ++IP SL V + +     + +M          +     +R    LE LG V+ I SDKTG
Sbjct: 473 TIIPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKTG 532

Query: 367 TLTQGKMIAKQI 378
           TLT  KM+ +++
Sbjct: 533 TLTDNKMLFRKL 544

>Kwal_26.7070
          Length = 1315

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 86/401 (21%), Positives = 157/401 (39%), Gaps = 65/401 (16%)

Query: 532  FDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKEN 591
            F+ST KRMS+++   + +  +++ KGA   +L       G +P                +
Sbjct: 697  FNSTRKRMSAIFRLPNGEI-KLFCKGADTVILERLKA--GENPYIEATL---------RH 744

Query: 592  IDSMSSEGLRVLAFANKSYPKSDVNE-------------EKLQKILKERDYAETGLTFLG 638
            ++  ++EGLR L  A+++  +S+  E             ++ QK+    +  E  L  LG
Sbjct: 745  LEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLG 804

Query: 639  LIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILP------------ 686
               I D  ++     +     AGI V +LTGD   TA  I     +L             
Sbjct: 805  ATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEED 864

Query: 687  -----TNLYHYSKEVVD-----------IMVMTGKQFDNLSEDEIDNLPVL------PLV 724
                  NL    K + D            +V+ GK      E ++++  +        ++
Sbjct: 865  KEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFALEADLEDYLLAIGKLCKAVI 924

Query: 725  IARCSPQTKVRMIEALHRR-EKFCAMTGDGVNDSPSLKMANVGIAM-GINGSDVAKDASD 782
              R SP  K  +++ + R+ +      GDG ND   ++ A+VG+ + G+ G   A+ A D
Sbjct: 925  CCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA-D 983

Query: 783  IVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPL 842
              ++   +   L  V  G      I + +L    +N+A  +     +      G+S+   
Sbjct: 984  FAIAQFKYLKKLLLV-HGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIME- 1041

Query: 843  APVEVLWIIVVTSCFP-AMGLGLEKAAHDLMDRPPNDSKAG 882
            +     + +  T   P  MG+  +  +  L+DR P   K G
Sbjct: 1042 SWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLG 1082

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 12/115 (10%)

Query: 317 SMIPSSLVVVLTITMSVGAAVMAS----------RNVIIRKLDSLEALGAVNDICSDKTG 366
           +++P SL V + +     A ++AS             ++R    +E LG +  I SDKTG
Sbjct: 503 NLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTG 562

Query: 367 TLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKG-DINFIPNLSPYEYSHNETED 420
           TLT+  M  K   +     ++ +  ++    E G +I F       + + N+T+D
Sbjct: 563 TLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEIGF-RKFDSMKETLNDTQD 616

>Kwal_23.3556
          Length = 1597

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 83/373 (22%), Positives = 143/373 (38%), Gaps = 67/373 (17%)

Query: 592  IDSMSSEGLRVLAFANKSYPKSDVN-------------EEKLQKILKERDYAETGLTFLG 638
            I+  S+ GLR L ++ K  P  D               E + +K+    +  ET L  LG
Sbjct: 964  IEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSVGELVETSLHLLG 1023

Query: 639  LIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGI-------------- 684
               I D  +E  A A+ K  +AGI + MLTGD   TA  I     +              
Sbjct: 1024 ATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHDYSTVVILSAKD 1083

Query: 685  --LPTNLYHYSKEVVD------IMVMTGKQFDNLSEDEIDNLPVL------------PLV 724
              + + L   S+E+        ++V+ G        +     P L             ++
Sbjct: 1084 ENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESN-----PTLMSVFVELCTKTDSVI 1138

Query: 725  IARCSPQTKVRMIEALHRREK--FCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASD 782
              R SP  K  M+  +   +K       GDG ND   ++ A++G+ +       A  +SD
Sbjct: 1139 CCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSSD 1198

Query: 783  IVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDK---EGKSV 839
              ++   F   L  V  GR       KFVL    + +   L+ +  + +Q      G S+
Sbjct: 1199 YSIAQFRFLLKLLLV-HGRYNYVRTTKFVLCTFYKEL---LFYLTQMIYQRHTMFSGTSL 1254

Query: 840  FPLAPVEVLWIIVVTSCFPAMGLGL-EKAAHDL-MDRPPNDSKAGIFTWEIIVDMFVYGV 897
            +   P  +     + +  P + +G+ EK    + +   P     G  +    + +F+Y +
Sbjct: 1255 Y--EPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRLSQSFNLRVFLYWM 1312

Query: 898  WMAA--SCMATFV 908
            ++AA  S + TF+
Sbjct: 1313 FLAALNSLIITFL 1325

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 63/148 (42%), Gaps = 36/148 (24%)

Query: 273 LHRKLSKLAVLLFWIAVVFAIVVMASQK---------------FDVDRGVAIYAVCVAL- 316
           L R ++ + + + ++    A+  +  Q+               F+ D G+A   +   + 
Sbjct: 412 LQRAINLIVLFMVFVVASMALFSLLGQRIIKKKYVDNNRAWYLFNSDAGLAPTVMSFIIM 471

Query: 317 --SMIPSSLVVVLTITMSVGAAVM--------ASRNVII--RKLDSLEALGAVNDICSDK 364
             ++IP SL V + I  ++ + +M        A  N     R    LE LG V+ I SDK
Sbjct: 472 YNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDK 531

Query: 365 TGTLTQGKMIAKQIWVPKFGTLQVVGSN 392
           TGTLT  KM+        F  L V GS+
Sbjct: 532 TGTLTDNKMV--------FRALSVCGSS 551

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 88/207 (42%), Gaps = 46/207 (22%)

Query: 588 IKENIDSMSSEGLRVLAFANKS-YPK---SDVNEEKLQKILKERDYAETGLTFLGLIGIY 643
           I  NI   ++  +  +   NK  +P    SD+    L +      Y     + +G   I 
Sbjct: 694 ISCNITDKNTSKIHTITIGNKKLFPDESLSDIASSTLTE-----SYVSIDGSLVGKFEIS 748

Query: 644 DPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMT 703
           D  +E+    V+     GI   M+TGD   +A  +AQ++GI   +++             
Sbjct: 749 DRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVF------------- 795

Query: 704 GKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRR-EKFCAMTGDGVNDSPSLKM 762
                                 +  +P+ K  ++  L     +  A  GDG+NDSP+L  
Sbjct: 796 ----------------------SEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVE 833

Query: 763 ANVGIAMGINGSDVAKDASDIVLSDDN 789
           A++GI++  +G+D+A +A+DIV+ D +
Sbjct: 834 ADLGISIS-SGTDIAIEAADIVILDSD 859

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 99/230 (43%), Gaps = 51/230 (22%)

Query: 156 IPADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDETPVGDRINLAFSSSTVVKGRAQ 215
           IPAD  +V +   E DE+L+TGES+ V K                      S V+ G   
Sbjct: 440 IPAD-GVVIRNETEVDESLITGESMLVEK-------------------IVGSQVIGGSVN 479

Query: 216 GI------AIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTVGAFLGTTQ 269
           G       AI+ G +T++  I  +++     +S+ P + +         +  G F+    
Sbjct: 480 GPGHFYFRAIRVGEDTKLANIIATMKKAQ--LSKAPIQKY-------ADKMAGIFV---- 526

Query: 270 GTPLHRKLSKLAVLLFWIAVVFAI----VVMASQ--KFDVDRGVAIYAVCVALSMIPSSL 323
             P    LS +   + W+ V + +    ++  S+  KF +   ++I  + VA    P +L
Sbjct: 527 --PFVISLSAIT-FITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVAC---PCAL 580

Query: 324 VVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM 373
            +     + VG  V AS  V+I+  D LE   A+     DKTGTLT G+M
Sbjct: 581 GLAAPTAIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRM 630

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 65/147 (44%), Gaps = 35/147 (23%)

Query: 639  LIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVD 698
             + + D  R E    V+  H+ GI   M++GD    A A+A EVGI         K V+ 
Sbjct: 1013 FLAVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI---------KHVIA 1063

Query: 699  IMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSP 758
             ++  GK                           K++ I     +    AM GDG+ND+P
Sbjct: 1064 DVLPEGKA-------------------------EKIQWIRETSGQGVAIAMVGDGMNDAP 1098

Query: 759  SLKMANVGIAMGINGSDVAKDASDIVL 785
            ++  A+VGI++  +GSD+A  + D VL
Sbjct: 1099 AIAAADVGISLA-SGSDLAMISCDFVL 1124

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 93/236 (39%), Gaps = 65/236 (27%)

Query: 157 PADLRLVSQQNFETDEALLTGESLPVSK-DANEIFDDETPVGDRINLAFSSSTVVKGRAQ 215
           PA   L+ Q   E DE+ LTGES P++    ++IF     VG                  
Sbjct: 678 PAVDALIVQGETEFDESSLTGESRPITHFPGDQIFAGTVNVG------------------ 719

Query: 216 GIAIKTGLNTEIGKIAK-SLRGGNELISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLH 274
                     +   IAK S   GN L+          +  IS  R      G  +G P+ 
Sbjct: 720 ----------QCAVIAKVSTAPGNSLL----------DHVISAVRD-----GQLRGAPIE 754

Query: 275 RK-----------LSKLAVLLF--WIAVVFAIVVMASQKFDVDRG-----VAIYAVCVAL 316
           R            +  LA+L +  W+ + FA  V++ +K D   G        +A+ V +
Sbjct: 755 RIADVLTGYFVPFIVLLAILTWAIWLILGFA-GVLSQEKLDGSVGGWPFWSLEFAIAVFV 813

Query: 317 SMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGA-VNDICSDKTGTLTQG 371
              P  + +     + VGA + A   ++ R   +   +G+ V  +C DKTGTLT+G
Sbjct: 814 IACPCGIGLAAPTALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDKTGTLTKG 869

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 78/326 (23%), Positives = 127/326 (38%), Gaps = 65/326 (19%)

Query: 592  IDSMSSEGLRVLAFANKSYP-------KSDVNEEKLQKILKERDYAETG------LTFLG 638
            ID  S+EGLR L ++ K  P       ++  +E K     +    AE G      L  LG
Sbjct: 944  IDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEVGGHIETDLELLG 1003

Query: 639  LIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEV-- 696
               I D  +E    A++K  +AGI + MLTGD   TA  I     +    +Y YS  V  
Sbjct: 1004 ATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKL----IYDYSTVVIL 1059

Query: 697  -------VDIMVMTGKQFDN------------LSEDEIDNLPVL------------PLVI 725
                   +  M   G++ D              S    +N P +             ++ 
Sbjct: 1060 KKNDDNLISKMTALGEELDTGKIAHCVLVIDGASLAVFENNPTMMSVFIELCTKTDSVIC 1119

Query: 726  ARCSPQTKVRMIEALHRREK--FCAMTGDGVNDSPSLKMANVGIAMGINGSD--VAKDAS 781
             R SP  K  ++  +  + K       GDG ND   ++ A++G+  GI G +   A  +S
Sbjct: 1120 CRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGV--GITGKEGLQASRSS 1177

Query: 782  DIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDK---EGKS 838
            D  ++   +   L  V  GR       KFVL    + V   L+ +  + +Q +    G S
Sbjct: 1178 DYSIAQFRYLLKLLFV-HGRYNYVRTSKFVLCTFYKEV---LFYLTQMIYQRQTMFSGTS 1233

Query: 839  VFPLAPVEVLWIIVVTSCFPAMGLGL 864
            ++   P  +     + +  P + +G+
Sbjct: 1234 LYE--PWSLSMFNTLFTSLPVICIGM 1257

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 36/76 (47%), Gaps = 20/76 (26%)

Query: 317 SMIPSSLVVVLTITMSVGAAVMA---------------SRNVIIRKLDSLEALGAVNDIC 361
           ++IP SL V   I  ++ + +M                SR   I     LE LG V+ I 
Sbjct: 479 TLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESDTPCESRTATI-----LEELGQVSYIF 533

Query: 362 SDKTGTLTQGKMIAKQ 377
           SDKTGTLT  KMI ++
Sbjct: 534 SDKTGTLTDNKMIFRK 549

>Scas_89.1
          Length = 271

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 111/240 (46%), Gaps = 39/240 (16%)

Query: 617 EEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAK 676
           +E +  ++K+  + E  L  LGL G+ D  + +   +++    AG+ + MLTGD   TA+
Sbjct: 20  DETMSSVIKK--HLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETAR 77

Query: 677 AIAQEVGILPTNLYHYS-------------KEVVDI-----MVMTGKQ---FDNLSEDEI 715
            ++    ++    Y ++              E + I     +++ G+    F    + E 
Sbjct: 78  CVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEF 137

Query: 716 DNLPV-LPLVIA-RCSPQTKVRMIEALHRRE----KFCAMTGDGVNDSPSLKMANVGIAM 769
            ++ V LP VIA RC+PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+  
Sbjct: 138 FDIVVDLPAVIACRCTPQQKADV--ALLIREITGKRVCCI-GDGGNDVSMIQCADVGV-- 192

Query: 770 GINGSDVAKDASDIVLSDDNFASILNAVE-EGR---RMSDNIQKFVLQL-LAENVAQALY 824
           GI G +  + +     S   F  +   +   GR   + S  + +FV+   L  +V QA+Y
Sbjct: 193 GIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVY 252

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 106/271 (39%), Gaps = 53/271 (19%)

Query: 590  ENIDSMSSEGLRVLAFA-----NKSYPKSDVNEEKLQKILKER--------DYAETGLTF 636
            +++D+ ++EGLR L ++     N+ Y   +      +  L  R        +  E  LT 
Sbjct: 943  QDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDTVGEIIERDLTL 1002

Query: 637  LGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIA---------QEVGILPT 687
            LG IGI D  +E    A+ K  +AGI + MLTGD   TA  I            V IL  
Sbjct: 1003 LGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIHDYSTVIILAP 1062

Query: 688  NLYHYSKEVVDI-------------MVMTGKQFDNLSEDEIDNLPVLPLVIARC------ 728
            N  + + ++  I             +V+ G            NL ++ L I  C      
Sbjct: 1063 NDENMASKITTITQEIEAGNVAHCVVVIDGATLTIFE----GNLTLMTLFIELCTKTDSV 1118

Query: 729  -----SPQTKVRMIEALHRREK--FCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDAS 781
                 SP  K  M+  + + +K       GDG ND   ++ A++G+ +       A  +S
Sbjct: 1119 ICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEGLQASRSS 1178

Query: 782  DIVLSDDNFASILNAVEEGRRMSDNIQKFVL 812
            D  ++   +   L  V  GR       KFVL
Sbjct: 1179 DYSIAQFRYLLKLLLV-HGRYNYIRTSKFVL 1208

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 56/133 (42%), Gaps = 28/133 (21%)

Query: 273 LHRKLSKLAVLLFWIAVVFAIVVMASQKF------DVDRGVAIYAVCVAL---------- 316
           L  +++ + + +  +  +F+ +    Q+F      D DR   +  V   L          
Sbjct: 389 LQTQINLIVLFMILVVAIFSFLSFGLQRFFKNREVDSDRAWYLMKVDAGLAPTIMSFIIM 448

Query: 317 --SMIPSSLVVVLTITMSVGAAVM----------ASRNVIIRKLDSLEALGAVNDICSDK 364
             ++IP SL V + I   + + +M           +     R    LE LG V+ I SDK
Sbjct: 449 YNTLIPLSLYVTMEIIKDMQSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDK 508

Query: 365 TGTLTQGKMIAKQ 377
           TGTLT  +MI ++
Sbjct: 509 TGTLTDNRMIFRK 521

>Kwal_55.21575
          Length = 989

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 77/169 (45%), Gaps = 40/169 (23%)

Query: 629 YAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTN 688
           Y +     +G   I D  +++ A  V+   + G  V M+TGD   +A  +A E+GI   N
Sbjct: 732 YVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANN 791

Query: 689 LYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRR-EKFC 747
           +Y                                   +  +P  K ++++ L     K  
Sbjct: 792 VY-----------------------------------SELTPADKNQLVQDLQDGGRKNV 816

Query: 748 AMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVL---SDDNFASI 793
           A  GDG+NDSP+L  +++G+++   G+D+A +A+D+++   S++N  S+
Sbjct: 817 AFIGDGINDSPALVTSDLGVSIS-TGTDIAMEAADVIILNRSENNHVSL 864

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 117/298 (39%), Gaps = 47/298 (15%)

Query: 95  FVIGINVIIGLIQEYKASKTMNALRALSS---PNAHVIRNGNSEVVDSTXXXXXXXXXXX 151
            +IG   +  L++    SKT N+L  L S       +I NG +  +              
Sbjct: 377 MLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIK 436

Query: 152 XXXTIPADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDETPVGDRINLAFSSSTVVK 211
               IP D  ++  ++ E DE+L+TGESL V +                   +    V+ 
Sbjct: 437 PGAKIPTDGVIIEGES-EVDESLITGESLMVPR-------------------YKGFPVIA 476

Query: 212 GRAQG------IAIKTGLNTEIGKIAKSLRGGNELISRDPAKTW--YQNAWISTKRTVGA 263
           G   G       A   G +T++ +I ++++     +S+ P + +  Y  +       V A
Sbjct: 477 GSINGPNRFLLTATSVGDDTKLAQIIQTMKQAQ--LSKAPIQHYADYLASKFVPSVLVLA 534

Query: 264 FLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMIPSSL 323
            +     T L R LS             +I    + KF +   + I  + VA    P +L
Sbjct: 535 MITFVTWTILSRVLSNPP----------SIFDSPNGKFFICLEMTISVIVVAC---PCAL 581

Query: 324 VVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVP 381
            +     + VG  + A   V+I+  D LE   ++     DKTGTLT G M  +Q +VP
Sbjct: 582 GLAAPTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQ-FVP 638

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
           Ca-ATPase (P-type) required for ribosome assembly and
           involved in late Golgi function, member of the cation
           transporting (E1-E2) P-type ATPase superfamily [4068 bp,
           1355 aa]
          Length = 1355

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 69/312 (22%), Positives = 119/312 (38%), Gaps = 62/312 (19%)

Query: 532 FDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKEN 591
           F+ST KRMS+++   D  + +++ KGA   +L                           +
Sbjct: 698 FNSTRKRMSAIFRFPD-GSIKLFCKGADTVILE-----------RLDDEANQYVEATMRH 745

Query: 592 IDSMSSEGLRVLAFANKSYPKSDVNE-------------EKLQKILKERDYAETGLTFLG 638
           ++  +SEGLR L  A +   + +  E              + +K+ +  +  E  L  +G
Sbjct: 746 LEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIG 805

Query: 639 LIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILP--TNLYHYSKEV 696
              I D  ++     +    +AGI + +LTGD   TA  I     +L    NL   ++E 
Sbjct: 806 ATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEET 865

Query: 697 VD--------------------------IMVMTGKQFDNLSEDEIDN--LPVLPL----V 724
            D                           +V+ GK      E E+++  L V  L    +
Sbjct: 866 RDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVI 925

Query: 725 IARCSPQTKVRMIEALHRREKFCAMT-GDGVNDSPSLKMANVGIAM-GINGSDVAKDASD 782
             R SP  K  +++ + R+     +    G ND   ++ A+VG+ + G+ G   A+ A D
Sbjct: 926 CCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEGMQAARSA-D 984

Query: 783 IVLSDDNFASIL 794
           I L    F   L
Sbjct: 985 IALGQFKFLKKL 996

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 77/188 (40%), Gaps = 42/188 (22%)

Query: 638 GLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVV 697
           G   + D  + +    ++        V M+TGD   +A  +A+ V I P N+Y       
Sbjct: 757 GRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVY------- 809

Query: 698 DIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDS 757
                                       +  +P  K + +E L    +  A  GDG+NDS
Sbjct: 810 ----------------------------SEVTPDGKSQTVEYLREEGRVIAFIGDGINDS 841

Query: 758 PSLKMANVGIAMGINGSDVAKDASDIVLSDD------NFASILNAVEEGRRMSDNIQKFV 811
            +L  +++GIA+  +G++VA +A+ IV+ +D          ++NA++   R    ++  +
Sbjct: 842 LALVTSDLGIAIS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNL 900

Query: 812 LQLLAENV 819
              L  NV
Sbjct: 901 FWALCYNV 908

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 93/225 (41%), Gaps = 30/225 (13%)

Query: 156 IPADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDETPVGDRINLAFSSSTVVKGRAQ 215
           IP+D  +V++   E DE+L+TGE+  V K+   +    T  G  + + F  ++V      
Sbjct: 446 IPSD-GIVTKGISEVDESLMTGETNLVVKEIGSVVTGGTINGSGL-IYFEVTSV------ 497

Query: 216 GIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHR 275
                 G +T++  I K ++      +     T Y  +       + + L     T L R
Sbjct: 498 ------GDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSLLTFIVWTSLTR 551

Query: 276 K---LSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMIPSSLVVVLTITMS 332
               +SKL++              +  +F +   +A   V VA    P +L +     + 
Sbjct: 552 SEKIISKLSIF----------GETSESRFYMCLQIATSVVIVAC---PCALGLATPTAIM 598

Query: 333 VGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQ 377
           VG  V +   V+I+  D LE    VN    DKTGTLT G M  +Q
Sbjct: 599 VGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ 643

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 15/102 (14%)

Query: 592  IDSMSSEGLRVLAFA------------NKSY--PKSDVNEEKLQKILKERDYAETGLTFL 637
            ID  S+EGLR L +A            NK Y   K+ + + K+ K+ +     E GL  L
Sbjct: 1025 IDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKI-KVDEAGAEIEDGLNLL 1083

Query: 638  GLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIA 679
            G+  I D  ++  + A++K  +AGI + MLTGD   TA  I 
Sbjct: 1084 GVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIG 1125

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 62/138 (44%), Gaps = 28/138 (20%)

Query: 268 TQGTPLHRKLSKLAVLLFWIAVVFAIV-----VMASQK----------FDVDRGVA---I 309
           T+   L RK++ + V + ++    ++      V+  +K          F  D GVA   +
Sbjct: 443 TKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHKKKYIDQNKAWYLFQADAGVAPTIM 502

Query: 310 YAVCVALSMIPSSLVVVLTITMSVGAAVM--------ASRNVII--RKLDSLEALGAVND 359
             + +  ++IP SL V + I   V + +M        A  N     R    LE LG V+ 
Sbjct: 503 SFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTATILEELGQVSY 562

Query: 360 ICSDKTGTLTQGKMIAKQ 377
           I SDKTGTLT  KMI ++
Sbjct: 563 IFSDKTGTLTDNKMIFRK 580

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 84/200 (42%), Gaps = 49/200 (24%)

Query: 622 KILKERDYAETGLT---------FLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFP 672
           ++L ER    +G T          LG   + D  RE+    V+     G  V M+TGD  
Sbjct: 556 RLLPERPSKFSGSTASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNH 615

Query: 673 GTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQT 732
             A  ++  +GI P N                    N+  + +              P+ 
Sbjct: 616 EAAMHVSHALGI-PLN--------------------NVFSERL--------------PEG 640

Query: 733 KVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFA- 791
           K  ++  L ++  + A  GDG+NDS +L  +++GI++  N SD+  DA+ IV+ D + A 
Sbjct: 641 KCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLSGN-SDIVADAAGIVVLDHSSAP 699

Query: 792 ---SILNAVEEGRRMSDNIQ 808
               IL A++  R   + ++
Sbjct: 700 PLTRILYAIDLARATFNRVK 719

>Scas_669.3
          Length = 1638

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 53/122 (43%), Gaps = 23/122 (18%)

Query: 592  IDSMSSEGLRVLAFANKSYPKSDVNE----------------EKLQKILKERDYAETGLT 635
            ID  S+EGLR L +   SY   D+ E                 +  KI +  +  E  L 
Sbjct: 999  IDEFSTEGLRTLVY---SYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEVGEEIEQDLQ 1055

Query: 636  FLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKE 695
             LG   I D  +E  + A++K  +AGI + MLTGD   TA  I     +    +Y YS  
Sbjct: 1056 LLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKL----IYDYSTV 1111

Query: 696  VV 697
            V+
Sbjct: 1112 VI 1113

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 20/76 (26%)

Query: 317 SMIPSSLVVVLTITMSVGAAVMA---------------SRNVIIRKLDSLEALGAVNDIC 361
           ++IP SL V + I  ++ + +M                SR   I     LE LG V+ + 
Sbjct: 496 TIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATI-----LEELGQVSYMF 550

Query: 362 SDKTGTLTQGKMIAKQ 377
           SDKTGTLT  KMI ++
Sbjct: 551 SDKTGTLTDNKMIFRK 566

>YGR208W (SER2) [2158] chr7 (911886..912815) Phosphoserine
           phosphatase, involved in synthesis of serine from
           3-phosphoglycerate [930 bp, 309 aa]
          Length = 309

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 62/158 (39%), Gaps = 22/158 (13%)

Query: 616 NEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGA---VKKFHQAGINVRMLTGDFP 672
           NE   ++ L+ER     GL    L        E T G     K  H+    + +L+G F 
Sbjct: 131 NELDFKESLRERVKLLQGLQVDTLYDEIKQKLEVTKGVPELCKFLHKKNCKLAVLSGGFI 190

Query: 673 GTAKAIAQEVGI--LPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSP 730
             A  I  ++G+     NL     EV     +TGK                P+V  +C  
Sbjct: 191 QFAGFIKDQLGLDFCKANLL----EVDTDGKLTGKTLG-------------PIVDGQCKS 233

Query: 731 QTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIA 768
           +T +++    +   +   M GDG ND P++  A  GIA
Sbjct: 234 ETLLQLCNDYNVPVEASCMVGDGGNDLPAMATAGFGIA 271

>Scas_505.4
          Length = 1025

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 83/203 (40%), Gaps = 19/203 (9%)

Query: 723 LVIARCSPQTKVRMIEALHRREKFCAMT-GDGVNDSPSLKMANVGIAM-GINGSDVAKDA 780
           +V  R SP  K  +++ + R+     +  GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 589 VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648

Query: 781 SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA---QALYLIVGLAFQDKEGK 837
            DI +    F   L  V  G      I   +L    +N A      + +   AF  +   
Sbjct: 649 -DIAVGQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIM 706

Query: 838 SVFPLAPVEVLWIIVVTSCFPAMGLGL--EKAAHDLMDRPPNDSKAG----IFTWEIIVD 891
             + ++   V + +     FP   +G+  +  +  L++R P   K G     F+  I   
Sbjct: 707 ESWTMSYYNVFFTV-----FPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWG 761

Query: 892 MFVYGVWMAASC-MATFVTIIYG 913
             V G + +A   + T +   YG
Sbjct: 762 WIVNGFYHSAVVYIGTMLFYRYG 784

>Scas_227.0d
          Length = 307

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 531 PFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXXXXXXXXXXXXIKE 590
           PF+ST K    + + ++   Y  + KGA E V N C      D              I +
Sbjct: 190 PFESTRKWGGIIVKYKESNLYRFFIKGAAEIVSNNCHSKRNSD----DSIVTLNKDQINK 245

Query: 591 NIDSMSSEGLRVLAFANKSYP 611
            I++++++ LR L+ A++ +P
Sbjct: 246 EIENLANDALRALSLAHRDFP 266

>Scas_576.8
          Length = 1591

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 53/115 (46%), Gaps = 19/115 (16%)

Query: 591  NIDSMSSEGLRVLAFANK--SYP-------KSDV-------NEEKLQKILKERDYAETGL 634
            +++  ++EGLR L  A +  S+P       + D+        EE+L+ +    D  E  L
Sbjct: 915  HLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQLEAV---SDEIEREL 971

Query: 635  TFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNL 689
            T LG   I D  ++    ++    QAGI + +LTGD   TA  I     +L  ++
Sbjct: 972  TLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIGFSCNLLNNDM 1026

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 102/432 (23%), Positives = 171/432 (39%), Gaps = 80/432 (18%)

Query: 311  AVCVALSMIPSSLVVVLTITMSVGAAVMASRNVII--RKLDS---------LEALGAVND 359
            AV +  S++P SL + + I +    A+    +V++   KLD           + LG +  
Sbjct: 612  AVILYQSLVPISLYISVEI-IKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEY 670

Query: 360  ICSDKTGTLTQGKMIAKQIWVP--KFG---TLQVVG---------------SNEPLNPEK 399
            I SDKTGTLTQ  M  K+  +    +G   T  + G                 E +  ++
Sbjct: 671  IFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDR 730

Query: 400  GD-INFIPNLSPYEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIA 458
             + IN + NL+     + E E   + + F D   G S  G+ Q +    ++   +LA   
Sbjct: 731  EEMINKLQNLAKNSQFY-EDEVTFVSKEFVDDLTGGS--GSVQQKSCQHFM--LALALCH 785

Query: 459  SVFTDPETKEWKAHGDPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDAT 518
            SV T+P +KE     DP ++ I+  A   D    V T    DM    +  +      +  
Sbjct: 786  SVLTEP-SKE-----DPAKLEIK--AQSPDEAALVTTAR--DMGFSFLKKTKEGMVLEVQ 835

Query: 519  AANAKFRHAAEFPFDSTIKRMSSVY-----ESRDYKTYEIYTKGAFESVLNCCTHWYGRD 573
                +F+      F+S+ KRMS +      ++       +  KGA +SV+       G +
Sbjct: 836  GIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGA-DSVIYSRLDKTGLN 894

Query: 574  PNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFANKSY---------PKSDV-------NE 617
                             +++  ++EGLR L  A +            K D+        E
Sbjct: 895  EESLLEKTAL-------HLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDRE 947

Query: 618  EKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKA 677
            E+L+K+    D  E  L  LG   I D  ++    ++    +AGI + +LTGD   TA  
Sbjct: 948  EELEKV---SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAIN 1004

Query: 678  IAQEVGILPTNL 689
            I     +L  ++
Sbjct: 1005 IGFSCNLLNNDM 1016

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 102/439 (23%), Positives = 164/439 (37%), Gaps = 93/439 (21%)

Query: 311  AVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIR-KLDS---------LEALGAVNDI 360
            AV +  S++P SL + + I  +  AA +    ++   KLD           + LG +  I
Sbjct: 601  AVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYI 660

Query: 361  CSDKTGTLTQGKMIAKQIWVP--KFGT----------------LQVVGSNEPLNPEKGD- 401
             SDKTGTLTQ  M  K+  +    +G                 ++  G  E     K   
Sbjct: 661  FSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEAEGRREKEEIAKDRD 720

Query: 402  --INFIPNLS------PYEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETAS 453
              IN + NLS      P E +    E   I+Q+FK +       G+ Q +  + ++   +
Sbjct: 721  VMINDLRNLSNNTQFFPDEITFISKE---IVQDFKGR------NGDIQKKCCEHFM--LA 769

Query: 454  LANIASVFTDPETK-----EWKAHGDPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMS 508
            LA   SV T+P        E KA   P E A+    T  DL    +   +  M     + 
Sbjct: 770  LALCHSVLTEPSPTNPNKLEMKAQS-PDEAAL--VTTARDLGFCFMGKTKTGM-----VV 821

Query: 509  SVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYE-----SRDYKTYEIYTKGAFESVL 563
             +   +K+    N          F+S  KRMS + +       D     +  KGA +SV+
Sbjct: 822  EIQGIQKEFEILNI-------LEFNSARKRMSCIIKIPGATPNDEPRALLICKGA-DSVI 873

Query: 564  NCCTHWYGRDPNXXXXXXXXXXXXIKENIDSMSSEGLRVLAFANKSYPKSDVNE------ 617
                  Y R                  +++  ++EGLR L  A +    S+  E      
Sbjct: 874  ------YSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYD 927

Query: 618  -------EKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGD 670
                    + +++    D  E  L  LG   I D  ++    ++    +AGI + +LTGD
Sbjct: 928  IAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGD 987

Query: 671  FPGTAKAIAQEVGILPTNL 689
               TA  I     +L  ++
Sbjct: 988  KVETAINIGFSCNLLNNDM 1006

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 46/108 (42%), Gaps = 13/108 (12%)

Query: 591  NIDSMSSEGLRVLAFANKSYPKSDVNE-------------EKLQKILKERDYAETGLTFL 637
            +++  ++EGLR L  A +     +  E             ++  ++ K  D  E  LT L
Sbjct: 941  HLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLL 1000

Query: 638  GLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGIL 685
            G   I D  ++    ++    +AGI + +LTGD   TA  I     +L
Sbjct: 1001 GGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLL 1048

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 48/115 (41%), Gaps = 19/115 (16%)

Query: 591  NIDSMSSEGLRVLAFANKSYPKSDV----------------NEEKLQKILKERDYAETGL 634
            +++  ++EGLR L  A +    S+                  EE+L K+    D  E  L
Sbjct: 942  HLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVT---DVIEREL 998

Query: 635  TFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNL 689
              LG   I D  ++    ++    +AGI + +LTGD   TA  I     +L  ++
Sbjct: 999  ILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDM 1053

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
           dehalogenase or epoxide hydrolase family, has low
           similarity to S. cerevisiae Drs2p, which is a
           membrane-spanning Ca-ATPase (P-type) required for
           ribosome assembly and involved in late Golgi function
           [4716 bp, 1571 aa]
          Length = 1571

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 311 AVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIR-KLDS---------LEALGAVNDI 360
           AV +  S++P SL + + I  +  AA +    ++   KLD           + LG V  I
Sbjct: 605 AVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYI 664

Query: 361 CSDKTGTLTQGKMIAKQ 377
            SDKTGTLTQ  M  K+
Sbjct: 665 FSDKTGTLTQNVMEFKK 681

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 85/215 (39%), Gaps = 39/215 (18%)

Query: 523  KFRHAAEFPFDSTIKRMSSVY-----ESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNXX 577
            +FR      F+ST KRMS +      +        +  KGA +SV+         DP   
Sbjct: 840  EFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGA-DSVIYSRLDRSRNDPKLL 898

Query: 578  XXXXXXXXXXIKENIDSMSSEGLRVLAFANK----------------SYPKSDVNEEKLQ 621
                         +++  ++EGLR L  A +                +    D  EE L+
Sbjct: 899  ERTAL--------HLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNREEALE 950

Query: 622  KILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQE 681
            ++    D  E  L  LG   I D  ++    ++     AGI + +LTGD   TA  I   
Sbjct: 951  RVA---DAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIGFS 1007

Query: 682  VGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEID 716
              +L +++     E++ ++  +G+  ++L E + D
Sbjct: 1008 CNLLGSDM-----ELL-VIKSSGEDVEHLGEKDSD 1036

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 54/132 (40%), Gaps = 39/132 (29%)

Query: 256 STKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVA 315
           +T RT   F GT  GTP         +L F++A++                  +Y     
Sbjct: 586 ATSRTFFEF-GTVAGTPFAN-----GILAFFVALI------------------LYQ---- 617

Query: 316 LSMIPSSLVVVLTITMSVGAAVMASRNVII----------RKLDSLEALGAVNDICSDKT 365
            S++P SL + + I  +  AA +    ++           R  +  + LG +  I SDKT
Sbjct: 618 -SLVPISLYISIEIIKTAQAAFIYGDVLLYNPKLDYPCTPRTWNISDDLGQIEYIFSDKT 676

Query: 366 GTLTQGKMIAKQ 377
           GTLTQ  M  K+
Sbjct: 677 GTLTQNVMEFKK 688

>Scas_463.3
          Length = 315

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%)

Query: 723 LVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIA 768
           +V  +C  +T + + E      +   M GDG ND P++ +A  GIA
Sbjct: 228 IVDGQCKAETLLELCEKYQCPVEASCMVGDGGNDLPAMSVAGFGIA 273

>Scas_636.16
          Length = 1554

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 71/347 (20%), Positives = 127/347 (36%), Gaps = 79/347 (22%)

Query: 591  NIDSMSSEGLRVLAFANKSYPKSDVNE--EKL-----------QKILKERDYAETGLTFL 637
            +++  ++EGLR L    +    S+  E  EK            +++    D  E  L  L
Sbjct: 878  HLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERDLVLL 937

Query: 638  GLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIA------------------ 679
            G   I D  ++    ++    +AGI + +LTGD   TA  I                   
Sbjct: 938  GGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTT 997

Query: 680  ----QEVGILPTNLYH--YSKEVVDIMVMTGKQFDNLSEDEIDNLP-------------- 719
                +E G  PT + +   SK +++   MTG + + L+  + D+ P              
Sbjct: 998  GEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSE-EELAAAKKDHSPPQGEFAIIIDGEAL 1056

Query: 720  -------------------VLPLVIARCSPQTKVRMIEALHRREKFCAMT---GDGVNDS 757
                                  ++  R SP  K  +++ +  ++    MT   GDG ND 
Sbjct: 1057 KIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLV--KDTLDVMTLAIGDGSNDV 1114

Query: 758  PSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAE 817
              ++ A+VG+ +       A   SD  +    + + L  V  G+     + + + Q   +
Sbjct: 1115 AMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLV-HGKWCYKRLAEMIPQFFYK 1173

Query: 818  NVAQALYLIVGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGL 864
            NV   L L       D +G  +F    +   + +  TS  P + LG+
Sbjct: 1174 NVIFTLALFWYGVHNDFDGSYLFEYTYL-TFYNLAFTS-LPVIFLGI 1218

>ACL130C [919] [Homologous to ScYGR208W (SER2) - SH]
           (124650..125600) [951 bp, 316 aa]
          Length = 316

 Score = 30.4 bits (67), Expect = 8.1,   Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 15/21 (71%)

Query: 748 AMTGDGVNDSPSLKMANVGIA 768
           AM GDG ND P++  A +GIA
Sbjct: 251 AMVGDGANDLPAMHAAGLGIA 271

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 33,234,561
Number of extensions: 1399470
Number of successful extensions: 3848
Number of sequences better than 10.0: 84
Number of HSP's gapped: 3779
Number of HSP's successfully gapped: 177
Length of query: 1071
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 959
Effective length of database: 12,718,893
Effective search space: 12197418387
Effective search space used: 12197418387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)