Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K12012g59158229320.0
Scas_661.2862158326970.0
YDR037W (KRS1)59158226960.0
Sklu_2357.258858226830.0
Kwal_27.1054159158126630.0
AGR037C58958226450.0
KLLA0F18392g58858326000.0
CAGL0J10230g5434856661e-79
KLLA0F04796g5174616422e-76
Scas_633.285924856367e-75
Kwal_23.47175275036134e-72
YNL073W (MSK1)5765025902e-68
AER362W5254735845e-68
CAGL0D06556g5535402211e-18
ADL039C5564872192e-18
Sklu_2189.35584842121e-17
Scas_347.35524791952e-15
YLL018C (DPS1)5574801915e-15
KLLA0D03839g5554811835e-14
Kwal_27.122356502571612e-11
KLLA0A08426g5544701462e-09
YPL104W (MSD1)6581311381e-08
KLLA0A11484g4743531372e-08
Sklu_1963.16551301372e-08
Sklu_2265.35604881344e-08
Kwal_14.23034752691327e-08
YHR019C (DED81)5544711301e-07
KLLA0E24486g6452651292e-07
AGR206C6511181273e-07
Scas_700.66581951167e-06
AEL020W5523381158e-06
CAGL0H05907g6591291095e-05
CAGL0A02112g5484931051e-04
Scas_607.145553391032e-04
Kwal_0.375428320830.048
Kwal_34.16119465163810.089
CAGL0K07656g49767790.15
Scas_707.1449950770.28
AFR516W49950770.29
KLLA0F25234g49950770.29
Kwal_47.1799849950760.42
YFL022C (FRS2)50350740.67
CAGL0L08030g467334711.5
Kwal_34.1598950629711.7
KLLA0F24200g65263702.1
Sklu_2216.214074662.6
YNL077W (APJ1)52847683.1
KLLA0F08371g581153683.3
Scas_628.2448732674.4
CAGL0J09900g283119664.7
AER352C1082263674.7
Scas_710.22112036675.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K12012g
         (582 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K12012g 1159164..1160939 highly similar to sp|P15180 Saccha...  1134   0.0  
Scas_661.28                                                          1043   0.0  
YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase...  1043   0.0  
Sklu_2357.2 YDR037W, Contig c2357 1101-2867                          1038   0.0  
Kwal_27.10541                                                        1030   0.0  
AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH] (775332..77...  1023   0.0  
KLLA0F18392g 1693928..1695694 highly similar to sp|P15180 Saccha...  1006   0.0  
CAGL0J10230g complement(998449..1000080) similar to sp|P32048 Sa...   261   1e-79
KLLA0F04796g complement(466476..468029) similar to sp|P32048 Sac...   251   2e-76
Scas_633.28                                                           249   7e-75
Kwal_23.4717                                                          240   4e-72
YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA syntheta...   231   2e-68
AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH] complement(...   229   5e-68
CAGL0D06556g 623770..625431 highly similar to sp|P04802 Saccharo...    90   1e-18
ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH] (620628..62...    89   2e-18
Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement         86   1e-17
Scas_347.3                                                             80   2e-15
YLL018C (DPS1) [3401] chr12 complement(109901..111574) Aspartyl-...    78   5e-15
KLLA0D03839g 324274..325941 highly similar to sp|P04802 Saccharo...    75   5e-14
Kwal_27.12235                                                          67   2e-11
KLLA0A08426g complement(745048..746712) similar to sp|P38707 Sac...    61   2e-09
YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA synth...    58   1e-08
KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces c...    57   2e-08
Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement         57   2e-08
Sklu_2265.3 YHR019C, Contig c2265 4970-6652                            56   4e-08
Kwal_14.2303                                                           55   7e-08
YHR019C (DED81) [2305] chr8 complement(141886..143550) Asparagin...    55   1e-07
KLLA0E24486g complement(2173560..2175497) similar to sp|P15179 S...    54   2e-07
AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH] (1144536..1...    54   3e-07
Scas_700.6                                                             49   7e-06
AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH] complement...    49   8e-06
CAGL0H05907g complement(579444..581423) similar to sp|P15179 Sac...    47   5e-05
CAGL0A02112g 216596..218242 highly similar to sp|P38707 Saccharo...    45   1e-04
Scas_607.14                                                            44   2e-04
Kwal_0.375                                                             37   0.048
Kwal_34.16119                                                          36   0.089
CAGL0K07656g 761388..762881 highly similar to sp|P15625 Saccharo...    35   0.15 
Scas_707.14                                                            34   0.28 
AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH] complement(...    34   0.29 
KLLA0F25234g complement(2349192..2350691) highly similar to sp|P...    34   0.29 
Kwal_47.17998                                                          34   0.42 
YFL022C (FRS2) [1661] chr6 complement(93497..95008) Phenylalanyl...    33   0.67 
CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces c...    32   1.5  
Kwal_34.15989                                                          32   1.7  
KLLA0F24200g 2257007..2258965 similar to sp|P53918 Saccharomyces...    32   2.1  
Sklu_2216.2 YBR088C, Contig c2216 2801-3223                            30   2.6  
YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by ...    31   3.1  
KLLA0F08371g 779264..781009 no similarity, hypothetical start          31   3.3  
Scas_628.24                                                            30   4.4  
CAGL0J09900g 966959..967810 highly similar to sp|P04840 Saccharo...    30   4.7  
AER352C [2853] [Homologous to ScYMR218C (TRS130) - SH] (1282221....    30   4.7  
Scas_710.22                                                            30   5.1  

>CAGL0K12012g 1159164..1160939 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, start by similarity
          Length = 591

 Score = 1134 bits (2932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/582 (94%), Positives = 548/582 (94%)

Query: 1   MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRM                        
Sbjct: 1   MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMKARQVEAKKAAKKASAQPKPEPKK 60

Query: 61  XXXXXXXXXXPSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGETL 120
                     PSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGETL
Sbjct: 61  KKNDLLADLDPSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGETL 120

Query: 121 PNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGDI 180
           PNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGDI
Sbjct: 121 PNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGDI 180

Query: 181 VGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 240
           VGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM
Sbjct: 181 VGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 240

Query: 241 NKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMFM 300
           NKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMFM
Sbjct: 241 NKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMFM 300

Query: 301 RIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 360
           RIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL
Sbjct: 301 RIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 360

Query: 361 LFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLH 420
           LFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLH
Sbjct: 361 LFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLH 420

Query: 421 TKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 480
           TKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS
Sbjct: 421 TKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 480

Query: 481 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNA 540
           RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNA
Sbjct: 481 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNA 540

Query: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 582
           LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL
Sbjct: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 582

>Scas_661.28
          Length = 621

 Score = 1043 bits (2697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/583 (85%), Positives = 522/583 (89%), Gaps = 1/583 (0%)

Query: 1   MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMXXXXXXXXXXXXXXXXXXX-XXXX 59
           MSQEEA +   E VANLHLDE TGEMVSKSELKKR+                        
Sbjct: 31  MSQEEAVQKVAENVANLHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPESKK 90

Query: 60  XXXXXXXXXXXPSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGET 119
                      PSQYFEARSRQI ELRKT SPNPYPHKF+VSISNPEFL KYA+L+RGET
Sbjct: 91  KKNTDLFADLDPSQYFEARSRQIQELRKTQSPNPYPHKFKVSISNPEFLKKYAYLQRGET 150

Query: 120 LPNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGD 179
           LPNE V+IAGRIHAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY +   YE DHDL+KRGD
Sbjct: 151 LPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDLLKRGD 210

Query: 180 IVGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 239
           IVGVEGYVGRTQPKKGGEGEISVFV RIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI
Sbjct: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 270

Query: 240 MNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMF 299
           MNKD+R RFI RS+II++IR+FLD R+FIEVETPMMNVIAGGATAKPFVTHHNDLDMDM+
Sbjct: 271 MNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 330

Query: 300 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 359
           MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 331 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 390

Query: 360 LLFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQL 419
           L+FSEMVKEI GSY+IKYHPDPNNPEKEMELNF RPWKR+NMIEELEKRFNVTFPAGDQL
Sbjct: 391 LMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQL 450

Query: 420 HTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 479
           HT ETGEFL+KVL DN +ECPPP+TNARMLDKLVGELED CINPTFIFGHPQMMSPLAKY
Sbjct: 451 HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKY 510

Query: 480 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCN 539
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQL+DETFCN
Sbjct: 511 SRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 570

Query: 540 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 582
           ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL
Sbjct: 571 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 613

>YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase,
           cytoplasmic [1776 bp, 591 aa]
          Length = 591

 Score = 1043 bits (2696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/582 (84%), Positives = 523/582 (89%), Gaps = 1/582 (0%)

Query: 1   MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSQ++  KAA EGVANLHLDE TGEMVSKSELKKR+                        
Sbjct: 1   MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPASKK 60

Query: 61  XXXXXXXXXXPSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGETL 120
                     PSQYFE RSRQI ELRKTH PNPYPHKF VSISNPEFLAKYAHLK+GETL
Sbjct: 61  KTDLFADLD-PSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGETL 119

Query: 121 PNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGDI 180
           P E VSIAGRIHAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY D ++YE DHDL+KRGDI
Sbjct: 120 PEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGDI 179

Query: 181 VGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 240
           VGVEGYVGRTQPKKGGEGE+SVFV R++LLTPCLHMLPADHFGFKDQETRYRKRYLDLIM
Sbjct: 180 VGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 239

Query: 241 NKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMFM 300
           NKD+R RFITRS+II+YIR+FLD R FIEVETPMMNVIAGGATAKPF+THHNDLDMDM+M
Sbjct: 240 NKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMYM 299

Query: 301 RIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 360
           RIAPELFLK+LVVGG+DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL
Sbjct: 300 RIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 359

Query: 361 LFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLH 420
           +FSEMVKEI GSY+IKYHPDP +P KE+ELNF+RPWKRINMIEELEK FNV FP+GDQLH
Sbjct: 360 MFSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLH 419

Query: 421 TKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 480
           T ETGEFL+K+L DN LECPPP+TNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS
Sbjct: 420 TAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 479

Query: 481 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNA 540
           RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQL+DETFCNA
Sbjct: 480 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA 539

Query: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 582
           LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL
Sbjct: 540 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 581

>Sklu_2357.2 YDR037W, Contig c2357 1101-2867
          Length = 588

 Score = 1038 bits (2683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/582 (86%), Positives = 518/582 (89%), Gaps = 1/582 (0%)

Query: 1   MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSQEEATKAATE VANLHLDEVTGE VSKSELKKR+                        
Sbjct: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEAKKAAKKANAQPKPETKK 60

Query: 61  XXXXXXXXXXPSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGETL 120
                     PSQYFEARSRQI ELRK+H PNPYPHKF VSIS P+FL KY +LKRGETL
Sbjct: 61  KVDTFADLD-PSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGETL 119

Query: 121 PNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGDI 180
           PNE VSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDY   EAYE DH L+KRGDI
Sbjct: 120 PNEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDI 179

Query: 181 VGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 240
           VGVEGYVGRTQPKKGGEGEISVFV RIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM
Sbjct: 180 VGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 239

Query: 241 NKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMFM 300
           NKD+R RFITRSKII +IRKFLD R FIEVETPMMNVIAGGATAKPFVTHHNDL+MDMFM
Sbjct: 240 NKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM 299

Query: 301 RIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 360
           RIAPELFLK+LVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL
Sbjct: 300 RIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 359

Query: 361 LFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLH 420
           LFSEMVKEI GSYVIKYHP+P NPE EMELNFARPWKRINMIEELEKRFNV FPAGDQLH
Sbjct: 360 LFSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQLH 419

Query: 421 TKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 480
           T ETGEFL+ +L +N +EC PP+TNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS
Sbjct: 420 TAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 479

Query: 481 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNA 540
           RD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDE QLIDETFCNA
Sbjct: 480 RDVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNA 539

Query: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 582
           LEYGLPPTGGWGCG+DRLAMFLTDSNTIREVLLFPTLKPDVL
Sbjct: 540 LEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVL 581

>Kwal_27.10541
          Length = 591

 Score = 1030 bits (2663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/581 (84%), Positives = 515/581 (88%)

Query: 1   MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSQEEA K+A + +ANLHLDE TGEMVSKSELKKR                         
Sbjct: 1   MSQEEAVKSANDAIANLHLDEATGEMVSKSELKKRAKQRQVEAKKAAKKASAQPKPEPKK 60

Query: 61  XXXXXXXXXXPSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGETL 120
                     PSQYFEARSRQI EL+KT SPNPYPHKF VSI   EFL KYAHL+RGETL
Sbjct: 61  KANDAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGETL 120

Query: 121 PNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGDI 180
           P E VSIAGR+HAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY    AYE DHDLIKRGDI
Sbjct: 121 PEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGDI 180

Query: 181 VGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 240
           +GVEGYVGRTQPKKGGEGEISVFV RI+LLTPCLH+LPADHFGFKDQETRYRKRYLDLIM
Sbjct: 181 IGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLIM 240

Query: 241 NKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMFM 300
           NKD+R RFITRSKII YIRKFLD R+FIEVETPMMNVIAGGATAKPFVTHHNDL+MDMFM
Sbjct: 241 NKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM 300

Query: 301 RIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 360
           RIAPELFLKELVVGGM+RVYEIGRQFRNEGIDMTHNPEFTTCEFYQA+ADVYDLMDMTE+
Sbjct: 301 RIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEV 360

Query: 361 LFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLH 420
           LFSEMVKEI GSYVIKYHPDP +P KE+ELNFARPWKRINMIEELEKR NV FPAGD+LH
Sbjct: 361 LFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELH 420

Query: 421 TKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 480
           T ETGEFL++VLK+NNLECPPP+TNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAK S
Sbjct: 421 TAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKKS 480

Query: 481 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNA 540
           RD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQL+DETFCNA
Sbjct: 481 RDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA 540

Query: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDV 581
           LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPD 
Sbjct: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDT 581

>AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH]
           (775332..777101) [1770 bp, 589 aa]
          Length = 589

 Score = 1023 bits (2645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/582 (84%), Positives = 514/582 (88%), Gaps = 1/582 (0%)

Query: 1   MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMXXXXXXXXXXXXXXXXXXXXXXXX 60
           MS+E A +   E VANLHLDEVTGEMVSKSELKKR+                        
Sbjct: 1   MSEEAAVQQVAENVANLHLDEVTGEMVSKSELKKRIKQRQVEAKKAAKKATSKPKPEPKK 60

Query: 61  XXXXXXXXXXPSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGETL 120
                     PS+YFEARSRQI ELRKT  PNPYPHKF V+I  P FL KYAHL+RGETL
Sbjct: 61  KVENMADLD-PSKYFEARSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGETL 119

Query: 121 PNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGDI 180
           P E VSIAGRIHAKRESGSKL+FYVLH DGVEVQVMSQLQDY   EAYE DH L+KRGDI
Sbjct: 120 PEERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDI 179

Query: 181 VGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 240
           VGVEGYVGRTQPKKGGEGEISVFV RI+LLTPCLHMLPADHFGFKDQETRYRKRYLDLIM
Sbjct: 180 VGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 239

Query: 241 NKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMFM 300
           NKD+R RFITRSKII YIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDM M+M
Sbjct: 240 NKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYM 299

Query: 301 RIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 360
           RIAPELFLK+LVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL
Sbjct: 300 RIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 359

Query: 361 LFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLH 420
           LFSEMVKEI G Y IK+HPDPN+P KE ++NFARPWKRINMIEELEKRFNVTFPAGDQLH
Sbjct: 360 LFSEMVKEITGDYKIKFHPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLH 419

Query: 421 TKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 480
           T ETGEFL+K+L DN ++CPPP+TNARMLDKLVGELEDTCI+PTFIFGHPQMMSPLAK+S
Sbjct: 420 TAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHS 479

Query: 481 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNA 540
           RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNA
Sbjct: 480 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNA 539

Query: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 582
           LEYGLPPTGGWGCG+DRLAMFLTDSNTIREVLLFPTLKPDVL
Sbjct: 540 LEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVL 581

>KLLA0F18392g 1693928..1695694 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 588

 Score = 1006 bits (2600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/583 (83%), Positives = 514/583 (88%), Gaps = 1/583 (0%)

Query: 1   MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMXXXXXXXXXXXXXXXXXXXXX-XX 59
           MSQ     AATE VAN+HLDE+TGEMVSKSELKKR+                        
Sbjct: 1   MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQVEAKKAAKKATAKPTPEPKK 60

Query: 60  XXXXXXXXXXXPSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGET 119
                      PSQYFEARSRQI ELRKTHSPNPYPHKFQVS++ PEFL+KYA+LKRGET
Sbjct: 61  KANTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET 120

Query: 120 LPNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGD 179
           LP E VSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDY    +YE+DH LIKRGD
Sbjct: 121 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD 180

Query: 180 IVGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 239
           IVGVEGYVGRT PKKGGEGEISVFV RI+LLTPCLHMLP DHFGFKDQE RYRKRYLDLI
Sbjct: 181 IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI 240

Query: 240 MNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMF 299
           MNKD+R RFITRSKII Y+RKFLD R+FIEVETPMMNVIAGGATAKPFVTHHNDLDMDM+
Sbjct: 241 MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 300

Query: 300 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 359
           MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 301 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 360

Query: 360 LLFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQL 419
           ++ SEMVKEI GSYVIKYHPDPN+  KE+ELNF RPWKRINMIEELE RF+VTFPAGDQL
Sbjct: 361 IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL 420

Query: 420 HTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 479
           HT ETGEFL+KVLKDN ++C PP+TNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY
Sbjct: 421 HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 480

Query: 480 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCN 539
           SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQA QK QGDDEAQL+DETFCN
Sbjct: 481 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN 540

Query: 540 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 582
           ALEYGLPPTGGWGCGIDRLAMFL DSNTIREVLLFPTLKP+V+
Sbjct: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLKPEVV 583

>CAGL0J10230g complement(998449..1000080) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1, hypothetical
           start
          Length = 543

 Score =  261 bits (666), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 172/485 (35%), Positives = 264/485 (54%), Gaps = 28/485 (5%)

Query: 107 FLAKYAHLKRGE-TLPNEIVSIAGRIHAKRESGSKLKFYVLHGDGVE-VQVMSQLQDYAD 164
           FL KY      +    N+ +S+ GRI + R SG K+ F  L  DG+  +Q++   ++  +
Sbjct: 67  FLKKYGSTSEDQLNKINQKISLCGRIKSIRFSGKKMAFIDLV-DGIHGIQLILNCREIGN 125

Query: 165 AEAYENDHDLIKRGDIVGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHM-LPADHFG 223
           +  +E++   +++GD V   G     +  K     IS+    +  +     M LP     
Sbjct: 126 SATFESELSFLRKGDYVMTTGL---PRLSKSRMKNISLRCTDLPKILSVAQMPLPPKLI- 181

Query: 224 FKDQETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGAT 283
             D       + +D  +N     R   RS I+K IR FL+ RDFIEVETP+++  + GA 
Sbjct: 182 --DTVKSNSNKVVDYQINGFQNIRI--RSSILKSIRNFLEERDFIEVETPILSSKSNGAV 237

Query: 284 AKPFVTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCE 343
           AKPF++   D D  + +R+APEL+LK L++ G ++V+EIG+ FRNEGID +HNPEFTT E
Sbjct: 238 AKPFMSSSKDFD-KLMLRVAPELWLKRLIISGCNKVFEIGKSFRNEGIDGSHNPEFTTLE 296

Query: 344 FYQAYADVYDLMDMTELLFSEMVKEINGSYVIKYHPDPNNPEKEMELN---FARPW--KR 398
           FYQ+Y  + DL+ + E LF +++ ++  +  IK +     PE  +EL     +  W  KR
Sbjct: 297 FYQSYLTMEDLIKLNEDLFKKIITDLTNNLTIKQYL----PESLLELEDILKSNNWKFKR 352

Query: 399 INMIEELEKRFNVTFPAGDQLHTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGEL-- 456
           +  +  L K   V         +K+  E + +  K          +++++L++L  EL  
Sbjct: 353 VEFLPTLSKELGVDLSQVKIEDSKQLLEVIPQKYKGQFFGKSSSYSSSQILNRLCSELIE 412

Query: 457 EDTC--INPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRA 514
           E  C   +PT I+ HP ++SPLAK + D     +RFE+F+  +E  NAY E N P  Q  
Sbjct: 413 EKYCNSSHPTIIYHHPAVISPLAKSNPDDSRTTKRFELFIKGREYSNAYEEENCPQVQLE 472

Query: 515 RFEEQARQK-DQGD-DEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVL 572
           +FE+QAR K D GD D    ID+ + NA+++G+PP GG+G GIDRL M +T    I +VL
Sbjct: 473 KFEQQARMKEDYGDNDTLSSIDQEYINAMKWGMPPIGGFGLGIDRLCMLITGCQRIEQVL 532

Query: 573 LFPTL 577
            F TL
Sbjct: 533 PFGTL 537

>KLLA0F04796g complement(466476..468029) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1 lysyl-tRNA
           synthetase, mitochondrial, hypothetical start
          Length = 517

 Score =  251 bits (642), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 162/461 (35%), Positives = 252/461 (54%), Gaps = 30/461 (6%)

Query: 126 SIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDY-ADAEAYENDHDLIKRGDIVGVE 184
           ++ G+I   R SG K+ F  L  D   +QV+  L +       ++      K GD + V 
Sbjct: 72  TLRGKITNMRFSGKKIGFINLLNDEKSLQVIVNLSNLPMSVGEFQAHMRKFKIGDHIQVT 131

Query: 185 GYVGRTQPKKGGEGEISVFV-KRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKD 243
           G+ G +Q     +G +S+ V   +++L+P    +P       D   R   + LD ++N  
Sbjct: 132 GFPGVSQK----QGTLSLKVNSELKMLSPAQIPIPPKLL---DSSKRNSNKTLDYLVN-- 182

Query: 244 SRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMD--MFMR 301
             +    R  + K IR++L  ++FIEVETP+++  + GA AKPF+TH   +D +    +R
Sbjct: 183 GTEAIYIRHLVTKRIREWLYKQEFIEVETPIISSKSNGANAKPFITHCTAIDKEQPFELR 242

Query: 302 IAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL 361
           IAPEL+LK L +GGM++++EIG+ FRNEGID THNPEFTT EFYQ Y ++  L++M+E L
Sbjct: 243 IAPELWLKRLCIGGMNKIFEIGKVFRNEGIDSTHNPEFTTLEFYQCYINMEQLIEMSESL 302

Query: 362 FSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLHT 421
              + + I+        P       +++ N  + +KR+  +  L ++  + F   D    
Sbjct: 303 LIYVCQGID-------KPKAQELLDQIKANNGK-FKRLEFLPTLTQKTGIDFDNMDL--- 351

Query: 422 KETGEFLQKVLKDNNLECP-PPITNARMLDKLVGE-LEDTC--INPTFIFGHPQMMSPLA 477
               E L++ L+  N+      ++  ++LD+L G+ +E  C  + PT I+ HP ++SPLA
Sbjct: 352 -NNAELLKEKLRKANISISESSVSPQQILDELCGKYIESQCDTLLPTIIYHHPTVLSPLA 410

Query: 478 KYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQ-GDDEAQLIDET 536
           K   +   + +RFE+F+  KE  NAY E N P  Q  +F  Q   K Q  DDE   +D  
Sbjct: 411 KTDSNNVQITKRFEIFINRKEYMNAYEEENCPDLQLEKFTNQLASKTQFKDDEMMAVDLP 470

Query: 537 FCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTL 577
           +  A++YG+PP GG+G GIDRL M L D+  I EVL F TL
Sbjct: 471 YVQAMKYGMPPIGGFGLGIDRLCMLLADTQRIEEVLSFGTL 511

>Scas_633.28
          Length = 592

 Score =  249 bits (636), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 170/485 (35%), Positives = 261/485 (53%), Gaps = 46/485 (9%)

Query: 117 GETLPNEIVSIAGRIHAKRESGSKLKFYVLHGD--GVEVQV---MSQLQDYADAEAYEND 171
           GE      + + GRI   R SG K+ F  L      V++QV   +++L+     E ++  
Sbjct: 118 GEDDYKSFLQLNGRIKNIRYSGKKIAFIDLFDSRYNVKIQVILNLNKLKQETSEERFQEV 177

Query: 172 HDLIKRGDIVGVEGYVGRTQPK------KGGEGEISVFVKRIELLTPCLHMLPADHFGFK 225
             L+K+GD +   G  G ++ +      KG +  +        LL+   + LP+     K
Sbjct: 178 VQLLKKGDYIKAFGIPGFSESRSHTLSLKGTKLPV--------LLSAAQYPLPSQ---LK 226

Query: 226 DQETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAK 285
           D+    + R LD  +N  S    + RS II+ +R FLD ++FIEVETP+++  + GA A+
Sbjct: 227 DELKARKNRVLDYQVNGVSS--LLLRSNIIRLLRSFLDKQEFIEVETPILSSKSNGANAR 284

Query: 286 PFVTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFY 345
           PF+T    L+ ++ +RIAPEL+LK L++ G+DRVYEIG+ FRNEG+D THNPEFT  EFY
Sbjct: 285 PFITKSGSLNENLELRIAPELWLKRLIISGLDRVYEIGKVFRNEGVDSTHNPEFTLLEFY 344

Query: 346 QAYADVYDLMDMTELLFSEMVK--EINGSYVIKYHPDP--NNPEKEMELNFARPWK--RI 399
           + Y  + DL++ +E LF  ++   E+  S   +YH  P  +N  + +E      WK  RI
Sbjct: 345 ERYLSMTDLIEKSEDLFKHILVNLELKKS---EYHFSPAFDNLYRTLE---QANWKFRRI 398

Query: 400 NMIEELEKRFNVTFPAGDQLHTKETGEFLQKVLKDNNLECPPP--ITNARMLDKLVGELE 457
             +  L +  N+ F   D    ++  E L    +    E  PP  +++ ++L+KL     
Sbjct: 399 EFLPTLSQELNIDFSLIDLNDAEKLLESLPAHSRKELFENVPPGELSSQQILNKLCSFYL 458

Query: 458 DT----CINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQR 513
           ++     I+PT IF HP+++SPLAK       + +RFE+F+  KE  NAY E N P  Q 
Sbjct: 459 ESRYCDTIHPTIIFHHPRIISPLAKAHPSNQQITKRFEMFINGKEYINAYEEENCPQLQE 518

Query: 514 ARFEEQARQ----KDQGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIR 569
             F+ Q       K++ +DE    DE F NA++ G+PP GG+G G+DRL M L +   I 
Sbjct: 519 KNFQLQQFSKETIKNKENDELISPDEGFINAMKSGMPPVGGFGLGVDRLCMLLMNKGRIE 578

Query: 570 EVLLF 574
           +VL F
Sbjct: 579 DVLPF 583

>Kwal_23.4717
          Length = 527

 Score =  240 bits (613), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 167/503 (33%), Positives = 266/503 (52%), Gaps = 42/503 (8%)

Query: 94  YPHKFQVS---ISNPEFLAKYAHLKRGETLPNEIVSIAGRIHAKRESGSKLKFYVLHGDG 150
           YP   ++S    +  EF  KY  L   +   +E+  +  RI + R SG  + F  +    
Sbjct: 42  YPSLSKISPATTTVSEFKQKYQALHEDQPQSSEV--LRARIDSVRISGKNMCFVDVSNAR 99

Query: 151 VEVQVMSQLQDYADA---------EAYENDHDLIKRGDIVGVEGYVGRTQPKKGGEGEIS 201
             VQ++        A         + +++  DL + GD +   G+ G +Q ++    + +
Sbjct: 100 NSVQLILNYNVMKTAMPSSALTREQFFQHVQDL-RPGDHIQACGFPGLSQRERTLSLKCT 158

Query: 202 VFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKF 261
              K  E+L P L  +P       D   R   R LD ++N    +  + R ++   IR+F
Sbjct: 159 ---KLTEILAPALLAVPPK---LTDPAKRNTNRVLDYLVN--GHETLVVRHQVNTAIREF 210

Query: 262 LDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYE 321
           L+ R F+EVETP+++  A GA A+PF T     + ++ +R+APEL+LK LVV G++RVYE
Sbjct: 211 LNMRGFLEVETPVLSSKANGAAAEPFSTRTKATNAELELRVAPELWLKRLVVAGVNRVYE 270

Query: 322 IGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEINGSYVIKYHPDP 381
           +G+ FRNEG+D THNPEFTT EFYQ+YA + +L++++E L+  ++  ++  +  +     
Sbjct: 271 LGKVFRNEGVDATHNPEFTTLEFYQSYASMDELIELSEQLYLHVLNRVDNRFAREL---- 326

Query: 382 NNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLHTKETGEFLQKVLKDNNLECPP 441
               K   L  A  +KR+  +  L +   V F   D LH     + + + L   N+    
Sbjct: 327 ----KNELLANAGKFKRVEFLPTLLRETGVDFTQID-LH---NSDLISRALIAKNIHMDT 378

Query: 442 PITN-ARMLDKLVGELEDT--CIN--PTFIFGHPQMMSPLAKYSRDQPGL-CERFEVFVA 495
              +  ++LD L G   +   C +  PT I+ HP +MSPLAK + D   L  +RFEVF+ 
Sbjct: 379 TGKSPQQILDMLCGRFIENKYCTSSLPTVIYHHPTVMSPLAKGNPDDNMLTTKRFEVFIN 438

Query: 496 TKEICNAYTELNDPFDQRARFE-EQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCG 554
            KE  NAY E N P +Q  +FE +++ Q+  GD E+  +D ++  A+++G+PP GG+G G
Sbjct: 439 GKEYINAYEEENCPQEQLQKFELQKSAQETYGDRESLAVDYSYVEAMKWGMPPIGGFGLG 498

Query: 555 IDRLAMFLTDSNTIREVLLFPTL 577
           IDRL M LT +  I  VL F T+
Sbjct: 499 IDRLCMLLTGNKRIERVLSFGTI 521

>YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA synthetase,
           mitochondrial [1731 bp, 576 aa]
          Length = 576

 Score =  231 bits (590), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 167/502 (33%), Positives = 254/502 (50%), Gaps = 46/502 (9%)

Query: 104 NPEFLAKYAHLKRGETLPNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQ--- 160
           N  FL   A L   E  PN ++SI GRI + R SG K+ F  L+     ++  +QLQ   
Sbjct: 81  NERFLGNPATLHH-EDNPNLLLSINGRIKSIRFSGQKIVFIDLYNGSSGLKNDTQLQLIV 139

Query: 161 ----------DYADAEAYENDHDLIKRGDIVGVEGYVGRTQPKKGGEGEISVFVKRIELL 210
                     D A+   Y N    +K+GD +   GY G +Q +      +S+   ++ ++
Sbjct: 140 NYNKIGGSSEDKANFSEYMN---FLKKGDYIKALGYPGFSQSR---VKMLSLICNKLPIV 193

Query: 211 TPCLHM-LPADHFGFKDQETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIE 269
                + LP+      D+      R +D  +N    +  + R++IIK +RKFLD+R+F+E
Sbjct: 194 LSVSQLPLPSR---LNDETKIKSNRVVDYQLN--GTQTLLVRARIIKLLRKFLDDRNFVE 248

Query: 270 VETPMMNVIAGGATAKPFVTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNE 329
           VETP+++  + GA AKPF+T   D D  + +RIAPEL+LK L++ G+ +VYEIG+ FRNE
Sbjct: 249 VETPILSSKSNGAMAKPFITSSKDFD-HLELRIAPELWLKRLIISGLQKVYEIGKVFRNE 307

Query: 330 GIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEINGSYVIKYHPDPNNPEKEME 389
           GID THN EF+T EFY+ Y  + D++  TE LF  ++  +   +     P P     E+ 
Sbjct: 308 GIDSTHNAEFSTLEFYETYMSMDDIVTRTEDLFKFLITNLQKFFQDTRLPVPKT-FSELH 366

Query: 390 LNFA-RPWK--RINMIEELEKRFNVTFPAGDQLHTKETGEFLQKVLKDNNLECPPPITNA 446
           L  +   WK  ++  +  L K   +       L   +  E L+ + KD   +  P   N 
Sbjct: 367 LALSENNWKFRKVEFLPTLNKELGIDL-MNSGLDINKPSELLKALPKDIAKKYFPSADNT 425

Query: 447 RMLDKL--VGELEDTCIN--------PTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVAT 496
             L  L  + +L D  +         PT I+  P ++SPLAK       + +RFEVF+  
Sbjct: 426 GQLSSLQILNKLSDVFLEQRHCQSTLPTVIYHQPAILSPLAKTDPQNKQVTKRFEVFIKG 485

Query: 497 KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQ----LIDETFCNALEYGLPPTGGWG 552
           KE  NAY E N P  Q  +F +Q +  +   ++ +    +ID  +   ++YG+PP GG+G
Sbjct: 486 KEYINAYEEENCPQLQLQKFLQQKQINELTGNKTETLSPVIDYQYVETMKYGMPPVGGFG 545

Query: 553 CGIDRLAMFLTDSNTIREVLLF 574
            GIDRL M   D   I EVL F
Sbjct: 546 LGIDRLCMLFCDKKRIEEVLPF 567

>AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH]
           complement(1309431..1311008) [1578 bp, 525 aa]
          Length = 525

 Score =  229 bits (584), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 160/473 (33%), Positives = 237/473 (50%), Gaps = 44/473 (9%)

Query: 121 PNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQ----LQDYADAEAYENDHDLIK 176
           P     I G+I   R  G  + F  L   G  +Q+M               ++N    ++
Sbjct: 75  PERTYVINGQIRGIRVVGRSMCFVDLQQQGSALQLMVNHSLVRAQLVAKRPFQNAIAGLR 134

Query: 177 RGDIVGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFG----FKDQETRYR 232
            GD V   G+ G ++ ++     +S+  +++        ML A          D+  R +
Sbjct: 135 LGDHVQPTGFPGLSKTER----TLSLKCRKVP------RMLAAAQIAIPQRLTDRVKRQQ 184

Query: 233 KRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHN 292
            R LD ++N      F  R K +  +R +L+ R F+EVETPM++  + GA A PFVTH  
Sbjct: 185 NRTLDYLVNGLKVLEF--RHKALTALRAYLNRRGFLEVETPMLSAKSSGANATPFVTHLR 242

Query: 293 DLDMDMF-MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADV 351
             D     +RIAPEL+LK L VGG  RVYEIG+ FRNEGID THNPEFTT E YQ YA +
Sbjct: 243 GQDKQALELRIAPELWLKRLCVGGAQRVYEIGKVFRNEGIDATHNPEFTTLELYQCYAPL 302

Query: 352 YDLMDMTELLFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNV 411
            +L+++ ++L  ++   ++        P       EM  N    ++R+  +  L +   V
Sbjct: 303 DELLELAQVLLRDICVAVD-------TPVSRQLLAEMAQNGG-AFRRVEFLPTLSRETGV 354

Query: 412 TFPAGDQLHTKETGEFLQKVLKDNNLECPPPITN-ARMLDKLVGE-LED---TCINPTFI 466
            + A D   +      ++  L    ++ P  I +  ++L+KL  + +ED     + PT I
Sbjct: 355 DWAAVDLADSTA----IRVALSGAGIDVPESIVSPQQILNKLCADYIEDRYCQSLLPTAI 410

Query: 467 FGHPQMMSPLAKYSRDQPGL-CERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQ 525
             HP +MSPLAK +    GL   RFE+FV  +E+ NAY E N P +Q  + + Q R ++Q
Sbjct: 411 LHHPAVMSPLAKSA----GLVANRFELFVCGRELINAYEEENCPQEQLKKMQLQQRHREQ 466

Query: 526 -GDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTL 577
             D E+  ID  +  A++YG+PP GG G GIDRL M L     I EVL F  L
Sbjct: 467 FHDQESMQIDHHYIEAMKYGMPPIGGLGLGIDRLCMLLLAKARIEEVLPFGCL 519

>CAGL0D06556g 623770..625431 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1, start by
           similarity
          Length = 553

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 127/540 (23%), Positives = 218/540 (40%), Gaps = 94/540 (17%)

Query: 76  EARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGETLPNEIVSIAGRIHAKR 135
           +A++ ++    + + P P+    Q      E   K+  L + +   ++ V    R+H  R
Sbjct: 60  QAKANEVDHSAENYGPAPF---VQSQFRTGEKRVKFEDLSKEDA--DKEVLFRARVHNTR 114

Query: 136 ESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRG------DIVGVEGYVGR 189
           + G+ L F  L      +Q + +    AD    +   +++K         IV V G V  
Sbjct: 115 QQGATLAFLTLRQQSSLIQALVK----ADKAGEKISKNMVKWAGSLNLESIVLVRGIVKV 170

Query: 190 T-QPKKGGE-GEISVFVKRIELLTPCLHMLP------------ADHFGFK--DQETRYRK 233
             +P K     ++ + V +I  ++     LP            A+  G    + +TR   
Sbjct: 171 VDEPIKSATIQDLEIHVTQIHTISETPETLPILIEDASRSEAEAEAAGLPVVNLDTRLDN 230

Query: 234 RYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPF-VTHHN 292
           R +DL     ++  F  +  +    R+FL N+ F+EV TP M   A    A  F VT+  
Sbjct: 231 RVIDL-RTVTNQAIFRIQHGVCALFREFLANKKFVEVHTPKMLGAASEGGANVFEVTYFK 289

Query: 293 DLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCEFYQAYADV 351
                 ++  +P+   ++L+V   ++V+EIG  FR E  +   H  EFT  +   A+ + 
Sbjct: 290 G---KAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEH 346

Query: 352 Y-DLMDMTELLFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELE---- 406
           Y +++D+   LF  +  E+   Y            KE+EL      ++   +EE +    
Sbjct: 347 YHEVLDVLSELFVFLFTELKKRYA-----------KEIEL-----VRKQYPVEEFKLPKD 390

Query: 407 -KRFNVTFPAGDQLHTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTC----- 460
            K   +T+  G Q+  KE G+ +    +D + E      N + L KLV E  DT      
Sbjct: 391 GKMVRITYKEGIQM-LKEAGKDIGD-FEDLSTE------NEKFLGKLVREKYDTDFYILD 442

Query: 461 -----INPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRAR 515
                I P +    P+            P     ++ F+  +EI +    ++D    +  
Sbjct: 443 KFPLEIRPFYTMPDPE-----------DPRYSNSYDFFMRGEEILSGAQRIHD---HKML 488

Query: 516 FEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
            E   R K  G D      + +C+   YG PP  G G G++R+ MF  D   IR   LFP
Sbjct: 489 ME---RMKVHGLDPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFFLDLKNIRRASLFP 545

>ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH]
           (620628..622298) [1671 bp, 556 aa]
          Length = 556

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 115/487 (23%), Positives = 197/487 (40%), Gaps = 82/487 (16%)

Query: 125 VSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGD----- 179
           V +  R+H  R+ G+ L F +L      +Q + +    A+AE   +   +   G      
Sbjct: 108 VLLRSRVHTVRQQGATLAFLMLRQRSSLIQALVK----ANAEGTVSKQMVKWAGSLNLES 163

Query: 180 IVGVEGYVGRTQP--KKGGEGEISVFVKRIELLTPCLHMLP------------ADHFGFK 225
           IV V G V + +   K     +  + + ++  ++     LP            A+  G  
Sbjct: 164 IVLVRGVVRKVEEPVKSATVQDFEIQITQLHTISETPQQLPILIEDASRSEAEAEAAGLP 223

Query: 226 --DQETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGAT 283
             + +TR   R +DL     ++  F  ++ +    R+F  +R+F E+ TP +        
Sbjct: 224 VVNLDTRLDARVIDL-RTVTNQAIFRIKAGVCGLFREFFQSRNFTEIHTPKLLASPSEGG 282

Query: 284 AKPFVTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTC 342
           A  F   +     + ++  +P+ + ++L+    +RV+E+   FR E  +   H  EFT  
Sbjct: 283 ANVFEVKY--FKGNAYLAQSPQFYKQQLIAADFERVFEVAPVFRAENSNTHRHMTEFTGV 340

Query: 343 E----FYQAYADVYDLM-DMTELLFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWK 397
           +    F + Y +V ++M +M   +F+E+ K                        FAR   
Sbjct: 341 DLEMAFEEHYHEVIEVMGEMFMFVFTELKK-----------------------RFARE-- 375

Query: 398 RINMIEELEKRFNV---TFPAGDQ---LHTKETGEFLQKVLKDNNLECPPPITNARMLDK 451
               I ++ K++ V    FPA  +   LH KE    L++  K+          N R L K
Sbjct: 376 ----IAQVRKQYPVEEFKFPADGKMVILHYKEGIAMLREAGKEIGDFDDLSTENERFLGK 431

Query: 452 LVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPG---LCERFEVFVATKEICNAYTELND 508
           LV E  DT       F  P  + P   Y+   P        ++ F+  +EI +    ++D
Sbjct: 432 LVREKYDTDFYILDKF--PAELRPF--YTMPDPADPRYSNSYDFFMRGEEIMSGAQRIHD 487

Query: 509 PFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTI 568
           P   R R +    Q +    +A   D  +C+A  YG PP  G G G++R+ MF  D   I
Sbjct: 488 PELLRERMKHHGLQPE----DAGFKD--YCDAFTYGCPPHAGGGIGLERIVMFYLDLKNI 541

Query: 569 REVLLFP 575
           R   LFP
Sbjct: 542 RRATLFP 548

>Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement
          Length = 558

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 108/484 (22%), Positives = 195/484 (40%), Gaps = 76/484 (15%)

Query: 125 VSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQL-QDYADAEAYENDHDLIKRGDIVGV 183
           V    R+H  R+ G+ L F  L      +Q + +  ++   ++        I    IV V
Sbjct: 110 VVFRARVHNSRQQGATLNFLTLRQQAELIQALVKSNKEGTVSKQMVKWTSSINLESIVLV 169

Query: 184 EGYVGRTQP--KKGGEGEISVFVKRIELLTPCLHMLP------------ADHFGFK--DQ 227
            G V + +   K      + + + +I  ++     +P            A+  G    + 
Sbjct: 170 HGIVRKVEEPIKSATVQNLEIHITKIFTISETPQQMPILLEDASRSEAEAEAAGLPVVNL 229

Query: 228 ETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPF 287
           +TR   R +DL     ++  F  +S + +  R+FL NRDF E+ TP +        A  F
Sbjct: 230 DTRLDARVIDL-RTVTNQAIFKIQSGVCELFREFLRNRDFTEIHTPKLLGSPSEGGANVF 288

Query: 288 -VTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCEFY 345
            VT+      + ++  +P+++ +EL+    +RV+E+G  FR E  +   H  EFT  +  
Sbjct: 289 EVTYFKG---NSYLAQSPQIYKQELIAADFERVFEVGPVFRAENSNTHRHMTEFTGLDLE 345

Query: 346 QAYADVYD-LMDMTELLFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEE 404
            A+ + YD ++D+   LF  +  E+   Y                       K I ++ +
Sbjct: 346 MAFEEHYDEVLDVLSELFVFIFTELKSRY----------------------SKEIALVRK 383

Query: 405 LEKRFNVTFPAGDQ---LHTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDT-- 459
                +   P   +   LH K+    L++  K  +        N ++L KLV E  DT  
Sbjct: 384 QYPVEDFKLPKDGKMVRLHFKDGIAMLREAGKQVDDFEDLSTENEKLLGKLVREKYDTDF 443

Query: 460 --------CINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFD 511
                    + P +    P+     ++YS         ++ F+  +EI +    ++D   
Sbjct: 444 YILDKFPLAVRPFYTMPDPED----SRYSNS-------YDFFMRGEEILSGAQRIHDS-- 490

Query: 512 QRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREV 571
                +E+ +  +   ++  L D  +C+A  YG PP  G G G++R+ MF  D   IR  
Sbjct: 491 --EFLKERMKVHELSPEDPGLKD--YCDAFTYGCPPHAGGGIGLERVVMFYLDLKNIRRA 546

Query: 572 LLFP 575
            LFP
Sbjct: 547 SLFP 550

>Scas_347.3
          Length = 552

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 107/479 (22%), Positives = 189/479 (39%), Gaps = 66/479 (13%)

Query: 125 VSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQ-DYADAEAYENDHDLIKRGDIVGV 183
           V    R+H  R+ G+ L F         +Q + ++Q D + ++        +    IV V
Sbjct: 104 VVFRARVHNTRQQGATLSFLTFRQQHDLIQGLVKVQKDGSVSKQMVKWAGSLNLESIVVV 163

Query: 184 EGYVGRTQP--KKGGEGEISVFVKRIELLTPCLHMLP------------ADHFGFK--DQ 227
           +G V R +   K     ++ + +  I  ++     LP            A+  G    + 
Sbjct: 164 KGIVKRVEEPIKSATVQDLEIHITDIHSISETPETLPILLEDASRSEAEAEAAGLPVVNL 223

Query: 228 ETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPF 287
           +TR   R +DL     ++  F  +S + +  R++L    F EV TP +        A  F
Sbjct: 224 DTRLDARVIDL-RTVTNQAIFKIQSGVCQLFREYLSGLKFTEVHTPKLLGAPSEGGASVF 282

Query: 288 VTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCE--- 343
              +       ++  +P+   ++L+V   ++V+EIG  FR E  +   H  EFT  +   
Sbjct: 283 EVSY--FKGKAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRHMTEFTGLDMEM 340

Query: 344 -FYQAYADVYDLM-DMTELLFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINM 401
            F + Y +V D++ D+   +F+E+ K  +                          K I +
Sbjct: 341 AFEEHYHEVLDVLSDLFVFIFTELKKRFS--------------------------KEIEI 374

Query: 402 IEELEKRFNVTFPAGDQLHTKETGEFLQKVLKDNNLECPP----PITNARMLDKLVGELE 457
           + +     +   PA  ++   +  E +Q +LKD   E          N + L KLV E  
Sbjct: 375 VRKQYPVEDFKLPADGKMVRIQYKEGIQ-MLKDAGKEIGDFDDLSTENEKFLGKLVREKY 433

Query: 458 DTCINPTFIFGHPQMMSPLAKY-SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARF 516
           DT       F  P  + P       + P     ++ F+  +EI +    ++D     A  
Sbjct: 434 DTDFYILDKF--PLAIRPFYTMPDAEDPRYSNSYDFFMRGEEILSGAQRIHD----HALL 487

Query: 517 EEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
           +E+ +      ++  L D  +C+   YG PP  G G G++R+ MF  D   IR   LFP
Sbjct: 488 QERMKVHGLSSEDPGLKD--YCDGFSYGCPPHAGGGIGLERVVMFFLDLKNIRRASLFP 544

>YLL018C (DPS1) [3401] chr12 complement(109901..111574)
           Aspartyl-tRNA synthetase, cytoplasmic [1674 bp, 557 aa]
          Length = 557

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 112/480 (23%), Positives = 197/480 (41%), Gaps = 68/480 (14%)

Query: 125 VSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGD----- 179
           V    R+H  R+ G+ L F  L      +Q + +    A+ E   + + +   G      
Sbjct: 109 VLFRARVHNTRQQGATLAFLTLRQQASLIQGLVK----ANKEGTISKNMVKWAGSLNLES 164

Query: 180 IVGVEGYVGRT-QPKKGGEGE-ISVFVKRIELLTPCLHMLP------------ADHFGFK 225
           IV V G V +  +P K    + + + + +I  ++     LP            A+  G  
Sbjct: 165 IVLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAAGLP 224

Query: 226 --DQETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETP-MMNVIAGGA 282
             + +TR   R +DL     ++  F  ++ + +  R++L  + F EV TP ++   + G 
Sbjct: 225 VVNLDTRLDYRVIDL-RTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGG 283

Query: 283 TAKPFVTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTT 341
           ++   VT+        ++  +P+   ++L+V   +RVYEIG  FR E  +   H  EFT 
Sbjct: 284 SSVFEVTYFKG---KAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHMTEFTG 340

Query: 342 CE----FYQAYADVYD-LMDMTELLFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPW 396
            +    F + Y +V D L ++   +FSE+ K       +        P +E +L      
Sbjct: 341 LDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIELVRK---QYPVEEFKLPKDGKM 397

Query: 397 KRINMIEELEKRFNVTFPAGD-QLHTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGE 455
            R+   E +E         GD +  + E  +FL K+++D         T+  +LDK   E
Sbjct: 398 VRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKY------DTDFYILDKFPLE 451

Query: 456 LEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRAR 515
                I P +    P             P     ++ F+  +EI +    ++D     A 
Sbjct: 452 -----IRPFYTMPDPA-----------NPKYSNSYDFFMRGEEILSGAQRIHD----HAL 491

Query: 516 FEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
            +E+ +      ++  L D  +C+   YG PP  G G G++R+ MF  D   IR   LFP
Sbjct: 492 LQERMKAHGLSPEDPGLKD--YCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFP 549

>KLLA0D03839g 324274..325941 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1 aspartyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 555

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 110/481 (22%), Positives = 192/481 (39%), Gaps = 70/481 (14%)

Query: 125 VSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDL-----IKRGD 179
           V    R+H  R+ G+ L F  L      +Q + +    A+ E   +   +     I    
Sbjct: 107 VVFRARVHNSRQQGATLAFLTLRQQAELIQGLVK----ANKEGTVSKQMVKWVGSINLES 162

Query: 180 IVGVEGYVGRTQP--KKGGEGEISVFVKRIELLTPCLHMLP------------ADHFGFK 225
           IV V G V + +   K      + V + +I  ++     LP            A+  G  
Sbjct: 163 IVVVHGIVKKVEEPIKSATVQNLEVHITKIYTISETPEQLPILIEDASRSEAEAEAAGLP 222

Query: 226 --DQETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETP-MMNVIAGGA 282
             + +TR   R +DL     ++  F  +S +    R+FL N+ F EV TP ++   + G 
Sbjct: 223 VVNLDTRLDSRVIDL-RTVTNQAIFRIQSGVCALFREFLTNKKFTEVHTPKLLGAPSEGG 281

Query: 283 TAKPFVTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTT 341
           +    VT+        ++  +P+L+ ++L+    +RV+E+   FR E  +   H  EFT 
Sbjct: 282 SNVFEVTYFKG---KSYLAQSPQLYKQQLIAADFERVFEVAPVFRAENSNTHRHMTEFTG 338

Query: 342 CEFYQAYADVYD-LMDMTELLFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRIN 400
            +   A+ + YD ++D    LF  +  ++   Y            KE+ L      ++  
Sbjct: 339 LDLEMAFEEHYDEVVDTLAELFVFIFSQLKTRYA-----------KEIAL-----VRKQY 382

Query: 401 MIEELE-----KRFNVTFPAGDQLHTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGE 455
            +EE +     K   + F  G  L        L++  KD +        N ++L KLV +
Sbjct: 383 PVEEFKLPKDGKMVRIPFKEGIAL--------LREAGKDVDDFEDLSTENEKLLGKLVRD 434

Query: 456 LEDTCINPTFIFGHPQMMSPLAKY-SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRA 514
             +T       F  P  + P       + P     ++ F+  +EI +    ++D      
Sbjct: 435 KYETDFYILDKF--PLAIRPFYTMPDAEDPRYSNSYDFFMRGEEILSGAQRIHDA----D 488

Query: 515 RFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLF 574
             +E+    +   ++  L D  +C A  YG PP  G G G++R+ MF  D   IR   LF
Sbjct: 489 LLKERMNAHEVHPEDPGLKD--YCEAFTYGCPPHAGGGIGLERVVMFYLDLKNIRRASLF 546

Query: 575 P 575
           P
Sbjct: 547 P 547

>Kwal_27.12235
          Length = 650

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 113/257 (43%), Gaps = 23/257 (8%)

Query: 125 VSIAGRIHAK-RESGSKLKFYVLH---GDGVEVQVMSQLQDYADAEAYENDHDLIKRGDI 180
           V + G I  K ++ G  L F VL    GD +++     L   A+ E            D+
Sbjct: 50  VILNGWIDKKPKKVGKDLNFGVLRDPEGDLIQLVDSQSLLKAANVE------------DV 97

Query: 181 VGVEGYVGRTQPKKGGEG-EISVFVKRIELLTPCLHMLPADHFGFKDQETRY-RKRYLDL 238
           V +EG +   + K+     E  + + ++  L       P+    FK+Q       RYL L
Sbjct: 98  VQIEGQLSLKRAKQESSAPEYEIKLSKLRTLNKAGKK-PSQLLHFKEQGNYPPEHRYLQL 156

Query: 239 IMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDL-DMD 297
            + K  +     R +I  YIRK L+++ F E+ETP++         +  V   N L D  
Sbjct: 157 RLPK-YQTYLRKRHEIATYIRKHLNSKMFSEIETPILFKSTPEGAREFLVPARNKLSDKP 215

Query: 298 MFMRI--APELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLM 355
            F  +  +P+ + + L+ GG+ R Y++ R FR+E +     PEFT  +   A+A    +M
Sbjct: 216 TFYALPQSPQQYKQLLMAGGVSRYYQLARCFRDEDLRSDRQPEFTQVDLEMAFASGSQVM 275

Query: 356 DMTELLFSEMVKEINGS 372
           D+ E   +     ++ S
Sbjct: 276 DVVESTITNTWNSLSSS 292

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 49/111 (44%), Gaps = 9/111 (8%)

Query: 469 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 524
           HP  M  L   S+    P LC  + ++  V   E+    T ++DP  Q   F+   +   
Sbjct: 514 HPFTMVQLKDLSKLSSNPLLCTGQHYDFVVNGTELGGGSTRIHDPELQNFIFKNILKI-- 571

Query: 525 QGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
               E + + E    A E G PP  G+  G DRL   +  ++ IR+V+ FP
Sbjct: 572 ---SEPEKLFEHLLTAFESGTPPHAGFAIGFDRLCAMICGTDNIRDVIAFP 619

>KLLA0A08426g complement(745048..746712) similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, start by similarity
          Length = 554

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 107/470 (22%), Positives = 182/470 (38%), Gaps = 74/470 (15%)

Query: 125 VSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGDIVGVE 184
           V ++G +H  R + S +   +  G G    V++   D A +    N    +     + + 
Sbjct: 132 VKVSGWVHRLRNNKSVVFIILRDGTGFLQTVLTG--DLARSYQIVN----LTLETTITLY 185

Query: 185 GYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKD--QETRYRKRYLD---LI 239
           G +      K   G + +FV   E++ P     P+    F +  QE       LD   L+
Sbjct: 186 GTIKVVPESKSAPGGVELFVDYFEIVGPA----PSGENAFTNRVQENADPSILLDQRHLM 241

Query: 240 MNKDSRKRFI-TRSKIIKYIRKFLDNRDFIEVETPMM--NVIAGGATAKPFVTHHNDLDM 296
           +  ++    +  R+ ++K IR+  D     EV  P M    + GG+T      +      
Sbjct: 242 LRGETLSAVMKVRAALMKSIRRVYDEEGLTEVNPPCMVQTQVEGGSTLFKLDYYGE---- 297

Query: 297 DMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCEFYQAYADVYDLM 355
           + F+  + +L+L E  +  +  VY I   FR E      H  E+T  E    + D  DL+
Sbjct: 298 EAFLTQSSQLYL-ETCLAALGDVYCIQESFRAEKSHTRRHLSEYTHIEAELCFLDFDDLL 356

Query: 356 DMTELLFSEMVK-----EINGSYVIKYHPD---PNNPEKEMELNFARPWKRINMIEELEK 407
              E + ++ ++      + G  V K +P+   P  P K ME   A  W + + I+  E 
Sbjct: 357 SHIERVITKTIQYVLEDPVAGPLVKKLNPNFQAPQLPFKRMEYKDAIEWLKEHGIKNEED 416

Query: 408 RFNVTFPAGDQLHTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIF 467
           +    F  GD +   E  E                            ++ DT   P  + 
Sbjct: 417 K---EFQFGDDI--AEAAE---------------------------RKMTDTIGVPILLT 444

Query: 468 GHP-QMMSPLAKYSRDQPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQARQKDQ 525
             P ++ S   K   D   + E  +V + T  EI      ++D  +  A F      K +
Sbjct: 445 RFPLEIKSFYMKRCDDDKRVTESVDVLMPTVGEITGGSMRIDDTEELMAGF------KRE 498

Query: 526 GDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
           G D A      F +  +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 499 GIDPAPYY--WFIDQRKYGTCPHGGYGLGTERILAWLCDRFTVRDCSLYP 546

>YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA
           synthetase, mitochondrial [1977 bp, 658 aa]
          Length = 658

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 67/131 (51%), Gaps = 7/131 (5%)

Query: 234 RYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFV----T 289
           RYL L  N   +     RS I K IR   +N DF EVETPM+   A    A+ F+    T
Sbjct: 152 RYLQL-RNPKYQDFLKKRSSISKEIRNSFNNFDFTEVETPML-FKATPEGAREFLVPTRT 209

Query: 290 HHNDLDMDMF-MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAY 348
             +D     + +  +P+ + + L+  G+++ Y++ R FR+E +     PEFT  +   A+
Sbjct: 210 KRSDGKPSFYALDQSPQQYKQLLMASGVNKYYQMARCFRDEDLRADRQPEFTQVDMEMAF 269

Query: 349 ADVYDLMDMTE 359
           A+  D+M + E
Sbjct: 270 ANSEDVMKIIE 280

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 469 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 524
           HP  M  L  Y +    P  C    +++ V   E+    T ++DP  Q   FE+  +   
Sbjct: 520 HPFTMVKLKDYEKLEKTPEKCLGRHYDLVVNGVELGGGSTRIHDPRLQDYIFEDILKI-- 577

Query: 525 QGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
              D A  +     NA + G PP  G+  G DR+   + ++ +IR+V+ FP
Sbjct: 578 ---DNAYELFGHLLNAFDMGTPPHAGFAIGFDRMCAMICETESIRDVIAFP 625

>KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, mitochondrial,
           start by similarity
          Length = 474

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 85/353 (24%), Positives = 146/353 (41%), Gaps = 47/353 (13%)

Query: 228 ETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPF 287
           E ++R  YL  ++      RF  R K+   + K LD  DF  V  P++  I      + F
Sbjct: 154 EFKHRTTYLSNLL------RF--RHKVESQLTKTLDGLDFTMVRPPILTSIDCEGAGEMF 205

Query: 288 VTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQ 346
               +  D  + + ++ +L L E+++ G+ RVY +   FR E  D   H  EF   E   
Sbjct: 206 NLKQDHWDEIVNLTVSSQLHL-EVLMMGLGRVYCLQPCFRAEKSDTNRHLCEFWMLEVEA 264

Query: 347 AYADVYD-LMDMTELLFSEMVKEINGSYVI-KYHPDPNNPE-KEMELNFARPWKRINMIE 403
           ++ D  + LMD+ EL+   +V  ++ +  + KY P   N +         + WKRI   +
Sbjct: 265 SFVDKNESLMDLVELMVKSVVLSLSETKDLPKYFPVGCNIDITSRWAKLLQDWKRITYTD 324

Query: 404 ELEKRFNVTFPAGDQL-HTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCIN 462
            +E   +    +G +  H    G       KD N E      + R L    G        
Sbjct: 325 AVEALLS----SGVKFEHDLAWG-------KDLNSE------HERWLCDHFG-------G 360

Query: 463 PTFIFGHPQMMSPLAKYSRDQPGLCERFEV-FVATKEICNAYTELNDPFDQRARFEEQAR 521
           P F+  +P+         R      E F++ F    EI       +D +D     +++  
Sbjct: 361 PVFVTNYPRDCKAFYMKLRPDGTTVECFDLLFPEIGEIVGGSVREDD-YDT---LKQEIE 416

Query: 522 QKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLF 574
           ++D   ++     + + N  + G  P GG+G GI+RL  +L  +  IR+ + F
Sbjct: 417 RRDMASNQL----DWYLNLRKEGTVPHGGFGIGIERLVSYLYGNPNIRDSIPF 465

>Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement
          Length = 655

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 66/130 (50%), Gaps = 6/130 (4%)

Query: 234 RYLDLIMNKDSRKRFI-TRSKIIKYIRKFLDNRDFIEVETPMM-NVIAGGATAKPFVTHH 291
           RYL L + K   + F+ TR +  K IRK LD   F EVETPM+      GA      T  
Sbjct: 152 RYLQLRLPK--YQNFLRTRYEASKLIRKDLDTYRFTEVETPMLFKSTPEGAREFLVPTRR 209

Query: 292 NDLDMDMFMRI--APELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYA 349
           ++     F  +  +P+ + + L+  G+ R ++I R FR+E +     PEFT  +   A+A
Sbjct: 210 SESKHPTFYALPQSPQQYKQLLMASGVHRYFQIARCFRDEDLRSDRQPEFTQVDLEMAFA 269

Query: 350 DVYDLMDMTE 359
              ++MD+ E
Sbjct: 270 SGNEVMDVVE 279

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 9/111 (8%)

Query: 469 HPQMMSPLAKYSRDQ----PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 524
           HP  M  L  Y +        L + +++ V+  E+    T ++DP  Q   F+E  +   
Sbjct: 519 HPFTMVKLDDYKKLSNEAISCLGQHYDLVVSGVELGGGSTRIHDPELQNYIFKEILKIH- 577

Query: 525 QGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
               + + +      A E G PP  G+  G DR+   +  + +IR+V+ FP
Sbjct: 578 ----QPERLFGHLLTAFEMGTPPHAGFAIGFDRMCAMMCGTESIRDVIAFP 624

>Sklu_2265.3 YHR019C, Contig c2265 4970-6652
          Length = 560

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 111/488 (22%), Positives = 190/488 (38%), Gaps = 78/488 (15%)

Query: 109 AKYAHLKRGETLPNEIVSIAGRIHAKRESGSKLKFYVLH-GDGVEVQVMSQLQDYAD-AE 166
           A+   + +  T     + ++G IH  R S   L F VL  G G    V++      D A+
Sbjct: 122 AEKVKISKSYTTIGSRIKVSGWIHRLR-SNKSLCFVVLRDGTGFLQAVLA-----GDLAK 175

Query: 167 AYENDHDLIKRGDIVGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPA--DHFGF 224
           AY+     ++    V + G + +    K   G + + V   E+++    + P+  D F  
Sbjct: 176 AYQTSTLTLE--STVTLYGTISKLPEGKTAPGGVELAVDYYEIVS----LAPSGEDAFTN 229

Query: 225 KDQETRYRKRYLD---LIMNKDSRKRFI-TRSKIIKYIRKFLDNRDFIEVETPMM--NVI 278
           K QE       LD   L +  ++    +  R+ +++ IR+  +     EV  P M    +
Sbjct: 230 KVQEGADPSLLLDQRHLALRGETLSAVMKVRASLLRAIRRAYEEEQLTEVTPPCMVQTQV 289

Query: 279 AGGATAKPFVTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT-HNP 337
            GG+T      +  +     ++  + +L+L E  +  +  VY I   FR E      H  
Sbjct: 290 EGGSTLFKLDYYGEE----AYLTQSSQLYL-ETCLASLGDVYCIQESFRAEKSHTRRHLS 344

Query: 338 EFTTCEFYQAYADVYDLMDMTELLFSEMVK-----EINGSYVIKYHPD---PNNPEKEME 389
           E+T  E    + D  DL+   E + ++ V+      I G  + + +PD   P  P K +E
Sbjct: 345 EYTHIEAELCFLDFDDLLSHIERVITKSVQYVLEDPIAGPLIKQLNPDFQAPQLPFKRLE 404

Query: 390 LNFARPWKRINMIEELEKRFNVTFPAGDQLHTKETGEFLQKVLKDNNLECPPPITNARML 449
              A  W + + I+  +      F  GD +   E  E                       
Sbjct: 405 YKDAIEWLKEHGIKNEDGE---EFKFGDDI--AEAAE----------------------- 436

Query: 450 DKLVGELEDTCINPTFIFGHP-QMMSPLAKYSRDQPGLCERFEVFVAT-KEICNAYTELN 507
                ++ DT   P  +   P ++ S   K   D P + E  +V + T  EI      ++
Sbjct: 437 ----RKMTDTIGVPILLTRFPVEIKSFYMKRCTDDPSVTESVDVLMPTVGEITGGSMRID 492

Query: 508 DPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNT 567
              +  A F      K +G D A      F +   YG  P GG+G G +R+  +L D  T
Sbjct: 493 SIEELMAGF------KREGIDPAAYY--WFIDQRRYGSCPHGGYGLGTERILAWLCDRFT 544

Query: 568 IREVLLFP 575
           +R+  L+P
Sbjct: 545 VRDCSLYP 552

>Kwal_14.2303
          Length = 475

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 113/269 (42%), Gaps = 36/269 (13%)

Query: 125 VSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGDI---- 180
           V +  R+H  R+ G+ L F  L      +Q + +    ++AE   +   +   G I    
Sbjct: 121 VVLRARVHNSRQQGATLVFLTLRQQANLIQALVK----SNAEGTISKQMVKWTGSISPES 176

Query: 181 -VGVEGYVGRTQP--KKGGEGEISVFVKRIELLTPCLHMLP------------ADHFGFK 225
            V V G V + +   K      + + + +I  ++     LP            A+  G  
Sbjct: 177 IVLVHGVVKKVEEPIKSATVQNLEIHITQIFTISEAPQQLPILIEDASRSDAEAEAAGLP 236

Query: 226 --DQETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGAT 283
             + +TR   R +DL     ++  F  +S + +  R+FL  R F+E+ TP +        
Sbjct: 237 VVNLDTRLDARVIDL-RTATNQAIFRIQSGVCELFREFLTQRKFVEIHTPKLLGAPSEGG 295

Query: 284 AKPF-VTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTT 341
           A  F VT+        ++  +P+ + +EL+    +RV+E+   FR E  +   H  EFT 
Sbjct: 296 ANVFEVTYFKG---KSYLAQSPQFYKQELIAADFERVFEVAPVFRAENSNTHRHMTEFTG 352

Query: 342 CEFYQAYADVYD-----LMDMTELLFSEM 365
            +   A+ + YD     L D+   +F+++
Sbjct: 353 LDLEMAFEEHYDEVIDVLSDLFVFIFTQL 381

>YHR019C (DED81) [2305] chr8 complement(141886..143550)
           Asparaginyl-tRNA synthetase, cytoplasmic [1665 bp, 554
           aa]
          Length = 554

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 112/471 (23%), Positives = 179/471 (38%), Gaps = 76/471 (16%)

Query: 125 VSIAGRIHAKRESGSKLKFYVLH-GDGVEVQVMSQLQDYADAEAYENDHDLIKRGDIVGV 183
           V ++G IH  R S  K+ F VL  G G    V+S      D    +   DL      V +
Sbjct: 132 VKVSGWIHRLR-SNKKVIFVVLRDGSGFIQCVLS-----GDLALAQQTLDLTLES-TVTL 184

Query: 184 EGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPA--DHFGFKDQETRYRKRYLD---L 238
            G + +    K   G + + V   E++     + P   D F  K  E       LD   L
Sbjct: 185 YGTIVKLPEGKTAPGGVELNVDYYEVV----GLAPGGEDSFTNKIAEGSDPSLLLDQRHL 240

Query: 239 IMNKDSRKRFI-TRSKIIKYIRKFLDNRDFIEVETPMM--NVIAGGATAKPFVTHHNDLD 295
            +  D+    +  R+ ++K +R+  D     EV  P M    + GG+T    +   N   
Sbjct: 241 ALRGDALSAVMKVRAALLKSVRRVYDEEHLTEVTPPCMVQTQVEGGST----LFKMNYYG 296

Query: 296 MDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVYDL 354
            + ++  + +L+L E  +  +  VY I   FR E      H  E+T  E   A+    DL
Sbjct: 297 EEAYLTQSSQLYL-ETCLASLGDVYTIQESFRAEKSHTRRHLSEYTHIEAELAFLTFDDL 355

Query: 355 MDMTELLFSEMVK-----EINGSYVIKYHPD---PNNPEKEMELNFARPWKRINMIEELE 406
           +   E L  + V+      I G  V + +P+   P  P   ++   A  W   + I+  E
Sbjct: 356 LQHIETLIVKSVQYVLEDPIAGPLVKQLNPNFKAPKAPFMRLQYKDAITWLNEHDIKNEE 415

Query: 407 KRFNVTFPAGDQLHTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFI 466
                 F  GD +   E  E                            ++ DT   P F+
Sbjct: 416 GE---DFKFGDDI--AEAAE---------------------------RKMTDTIGVPIFL 443

Query: 467 FGHP-QMMSPLAKYSRDQPGLCERFEVFVA-TKEICNAYTELNDPFDQRARFEEQARQKD 524
              P ++ S   K   D P + E  +V +    EI      ++D  +  A F+   R+  
Sbjct: 444 TRFPVEIKSFYMKRCSDDPRVTESVDVLMPNVGEITGGSMRIDDMDELMAGFK---REGI 500

Query: 525 QGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
             D     ID+      +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 501 DTDAYYWFIDQR-----KYGTCPHGGYGIGTERILAWLCDRFTVRDCSLYP 546

>KLLA0E24486g complement(2173560..2175497) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1 aspartate--tRNA
           ligase, mitochondrial, start by similarity
          Length = 645

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 120/265 (45%), Gaps = 30/265 (11%)

Query: 121 PNEIVSIAGRIHAK-RESGSKLKFYVLHG-DGVEVQVMSQLQDYADAEAYENDHDLIKRG 178
           PN++V + G I AK ++ G  L F  L   +G ++Q++       D++++  +  +    
Sbjct: 44  PNKVV-LNGWIDAKPKKVGKNLIFGTLRDPNGEKIQLV-------DSQSFLKESQV---E 92

Query: 179 DIVGVEGYVGRTQPKKGGEGEISVFVKRIELLT--------PCLHMLPADHFGFKDQETR 230
           D+V + G +   +  +     I   +K IEL            L  L AD   F  +   
Sbjct: 93  DVVQIIGELSEKKQTQQSTVNIEYELKIIELQKLNQANKKPSQLQDLKADDGAFPPE--- 149

Query: 231 YRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTH 290
              RYL L + K  +     R +  K +R  LD+ +F EVETP++         +  V  
Sbjct: 150 --YRYLQLRLPK-YQNNLKLRYEASKNVRTVLDSLNFTEVETPLLFKSTPEGAREFLVPT 206

Query: 291 HNDLDMDM-FMRI--APELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQA 347
              +D +  F  +  +P+ + + L+  G++R +++ R FR+E +     PEFT  +   A
Sbjct: 207 RGKIDGEASFYALPQSPQQYKQLLIASGVNRYFQVARCFRDEDLRSDRQPEFTQVDLEMA 266

Query: 348 YADVYDLMDMTELLFSEMVKEINGS 372
           ++   D+ ++ E + +    +++ S
Sbjct: 267 FSSGKDVREVVEKVITSTWNKLHAS 291

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 469 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 524
           HP  M  L  Y++    P  C  E +++ V   E+    T ++DP  Q   F E    K+
Sbjct: 511 HPFTMVNLRDYNKLESDPLSCHGEHYDLVVNGVELGGGSTRIHDPELQNYIFHEILNIKN 570

Query: 525 QGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
             D    L+     NA + G PP  G+  G DR+   L  S +IR+V+ FP
Sbjct: 571 PEDLFGHLL-----NAFKMGTPPHAGFAIGFDRMCAMLCGSESIRDVIAFP 616

>AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH]
           (1144536..1146491) [1956 bp, 651 aa]
          Length = 651

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 58/118 (49%), Gaps = 3/118 (2%)

Query: 245 RKRFITRSKIIKYIRKFLDNRDFIEVETPMM-NVIAGGATAKPFVTHHNDLDMDMFMRI- 302
           + R   R    K +R  L+   F+EVETP++      GA      T H      +F  + 
Sbjct: 162 QARMKMRHNASKTVRASLEKLGFMEVETPLLFKSTPEGAREFLVPTRHKQGKDPLFYALP 221

Query: 303 -APELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 359
            +P+ + + L+ GG+ + Y++ R FR+E +     PEFT  +   A+A+  D+M + E
Sbjct: 222 QSPQQYKQLLMAGGVSKYYQLARCFRDEDLRSDRQPEFTQVDLEMAFANGDDVMRVVE 279

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 469 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 524
           HP  M  L  Y +  ++P  C  + ++  V   E+    T ++DP  QR  F +  +  +
Sbjct: 513 HPFTMVRLQDYQKLSEKPLSCLGQHYDFVVNGVELGGGSTRVHDPVLQRYIFNQILKINN 572

Query: 525 QGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
           +      L++     A   G PP  G+  G DR+   +    +IR+V+ FP
Sbjct: 573 EDQVFGHLLE-----AFSMGTPPHAGFAIGFDRMVAMMCAKESIRDVIAFP 618

>Scas_700.6
          Length = 658

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 91/195 (46%), Gaps = 10/195 (5%)

Query: 175 IKRGDIVGVEGYVGRTQPKKGGEGE----ISVFVKRIELLTPCLHMLPADHFGFKDQETR 230
           + R D++ V G + + + K     E      + V++I +L    +  P+    FK ++  
Sbjct: 99  LNREDVIQVNGTLMKKKEKSVSSAENIFEYEIQVEKISVLNSS-NEKPSQLHEFK-KDGN 156

Query: 231 YRKRYLDLIMNKDSRKRFI-TRSKIIKYIRKFLDNRDFIEVETPMM-NVIAGGAT--AKP 286
           Y   Y  L +     + F+  R +I   +R+ L+  +F+E+ETP++      GA     P
Sbjct: 157 YPPEYRFLQLRHHKYQEFLRKRYQISCKLRQLLNEEEFLEIETPILFKPTPEGAREFLVP 216

Query: 287 FVTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQ 346
             T  N       +  +P+ + + L+  G+ + +++ R FR+E +     PEFT  +   
Sbjct: 217 TRTKENSTPSFYSLTQSPQQYKQLLMASGVFKYFQVARCFRDEDLRADRQPEFTQIDMEM 276

Query: 347 AYADVYDLMDMTELL 361
           ++++  D+M + E L
Sbjct: 277 SFSNGEDVMALLERL 291

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 469 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 524
           HP  M  L  Y +    P  C  + +++ +   E+    T ++DP  Q   FE   + ++
Sbjct: 522 HPFTMVQLQDYEKLNSNPSQCRGQHYDLVINGVELGGGSTRVHDPILQDYIFENILKIEN 581

Query: 525 QGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
             +    L+      A E G PP  G+  G DR+   L+ + +IR+V+ FP
Sbjct: 582 AEELFGHLL-----RAFEMGTPPHAGFAIGFDRMCAMLSGTESIRDVIAFP 627

>AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH]
           complement(598366..600024) [1659 bp, 552 aa]
          Length = 552

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 76/338 (22%), Positives = 129/338 (38%), Gaps = 56/338 (16%)

Query: 250 TRSKIIKYIRKFLDNRDFIEVETPMM--NVIAGGATAKPFVTHHNDLDMDMFMRIAPELF 307
            R+  ++ IR+  ++   +EV  P M    + GG+T    +   +    + F+  + +L+
Sbjct: 251 VRAAFLRAIRRVYEDEGLLEVTPPCMVQTQVEGGST----LFKLDYYGEEAFLTQSSQLY 306

Query: 308 LKELVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVYDLMDMTELLFSEMV 366
           L E  +  +  V+ I   FR E      H  E+T  E    + D   L+  TE + + +V
Sbjct: 307 L-ETCLPALGDVFCIQESFRAEKSHTRRHLSEYTHIEAELGFVDFDQLLRHTERVITSLV 365

Query: 367 K-----EINGSYVIKYHPD---PNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQ 418
           +      + G  V + +PD   P  P   +E   A  W   + I+  E      F  GD 
Sbjct: 366 RYVLEDPVAGPLVKQLNPDFVPPQMPFMRLEYKDAITWLNEHGIKNEEGE---EFKFGDD 422

Query: 419 LHTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLA 477
           +   E  E                            ++ DT   P F+   P ++ S   
Sbjct: 423 I--AEAAER---------------------------KMTDTIGKPIFLTRFPLELKSFYM 453

Query: 478 KYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETF 537
           K   D P + E F+V + T       +   D  D     E  A  K +G +        F
Sbjct: 454 KRCADDPRVTESFDVLMPTVGEVTGGSMRIDSLD-----ELMAGFKREGVNPEPYY--WF 506

Query: 538 CNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
            +   YG  P GG+G G +R+  +L +   +R+  L+P
Sbjct: 507 SDQRRYGSCPHGGYGLGTERILAWLCNRYPVRDCSLYP 544

>CAGL0H05907g complement(579444..581423) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1, hypothetical
           start
          Length = 659

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 62/129 (48%), Gaps = 11/129 (8%)

Query: 250 TRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVT--------HHNDLDMDMFMR 301
           TR ++ K +R+ LD   F E+ETP +   A    A+ F+            D  + MF  
Sbjct: 166 TRYEVSKTLRQILDQDGFTEIETPTL-FKATPEGAREFMVPTRVSAKIKQVDKIVPMFYA 224

Query: 302 I--APELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 359
           +  +P+ + + L+  G+ + ++  R +R+E +     PEFT  +   ++A   D+M + E
Sbjct: 225 LTQSPQQYKQLLMASGVPKYFQFARCYRDEDLRADRQPEFTQLDMEMSFASQKDVMSVIE 284

Query: 360 LLFSEMVKE 368
              + + K+
Sbjct: 285 KCITSVWKK 293

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 9/111 (8%)

Query: 469 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 524
           HP  M  L  Y +    P  C  + +++ +   E+    T ++DP  Q+  FE   +  +
Sbjct: 520 HPFTMVQLQDYDKLTTNPIDCLGQHYDLVMNGIELGGGSTRIHDPELQKFMFENVLKISN 579

Query: 525 QGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
                 Q++     +A E G PP  G+  G DR+   L  +++IR+V+ FP
Sbjct: 580 -----YQILFGHLLSAFETGTPPHAGFAIGYDRMCAMLCGTDSIRDVIPFP 625

>CAGL0A02112g 216596..218242 highly similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, hypothetical start
          Length = 548

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 110/493 (22%), Positives = 187/493 (37%), Gaps = 78/493 (15%)

Query: 103 SNPEFLAKYAHLKRGETLPNEIVSIAGRIHAKRESGSKLKFYVLH-GDGVEVQVMSQLQD 161
           S PE  AK   + +   L  + V I+G IH  R S  K+ F VL  G G    V++    
Sbjct: 106 SLPE--AKKCKIGQSYELVGQRVKISGWIHRLR-SNKKVMFIVLRDGYGYLQSVLT---- 158

Query: 162 YADAEAYENDHDLIKRGDIVGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADH 221
             D    +   DL      V + G + +    K   G + + V   E++     + P+  
Sbjct: 159 -GDLAIAQQSLDLTIE-STVTLYGTITKVPEGKSAPGGVELLVDYYEVV----GLAPSGD 212

Query: 222 FGF-------KDQETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPM 274
             F        D      +R+L L   +        R+ ++K IR+        EV  P 
Sbjct: 213 EAFTNKIAEGADPSLLLDQRHLAL-RGETLSAVMKVRAALMKSIRRVYTEESLTEVTPPC 271

Query: 275 M--NVIAGGATAKPFVTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGID 332
           M    + GG+T      +        ++  + +L+L E  +  +  VY +   FR E   
Sbjct: 272 MVQTQVEGGSTLFKLDYYGEQ----AYLTQSSQLYL-ETCLPSLGDVYCVQESFRAEKSH 326

Query: 333 MT-HNPEFTTCEFYQAYADVYDLMDMTELLFSEMVK-----EINGSYVIKYHPD---PNN 383
              H  E+T  E   A+    +L+D  E +  + V+      I G  V + +PD   P  
Sbjct: 327 TRRHLSEYTHIEAELAFLTFEELLDHIERVLCKTVQYILEDPIAGPLVKQLNPDFQAPKM 386

Query: 384 PEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLHTKETGEFLQKVLKDNNLECPPPI 443
           P   +E   A  W + + I+  +      F  GD +      E  ++ + D        I
Sbjct: 387 PFMRLEYKDAIEWLKEHDIKNEDGE---EFKFGDDI-----AEAAERKMTDT-------I 431

Query: 444 TNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVAT-KEICNA 502
               +L K   E++         F  P+         +D   + E  +V + T  EI   
Sbjct: 432 GVPILLTKFPAEIKS--------FYMPR--------CKDDNRVTESVDVLMPTVGEITGG 475

Query: 503 YTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFL 562
              +N   +  A F     +++  D +A      F +  +YG  P GG+G G +R+  +L
Sbjct: 476 SMRINTEEELLAGF-----KRENIDPKAYYW---FIDQRKYGTCPHGGYGLGTERILAWL 527

Query: 563 TDSNTIREVLLFP 575
            +  T+R+  L+P
Sbjct: 528 CNRFTVRDCSLYP 540

>Scas_607.14
          Length = 555

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 73/339 (21%), Positives = 131/339 (38%), Gaps = 58/339 (17%)

Query: 250 TRSKIIKYIRKFLDNRDFIEVETPMM--NVIAGGATAKPFVTHHNDLDMDMFMRIAPELF 307
            R+ +++ +R+  +    +EV  P M    + GG+T      +  +     F+  + +L+
Sbjct: 254 VRAALLRAVRRVYEEEGLLEVTPPCMVQTQVEGGSTLFKLDYYGEE----AFLTQSSQLY 309

Query: 308 LKELVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVYDLMDMTELLFSEMV 366
           L E  +  +  V+ +   FR E      H  E+T  E   A+    +L++  E L  + V
Sbjct: 310 L-ETCLPALGDVFCVQESFRAEKSHTRRHLSEYTHIEAELAFLTFEELLEHIETLIVKSV 368

Query: 367 K-----EINGSYVIKYHPD---PNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQ 418
           +      + G  V + HP    P  P   +E   A  W + + I+  +      F  GD 
Sbjct: 369 QYVMEDPVAGPIVNQLHPHFVPPKGPFMRLEYKDAITWLQEHNIKNEDGE---DFKFGDD 425

Query: 419 LHTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLA 477
           +   E  E                            ++ DT   P  +   P ++ S   
Sbjct: 426 I--AEAAE---------------------------RKMTDTLNVPILLTRFPVEIKSFYM 456

Query: 478 KYSRDQPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDET 536
              +D P + E  +V + T  EI      ++D  +  A F      K +G D        
Sbjct: 457 PKCKDDPRVTESVDVLMPTVGEITGGSMRISDIDELMAGF------KREGIDPKPYY--W 508

Query: 537 FCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
           F +  +YG  P GG+G G +R+  +L +  T+R+  L+P
Sbjct: 509 FIDQRKYGTCPHGGYGLGTERILAWLCNRFTVRDCSLYP 547

>Kwal_0.375
          Length = 428

 Score = 36.6 bits (83), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 72/320 (22%), Positives = 130/320 (40%), Gaps = 38/320 (11%)

Query: 98  FQVSISNPEFL---AKYAHLKRGETLPNEIVSIAGRIHAKRESGSKLKFYVLH-GDGVEV 153
             +SI   E L    KY  +K  + + ++ V ++G IH +R S S L F VL  G G   
Sbjct: 103 LNISIKQDESLPDATKYKIIKSYDAI-DQRVKVSGWIHRQRSSKS-LVFIVLRDGTGYLQ 160

Query: 154 QVMSQLQDYADAEAYENDHDLIKRGDIVGVEGYVGRTQPKKGGEGEISVFVKRIELLTPC 213
            V++   D A A    +    +     + + G V +    K   G + + V   E+++  
Sbjct: 161 AVLTG--DLARA----HQTSTLTLESSITLYGKVCKLPEGKTAPGGVELLVDYYEIIS-- 212

Query: 214 LHMLPA--DHFGFKDQETRYRKRYLD---LIMNKDSRKRFI-TRSKIIKYIRKFLDNRDF 267
             + P+  D F  K  E       LD   L +  ++    +  R+ +++ +R+F D    
Sbjct: 213 --LAPSGDDAFTNKIAEGADPSLLLDQRHLALRGETLSAVMKVRAALLRSVRRFYDQEGL 270

Query: 268 IEVETPMM--NVIAGGATAKPFVTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQ 325
            EV  P M    + GG+T      +      + ++  + +L+L E  +  +  VY I   
Sbjct: 271 TEVTPPCMVQTQVEGGSTLFKLGYYGE----EAYLTQSSQLYL-ETCLASLGDVYSIQES 325

Query: 326 FRNEGIDM-THNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKE-----INGSYVIKYHP 379
           FR E      H  E+T  E    +    +++   E L +++V+      + G  V + +P
Sbjct: 326 FRAEKSHTRRHLSEYTHIEAELCFLSFDEMLVHIEKLITQVVQSVLDDPVAGPLVQQLNP 385

Query: 380 D---PNNPEKEMELNFARPW 396
               P  P   ++   A  W
Sbjct: 386 GFKAPTMPFMRLDYKDAIEW 405

>Kwal_34.16119
          Length = 465

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 67/163 (41%), Gaps = 22/163 (13%)

Query: 215 HMLPADHFGFKDQETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPM 274
           H LP   F   +   ++R  YL  ++      RF  RS +   + +F D++DF +V  P+
Sbjct: 118 HSLP---FLRSNPTLKHRSNYLGALL------RF--RSHVESSLVEFFDSQDFTKVAPPI 166

Query: 275 MNVIAGGATAKPFVTHHND--------LDMDMFMRIAPELFLKELVVGGMDRVYEIGRQF 326
           +         + F    N              ++ ++ +L L E++   + R + +   F
Sbjct: 167 LTSSDCEGAGELFRVESNSRWARNSSYFGKPTYLTVSTQLQL-EVLAMALSRCWTLTPCF 225

Query: 327 RNEGIDMT-HNPEFTTCEFYQAYAD-VYDLMDMTELLFSEMVK 367
           R E  D   H  EF   E    + D V+ L  + EL+   +VK
Sbjct: 226 RAEESDTNRHLAEFWMLEAEVCFIDNVHQLTQLAELMLKHVVK 268

>CAGL0K07656g 761388..762881 highly similar to sp|P15625
           Saccharomyces cerevisiae YFL022c Phenylalanyl-tRNA
           synthetase alpha chain, start by similarity
          Length = 497

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 7/67 (10%)

Query: 318 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEMVKEINGSYVI 375
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M     G   +
Sbjct: 345 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEDFFAKM-----GVTGL 399

Query: 376 KYHPDPN 382
           K+ P  N
Sbjct: 400 KFKPTYN 406

>Scas_707.14
          Length = 499

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 318 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEM 365
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFAKM 396

>AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH]
           complement(1358569..1360068) [1500 bp, 499 aa]
          Length = 499

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 318 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEM 365
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM 396

>KLLA0F25234g complement(2349192..2350691) highly similar to
           sp|P15625 Saccharomyces cerevisiae YFL022c FRS2
           phenylalanine--tRNA ligase beta chain, cytosolic
           singleton, start by similarity
          Length = 499

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 318 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEM 365
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM 396

>Kwal_47.17998
          Length = 499

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 318 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEM 365
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F +M
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEGFFEKM 396

>YFL022C (FRS2) [1661] chr6 complement(93497..95008)
           Phenylalanyl-tRNA synthetase, beta subunit, cytoplasmic
           [1512 bp, 503 aa]
          Length = 503

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 318 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEM 365
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F  M
Sbjct: 351 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFERM 400

>CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, hypothetical
           start
          Length = 467

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 66/334 (19%), Positives = 126/334 (37%), Gaps = 33/334 (9%)

Query: 251 RSKIIKYIRKFLDNR-DFIEVETPMMNVIAGGATAKPFVTHHNDL-DMDMFMRIAPELFL 308
           RS + +Y   F + + +F++V  P+          + F    + L +   F+ ++ +L L
Sbjct: 149 RSHMEEYAINFFNKQENFLKVSPPIFTTNDCEGAGEQFEVKSSVLENKKAFLTVSTQLHL 208

Query: 309 KELVVGGMDRVYEIGRQFRNE-GIDMTHNPEFTTCEFYQAYADVYD-LMDMTELLFSEMV 366
            E++   +   + +   FR E      H  EF   E   ++ D  D L+D T      MV
Sbjct: 209 -EILSMAIANCWTLSPCFRAEKSATPRHLMEFWMLEAEMSFIDNLDQLLDFTRNFLQSMV 267

Query: 367 KEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLHTKETGE 426
            +    Y  +    P+N      +N  +  +R  M+   E    +T+    Q        
Sbjct: 268 TQ---CYENREDLLPDNIS--TLINKEKILERWQMLRNSENWKRITYTDAIQ-------- 314

Query: 427 FLQKVLKDNNLECPPPITNARMLDKLVGELEDTCI-----NPTFIFGHPQMMSPLAKYSR 481
               +LK+ + + P P    +  + L  E E         +P F+  +P         S 
Sbjct: 315 ----ILKEKHSQEPFPRYKPKWGEALQTEHEKWLAEKYFQSPVFVTDYPMDCKAFYMKSN 370

Query: 482 DQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNAL 541
           +       F++ V         +   D ++       Q + K +G +    +D  + N  
Sbjct: 371 EDGKTVACFDLLVPEMGEIIGGSMREDNYESL-----QYQIKKRGMNNTGELD-WYVNLR 424

Query: 542 EYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
           + G+ P GG+G G +R   +L     I++ + FP
Sbjct: 425 KQGVAPHGGFGLGFERFISYLLGIQNIKDTIPFP 458

>Kwal_34.15989
          Length = 506

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 391 NFARPWKRINMIEELEKRFNVTFPAGDQL 419
           N A+PW  +N   +L+++ +  FP  DQL
Sbjct: 95  NLAQPWVYLNATNDLQRKISSLFPFSDQL 123

>KLLA0F24200g 2257007..2258965 similar to sp|P53918 Saccharomyces
           cerevisiae YNL125c ESBP6, hypothetical start
          Length = 652

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 510 FDQRARFEEQARQKD----QGDDEAQLIDETFCN--ALEYGLPPTGGWG---CGIDRLAM 560
           FDQ +  E + R +      GDDE Q +++ F N       LPP GG+G   C    L M
Sbjct: 148 FDQTSDSEGEYRSEVPVELAGDDEGQTLNKVFTNKETNTLDLPPEGGYGWVCCLCVTLVM 207

Query: 561 FLT 563
           F T
Sbjct: 208 FST 210

>Sklu_2216.2 YBR088C, Contig c2216 2801-3223
          Length = 140

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 7/74 (9%)

Query: 329 EGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFS-EMVKEI------NGSYVIKYHPDP 381
           EG+D        + EF +   D+  L D   +L + + VK +      +GS ++K H D 
Sbjct: 11  EGMDYDTVITMPSVEFAKVVRDLNQLSDSLNILVTKDTVKFVAEGDIGSGSVIVKPHTDM 70

Query: 382 NNPEKEMELNFARP 395
            NPE+ +++   +P
Sbjct: 71  ENPEESVKVELDKP 84

>YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by
           cell stress, member of the DnaJ family of predicted
           protein chaperones [1587 bp, 528 aa]
          Length = 528

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 346 QAYADVYDLMDMTELLFSEMVKEINGSYVIKYHPDPNNPEKEMELNF 392
           Q    +YD +++T    +  +K+   +  +KYHPD NN  +E +  F
Sbjct: 2   QQNTSLYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKF 48

>KLLA0F08371g 779264..781009 no similarity, hypothetical start
          Length = 581

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 69/153 (45%), Gaps = 13/153 (8%)

Query: 222 FGFKDQETRYRKRYLDLIMNKDSRKR-----FITRSKIIKYIRKFLDNRDFIEVETPMMN 276
           FG  +   RYR + ++ + + DS  +     FIT +++   +    D  D+I  +  + +
Sbjct: 416 FGPIESGARYRAKMVNDMKSDDSTGKPRWCHFITSAEMKGILDFIFDGLDYIANDDTLPD 475

Query: 277 VIAGGATAKPFVTHHNDLDMDMFMRIAPELFLKEL--VVGGMDRVY--EIGRQFRNEGID 332
            ++ G    PF  H + +   M   ++ +  +K+   V+ G  +V+  E+ +Q    G D
Sbjct: 476 KLSKGIKPNPFKQHESRIRSHMVGYVSGKKCMKDAKNVLTGERKVFAEEMYKQVI--GYD 533

Query: 333 MTHNPEFTTCEFYQAYADVYDLMDMTELLFSEM 365
               P  T  EF  A  +V  +MD  E LF + 
Sbjct: 534 DKRRPYNTLKEF--AVMEVKYMMDNIEDLFGKF 564

>Scas_628.24
          Length = 487

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 544 GLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
           G  P GG+G G++RL  +L  ++ I++ + FP
Sbjct: 447 GSVPHGGFGLGLERLISYLFGNHNIKDAIPFP 478

>CAGL0J09900g 966959..967810 highly similar to sp|P04840
           Saccharomyces cerevisiae YNL055c POR1, start by
           similarity
          Length = 283

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 49/119 (41%), Gaps = 19/119 (15%)

Query: 285 KPFVTHHNDLDM--------DMFMR-----IAPELFLKELVVGGMDRVYEIGRQFRNE-- 329
           +PF T     D+        DM +      +A   F  ++  G + + Y I   +  +  
Sbjct: 118 QPFFTARGAFDLLKGPGFVGDMTLAHESGVVAGAQFGYDIAAGSLSK-YAIALGYAAQDY 176

Query: 330 --GIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEINGSYVIKYHPDPNNPEK 386
             G+++ +N + TT  F+Q  +    +     L   + V  +N  +  KY PDPN+  K
Sbjct: 177 HLGLNI-NNDQVTTATFFQNVSPQLQIGSRATLNPRQTVSNVNIEFATKYLPDPNSQVK 234

>AER352C [2853] [Homologous to ScYMR218C (TRS130) - SH]
           (1282221..1285469) [3249 bp, 1082 aa]
          Length = 1082

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 98/263 (37%), Gaps = 48/263 (18%)

Query: 205 KRIELLTPCLHMLPADHFGFKDQE-----TRYRKRYLDLIMNKDSRKRFITRSKIIKYIR 259
           + +EL   CLH  P   +   D E     +     YL+L++   S K++    + +K   
Sbjct: 469 RLLELFIKCLHKCPEIEYLETDGEEIPVSSILCNSYLNLLVYSSSSKQY-WWGEFLK--- 524

Query: 260 KFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMFMRIA----------PELFLK 309
             L   D   +  P+ N+     + +P+ +  N   +D+ +  A           EL LK
Sbjct: 525 --LSQIDASNLLYPLENLFTVNISREPYFSKANTYALDVSLENALVPTDIHIHSAELLLK 582

Query: 310 E-----LVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQ--------AYADVYDLMD 356
                 L     ++V + G    N     T N  FTT  F           +  +YD   
Sbjct: 583 SSNDDFLTFSCKNQVIKHGS---NTLTLETTNVRFTTFTFVSFAVTVGDTVFKRIYDSSQ 639

Query: 357 MTELLFSEMVKEINGSYVIKYHPDPNNPEKEMEL---------NFARPWKRINMIEELEK 407
              L   E+ +E N  Y IK        EK++++          F+   K +++ EEL+ 
Sbjct: 640 ANSLHLKELYQEDNFRYSIKQSKMALFSEKKLQIEYFNNDSIEEFSLELKALSIEEELKP 699

Query: 408 RFNVTFPAGDQLHTKETGEFLQK 430
            F   F AG  L      +F Q+
Sbjct: 700 NF--AFDAGFSLFELCIDDFNQR 720

>Scas_710.22
          Length = 1120

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 95  PHKFQVSISNPEFLAKYAHLKRGETLPNEIVSIAGR 130
           PH  +++  +P+F+  YAH     TLPN I+S+  +
Sbjct: 37  PHHLKLNAKSPDFIHDYAHTSLQTTLPN-ILSLRSK 71

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,871,672
Number of extensions: 846533
Number of successful extensions: 2364
Number of sequences better than 10.0: 55
Number of HSP's gapped: 2367
Number of HSP's successfully gapped: 70
Length of query: 582
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 475
Effective length of database: 12,891,983
Effective search space: 6123691925
Effective search space used: 6123691925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)