Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K11990g99197646380.0
YBR059C (AKL1)110839514450.0
CAGL0H10208g102738513711e-173
Scas_661.27109538413601e-171
Sklu_1752.285838512931e-164
Kwal_27.1094593539812771e-160
KLLA0F18612g81437712371e-156
AGR027C96133912451e-155
Kwal_27.115427913147883e-91
Scas_601.66613227532e-87
Sklu_2226.77953257587e-87
KLLA0E08371g7773217532e-86
YNL020C (ARK1)6383257414e-86
ADL217W7503117478e-86
Scas_671.167233217432e-85
CAGL0G02607g6883237211e-82
YIL095W (PRK1)8103207254e-82
CAGL0J03432g6223157116e-82
KLLA0C06138g7082922662e-23
YMR001C (CDC5)7053192473e-21
Sklu_2419.96953002474e-21
ACL006W7082962456e-21
CAGL0J11638g7463002368e-20
Scas_700.288962092332e-19
Kwal_56.224766973002312e-19
YPL150W9012082304e-19
Sklu_2361.38843132305e-19
Scas_644.157263082286e-19
Kwal_55.215458652932224e-18
CAGL0M02299g8932002215e-18
Kwal_26.87518482292208e-18
KLLA0F11319g8432072198e-18
ACR133C8512062162e-17
KLLA0E21780g10162402144e-17
CAGL0L11550g10722592119e-17
Sklu_2419.105662312052e-16
Sklu_1962.23641502013e-16
Scas_580.610152362046e-16
ACL104C9472412021e-15
AFL101C3672451942e-15
YHR102W (KIC1)10802331993e-15
CAGL0K05709g11032341931e-14
Kwal_56.242743461551853e-14
KLLA0C01650g11122341903e-14
AFR696C11422341885e-14
Scas_693.1710492031841e-13
Scas_564.712102221832e-13
YDR477W (SNF1)6333001812e-13
KLLA0A03806g6023001794e-13
ABL034W14252321805e-13
KLLA0B02332g3612901746e-13
AGR058W10712231796e-13
Scas_660.286233001776e-13
AEL230W6082951777e-13
Kwal_47.182335983211777e-13
Scas_707.369152261788e-13
YDR507C (GIN4)11422341771e-12
YDR523C (SPS1)4902071741e-12
YLR096W (KIN2)11473001752e-12
Sklu_2323.34002481712e-12
CAGL0M08910g6122931732e-12
YPL236C3643441702e-12
YOL100W (PKH2)10812331743e-12
YDR122W (KIN1)10642231733e-12
KLLA0F19536g11042101733e-12
YGL179C (TOS3)5602951713e-12
CAGL0M11396g11922121724e-12
CAGL0K08514g14893241725e-12
Scas_493.211172451715e-12
Kwal_56.237178581911706e-12
YAR019C (CDC15)9742471706e-12
Kwal_23.566816892031672e-11
CAGL0B01925g9442031662e-11
Kwal_33.131125052021642e-11
Sklu_2073.311822861652e-11
Kwal_47.1726311272101653e-11
Sklu_2366.54662381623e-11
KLLA0F13552g12671991644e-11
Sklu_1603.24881961624e-11
AFR377C7261971634e-11
Kwal_26.778812672321644e-11
Kwal_56.226939842121634e-11
CAGL0G09020g3611501604e-11
YJL187C (SWE1)8192351634e-11
AFR724C4402121605e-11
YPR054W (SMK1)3882591595e-11
ADR313W5782991615e-11
Scas_627.73492511585e-11
CAGL0K02167g11622731617e-11
YCR073C (SSK22)13312501618e-11
AFR335C10331921618e-11
Kwal_23.632515422801619e-11
CAGL0C03509g8953051601e-10
CAGL0G04609g9652451601e-10
ACR196C5302091591e-10
YCL024W (KCC4)10372311601e-10
YER129W (PAK1)11422071601e-10
CAGL0E05720g3582521561e-10
KLLA0C00979g4832981571e-10
Kwal_26.715412132531591e-10
KLLA0C12485g9252131581e-10
Scas_675.25272011571e-10
CAGL0M10153g8671671582e-10
YHL007C (STE20)9392401572e-10
Scas_598.67902721572e-10
Kwal_56.240913811841533e-10
Scas_502.211161501563e-10
CAGL0J03872g6612071553e-10
ADL315C4341851533e-10
YDR490C (PKH1)7661641554e-10
Scas_667.184372001534e-10
Kwal_26.78619551791554e-10
YOR233W (KIN4)8001851545e-10
YKL101W (HSL1)15181961546e-10
YDR283C (GCN2)16592041546e-10
Scas_668.228931791536e-10
ABR014W9711791537e-10
YPL209C (IPL1)3672461498e-10
YNR047W8933091528e-10
AEL284C4792481508e-10
Sklu_2437.1610711911529e-10
CAGL0K02673g9152311511e-09
Scas_458.13671071481e-09
Scas_629.169183071511e-09
AER264C14832371511e-09
Scas_703.57493031501e-09
Kwal_26.87098292551502e-09
Scas_616.1014612291502e-09
Kwal_23.52908192401492e-09
YFR014C (CMK1)4462581472e-09
CAGL0H00979g3991571462e-09
Kwal_0.964272671462e-09
ACL053C11812201483e-09
Scas_651.183711501453e-09
Scas_653.256661951473e-09
Scas_548.613822511483e-09
KLLA0B13607g9891791473e-09
YNL298W (CLA4)8422741473e-09
YKL048C (ELM1)6401801473e-09
YBR274W (CHK1)5272001463e-09
AEL205W7932061473e-09
CAGL0H01639g5212481464e-09
AEL115C3861501444e-09
Sklu_2086.42431701404e-09
ADL389W7112901464e-09
AAR009W4532801444e-09
CAGL0I07513g10761511465e-09
KLLA0D09328g10462131465e-09
KLLA0F01276g5192011445e-09
KLLA0B11946g4391811445e-09
KLLA0B03586g7343031456e-09
KLLA0C04213g3942921436e-09
YDL159W (STE7)5152041446e-09
Kwal_33.138463751321426e-09
CAGL0C05005g10762521457e-09
YKL166C (TPK3)3981281427e-09
YJL164C (TPK1)3971281427e-09
Scas_720.9416832241457e-09
Kwal_23.64588682661447e-09
KLLA0E17127g8521941447e-09
Kwal_26.735514462581448e-09
ABL028W7221511431e-08
YDL028C (MPS1)7643241431e-08
KLLA0B07205g4551421411e-08
KLLA0C03828g7933261421e-08
YPL203W (TPK2)3801281401e-08
YOL045W (PSK2)11011681431e-08
ADR300C8901911421e-08
AFL143C3613431401e-08
Kwal_27.125594141841401e-08
YCR091W (KIN82)7202611411e-08
Scas_544.64892091401e-08
YPL141C8652561411e-08
YDL025C6201501411e-08
Kwal_26.83475921521412e-08
CAGL0F09075g7462901412e-08
KLLA0A07403g8792481412e-08
AAL083W16982021422e-08
KLLA0F07623g12292541412e-08
Scas_634.57902681412e-08
KLLA0C10802g16722021412e-08
KLLA0B13112g7302091402e-08
CAGL0H06259g13361671412e-08
ADR167W8733051402e-08
CAGL0K04169g3981871382e-08
CAGL0M08404g4621271382e-08
KLLA0D07348g9091131402e-08
YHR205W (SCH9)8242901402e-08
CAGL0L03520g14471921402e-08
Kwal_55.203267502051392e-08
YAL017W (PSK1)13562451402e-08
KLLA0C16577g5041941382e-08
Scas_602.1111863011403e-08
KLLA0C08525g15512151403e-08
AFL090W3461281373e-08
KLLA0C18568g7743061393e-08
Scas_643.2010822531393e-08
Kwal_56.240593531501363e-08
Kwal_47.167617443061383e-08
ACL054W9723601384e-08
CAGL0D01694g4322411374e-08
Kwal_33.141678382651384e-08
Kwal_33.136817152351374e-08
ACR281C12592471384e-08
KLLA0D03190g3721071354e-08
Scas_689.25*4091071354e-08
ACR117W5241851365e-08
Scas_633.297893271375e-08
Scas_584.1110741911375e-08
ABL011C7012271365e-08
AFR372W7742041366e-08
CAGL0F03311g10452071376e-08
KLLA0B07579g7222371366e-08
Sklu_1995.27292041366e-08
Scas_685.245152071356e-08
AEL149C7272351367e-08
Sklu_2066.26392601357e-08
Kwal_27.100047351571367e-08
Kwal_27.97638682051358e-08
CAGL0K01617g7743401358e-08
YOL016C (CMK2)4472631339e-08
CAGL0H01199g16481981359e-08
Scas_673.20*7581921349e-08
KLLA0F01507g4722041331e-07
ACR119W9312291341e-07
Kwal_47.183076211911341e-07
CAGL0K03399g7031911341e-07
YKL126W (YPK1)6801511341e-07
CAGL0M03729g8611481341e-07
KLLA0F26983g4672721321e-07
Scas_700.34864941331e-07
CAGL0F00913g12061681341e-07
KLLA0C04191g7972261331e-07
Sklu_2429.54322561321e-07
CAGL0I03498g4512321321e-07
Scas_640.14*7282091331e-07
Kwal_56.245844351981321e-07
AEL185C5152361321e-07
Scas_720.1038043131322e-07
Sklu_1722.28092361322e-07
CAGL0M02519g7562741322e-07
KLLA0F14190g13382291332e-07
Scas_477.57032051322e-07
Scas_678.2416102021322e-07
CAGL0L06820g3662021302e-07
ADR317C8193461312e-07
YPL140C (MKK2)5061901302e-07
Kwal_33.140815802721312e-07
AER222C4232941302e-07
Kwal_33.141925771491312e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K11990g
         (976 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K11990g complement(1155395..1158370) some similarities with...  1791   0.0  
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...   561   0.0  
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...   532   e-173
Scas_661.27                                                           528   e-171
Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement         502   e-164
Kwal_27.10945                                                         496   e-160
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...   481   e-156
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...   484   e-155
Kwal_27.11542                                                         308   3e-91
Scas_601.6                                                            294   2e-87
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                          296   7e-87
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...   294   2e-86
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...   290   4e-86
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...   292   8e-86
Scas_671.16                                                           290   2e-85
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...   282   1e-82
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...   283   4e-82
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...   278   6e-82
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   107   2e-23
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...   100   3e-21
Sklu_2419.9 YMR001C, Contig c2419 14049-16136                         100   4e-21
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    99   6e-21
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    96   8e-20
Scas_700.28                                                            94   2e-19
Kwal_56.22476                                                          94   2e-19
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    93   4e-19
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            93   5e-19
Scas_644.15                                                            92   6e-19
Kwal_55.21545                                                          90   4e-18
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    90   5e-18
Kwal_26.8751                                                           89   8e-18
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    89   8e-18
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    88   2e-17
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    87   4e-17
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    86   9e-17
Sklu_2419.10 , Contig c2419 14439-16135                                84   2e-16
Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement          82   3e-16
Scas_580.6                                                             83   6e-16
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    82   1e-15
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    79   2e-15
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    81   3e-15
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    79   1e-14
Kwal_56.24274                                                          76   3e-14
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    78   3e-14
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    77   5e-14
Scas_693.17                                                            75   1e-13
Scas_564.7                                                             75   2e-13
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    74   2e-13
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    74   4e-13
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    74   5e-13
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    72   6e-13
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    74   6e-13
Scas_660.28                                                            73   6e-13
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    73   7e-13
Kwal_47.18233                                                          73   7e-13
Scas_707.36                                                            73   8e-13
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    73   1e-12
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    72   1e-12
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    72   2e-12
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            70   2e-12
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    71   2e-12
YPL236C (YPL236C) [5213] chr16 complement(101608..102702) Serine...    70   2e-12
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    72   3e-12
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    71   3e-12
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    71   3e-12
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    70   3e-12
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    71   4e-12
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    71   5e-12
Scas_493.2                                                             70   5e-12
Kwal_56.23717                                                          70   6e-12
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    70   6e-12
Kwal_23.5668                                                           69   2e-11
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    69   2e-11
Kwal_33.13112                                                          68   2e-11
Sklu_2073.3 YER129W, Contig c2073 2194-5742                            68   2e-11
Kwal_47.17263                                                          68   3e-11
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       67   3e-11
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    68   4e-11
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         67   4e-11
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    67   4e-11
Kwal_26.7788                                                           68   4e-11
Kwal_56.22693                                                          67   4e-11
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    66   4e-11
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    67   4e-11
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    66   5e-11
YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specifi...    66   5e-11
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    67   5e-11
Scas_627.7                                                             65   5e-11
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    67   7e-11
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    67   8e-11
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    67   8e-11
Kwal_23.6325                                                           67   9e-11
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    66   1e-10
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    66   1e-10
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    66   1e-10
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    66   1e-10
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    66   1e-10
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    65   1e-10
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    65   1e-10
Kwal_26.7154                                                           66   1e-10
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    65   1e-10
Scas_675.2                                                             65   1e-10
CAGL0M10153g complement(1010688..1013291) some similarities with...    65   2e-10
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    65   2e-10
Scas_598.6                                                             65   2e-10
Kwal_56.24091                                                          64   3e-10
Scas_502.2                                                             65   3e-10
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    64   3e-10
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    64   3e-10
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    64   4e-10
Scas_667.18                                                            64   4e-10
Kwal_26.7861                                                           64   4e-10
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    64   5e-10
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    64   6e-10
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    64   6e-10
Scas_668.22                                                            64   6e-10
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    64   7e-10
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    62   8e-10
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    63   8e-10
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    62   8e-10
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      63   9e-10
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    63   1e-09
Scas_458.1                                                             62   1e-09
Scas_629.16                                                            63   1e-09
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    63   1e-09
Scas_703.5                                                             62   1e-09
Kwal_26.8709                                                           62   2e-09
Scas_616.10                                                            62   2e-09
Kwal_23.5290                                                           62   2e-09
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    61   2e-09
CAGL0H00979g complement(94328..95527) similar to tr|Q12003 Sacch...    61   2e-09
Kwal_0.96                                                              61   2e-09
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    62   3e-09
Scas_651.18                                                            60   3e-09
Scas_653.25                                                            61   3e-09
Scas_548.6                                                             62   3e-09
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    61   3e-09
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    61   3e-09
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    61   3e-09
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    61   3e-09
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    61   3e-09
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    61   4e-09
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    60   4e-09
Sklu_2086.4 , Contig c2086 6437-7168 reverse complement                59   4e-09
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    61   4e-09
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    60   4e-09
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    61   5e-09
KLLA0D09328g complement(788565..791705) some similarities with s...    61   5e-09
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    60   5e-09
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    60   5e-09
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    60   6e-09
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    60   6e-09
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    60   6e-09
Kwal_33.13846                                                          59   6e-09
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    60   7e-09
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    59   7e-09
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    59   7e-09
Scas_720.94                                                            60   7e-09
Kwal_23.6458                                                           60   7e-09
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    60   7e-09
Kwal_26.7355                                                           60   8e-09
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    60   1e-08
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    60   1e-08
KLLA0B07205g complement(624606..625973) some similarities with s...    59   1e-08
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    59   1e-08
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    59   1e-08
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    60   1e-08
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    59   1e-08
AFL143C [3052] [Homologous to ScYPL236C - SH] (164241..165326) [...    59   1e-08
Kwal_27.12559                                                          59   1e-08
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    59   1e-08
Scas_544.6                                                             59   1e-08
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    59   1e-08
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    59   1e-08
Kwal_26.8347                                                           59   2e-08
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    59   2e-08
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    59   2e-08
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    59   2e-08
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    59   2e-08
Scas_634.5                                                             59   2e-08
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    59   2e-08
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    59   2e-08
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    59   2e-08
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    59   2e-08
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    58   2e-08
CAGL0M08404g complement(836791..838179) some similarities with s...    58   2e-08
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    59   2e-08
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    59   2e-08
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    59   2e-08
Kwal_55.20326                                                          58   2e-08
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    59   2e-08
KLLA0C16577g complement(1451181..1452695) some similarities with...    58   2e-08
Scas_602.11                                                            59   3e-08
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    59   3e-08
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    57   3e-08
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    58   3e-08
Scas_643.20                                                            58   3e-08
Kwal_56.24059                                                          57   3e-08
Kwal_47.16761                                                          58   3e-08
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    58   4e-08
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    57   4e-08
Kwal_33.14167                                                          58   4e-08
Kwal_33.13681                                                          57   4e-08
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    58   4e-08
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    57   4e-08
Scas_689.25*                                                           57   4e-08
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    57   5e-08
Scas_633.29                                                            57   5e-08
Scas_584.11                                                            57   5e-08
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    57   5e-08
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    57   6e-08
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    57   6e-08
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    57   6e-08
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            57   6e-08
Scas_685.24                                                            57   6e-08
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    57   7e-08
Sklu_2066.2 YJL128C, Contig c2066 5081-7000                            57   7e-08
Kwal_27.10004                                                          57   7e-08
Kwal_27.9763                                                           57   8e-08
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    57   8e-08
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    56   9e-08
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    57   9e-08
Scas_673.20*                                                           56   9e-08
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    56   1e-07
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    56   1e-07
Kwal_47.18307                                                          56   1e-07
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    56   1e-07
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    56   1e-07
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    56   1e-07
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    55   1e-07
Scas_700.34                                                            56   1e-07
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    56   1e-07
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    56   1e-07
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        55   1e-07
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    55   1e-07
Scas_640.14*                                                           56   1e-07
Kwal_56.24584                                                          55   1e-07
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    55   1e-07
Scas_720.103                                                           55   2e-07
Sklu_1722.2 YJL187C, Contig c1722 1158-3587 reverse complement         55   2e-07
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    55   2e-07
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    56   2e-07
Scas_477.5                                                             55   2e-07
Scas_678.24                                                            55   2e-07
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    55   2e-07
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    55   2e-07
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    55   2e-07
Kwal_33.14081                                                          55   2e-07
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    55   2e-07
Kwal_33.14192                                                          55   2e-07
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           55   2e-07
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    54   2e-07
Sklu_2099.2 , Contig c2099 975-2237 reverse complement                 54   3e-07
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    55   3e-07
Kwal_27.9773                                                           54   3e-07
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    55   3e-07
Kwal_14.1416                                                           54   3e-07
Kwal_14.1273                                                           54   3e-07
Scas_649.30                                                            55   3e-07
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    55   3e-07
Scas_721.124                                                           55   3e-07
Kwal_26.7635                                                           55   3e-07
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    54   3e-07
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    55   3e-07
Scas_717.69                                                            55   3e-07
Kwal_33.14434                                                          55   4e-07
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    54   4e-07
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    54   4e-07
Kwal_47.17252                                                          54   4e-07
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    54   4e-07
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    54   4e-07
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    55   4e-07
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    54   4e-07
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    54   4e-07
Scas_711.25                                                            54   5e-07
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    54   5e-07
Scas_718.90                                                            54   5e-07
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    54   5e-07
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    54   5e-07
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    54   5e-07
KLLA0C03938g complement(358851..360632) some similarities with s...    54   6e-07
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    54   6e-07
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    54   7e-07
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    54   7e-07
Scas_690.13                                                            53   7e-07
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    53   8e-07
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    54   8e-07
Kwal_17.2687                                                           53   8e-07
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    54   8e-07
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    53   8e-07
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    53   9e-07
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    53   1e-06
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    52   1e-06
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    52   1e-06
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            53   1e-06
Kwal_27.10581                                                          53   1e-06
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    53   1e-06
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    53   1e-06
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    53   1e-06
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         52   1e-06
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    52   1e-06
Scas_683.6                                                             52   2e-06
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    52   2e-06
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    52   2e-06
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          52   2e-06
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    52   2e-06
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    52   2e-06
Kwal_26.8941                                                           52   2e-06
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    51   2e-06
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         51   3e-06
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         52   3e-06
Scas_623.11                                                            51   3e-06
Sklu_2118.2 YAR018C, Contig c2118 1397-2677                            51   3e-06
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    51   3e-06
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    51   3e-06
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    50   4e-06
Scas_715.34                                                            51   4e-06
Kwal_55.20189                                                          51   4e-06
Scas_692.24                                                            51   4e-06
Kwal_56.23841                                                          50   4e-06
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    51   4e-06
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    50   4e-06
Scas_635.1                                                             50   4e-06
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    51   5e-06
Scas_683.12                                                            50   5e-06
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    50   5e-06
Scas_640.16                                                            50   5e-06
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    51   5e-06
Kwal_26.8703                                                           50   5e-06
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    50   6e-06
Scas_707.34                                                            50   6e-06
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    50   6e-06
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    50   7e-06
Scas_593.14d                                                           50   7e-06
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    50   7e-06
Kwal_55.22001                                                          50   7e-06
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    50   7e-06
Kwal_23.5576                                                           50   8e-06
YPR111W (DBF20) [5532] chr16 (747302..748996) Cell cycle protein...    50   8e-06
CAGL0K01661g complement(146952..148400) some similarities with t...    50   9e-06
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         50   9e-06
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    50   9e-06
Scas_655.2                                                             50   9e-06
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    50   9e-06
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    50   1e-05
Scas_713.38                                                            49   1e-05
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        50   1e-05
Kwal_47.17868                                                          49   1e-05
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    50   1e-05
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    50   1e-05
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    49   1e-05
Scas_698.37                                                            49   1e-05
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    50   1e-05
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    49   1e-05
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    49   1e-05
Scas_660.20                                                            49   1e-05
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         49   1e-05
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    49   2e-05
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    49   2e-05
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    49   2e-05
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    49   2e-05
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    49   2e-05
Scas_336.1                                                             49   2e-05
Scas_619.5*                                                            49   2e-05
Scas_688.14                                                            49   2e-05
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    48   2e-05
Kwal_33.13222                                                          45   2e-05
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    48   2e-05
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    49   2e-05
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    49   3e-05
Kwal_26.7682                                                           48   3e-05
Scas_610.7                                                             48   3e-05
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          48   3e-05
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         48   3e-05
Scas_705.23                                                            48   3e-05
Scas_201.1*                                                            47   3e-05
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    48   3e-05
Scas_651.19                                                            48   3e-05
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    48   4e-05
Kwal_33.14554                                                          48   4e-05
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    48   4e-05
Scas_654.12                                                            48   4e-05
Scas_710.28                                                            47   4e-05
Kwal_23.3590                                                           47   4e-05
KLLA0E11979g complement(1060048..1061892) some similarities with...    47   5e-05
KLLA0D12100g complement(1031728..1033161) some similarities with...    47   5e-05
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    47   5e-05
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    47   5e-05
CAGL0M08360g complement(833220..835520) some similarities with s...    47   5e-05
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    47   5e-05
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    47   6e-05
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       47   6e-05
Scas_700.35                                                            47   6e-05
Scas_618.8                                                             47   7e-05
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    47   7e-05
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      47   7e-05
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    47   7e-05
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    47   7e-05
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    47   8e-05
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    47   8e-05
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    47   8e-05
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    47   8e-05
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    47   8e-05
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    47   8e-05
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    47   9e-05
Scas_680.20                                                            46   9e-05
Sklu_2389.4 YJL057C, Contig c2389 7783-9576                            47   9e-05
YPL026C (SKS1) [5412] chr16 complement(500671..502179) Serine/th...    46   1e-04
Scas_582.1                                                             47   1e-04
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    46   1e-04
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    47   1e-04
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    46   1e-04
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    47   1e-04
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    46   1e-04
Kwal_0.307                                                             46   1e-04
Kwal_14.2497                                                           46   1e-04
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    46   1e-04
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    46   1e-04
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    46   1e-04
Kwal_55.21900                                                          46   1e-04
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    46   1e-04
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    46   2e-04
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    46   2e-04
Kwal_56.22788                                                          45   2e-04
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    45   2e-04
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    45   2e-04
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    45   2e-04
Scas_721.132                                                           45   2e-04
Scas_628.9                                                             45   4e-04
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    44   4e-04
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    44   4e-04
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    44   4e-04
Scas_716.33                                                            44   4e-04
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    44   4e-04
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    44   4e-04
Scas_721.61                                                            44   4e-04
Kwal_55.20221                                                          45   4e-04
Kwal_26.7552                                                           44   5e-04
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    44   5e-04
Scas_713.21                                                            44   5e-04
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    44   6e-04
Scas_689.24                                                            44   6e-04
Scas_721.110                                                           44   6e-04
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    44   6e-04
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    44   6e-04
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    44   6e-04
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    44   6e-04
Scas_677.18                                                            44   6e-04
Scas_713.7                                                             44   7e-04
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    43   7e-04
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    44   7e-04
Scas_22.1                                                              43   7e-04
Sklu_2307.1 YPL042C, Contig c2307 215-1945                             44   9e-04
Scas_584.8                                                             44   0.001
Kwal_33.13831                                                          44   0.001
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    43   0.001
Kwal_27.11777                                                          43   0.001
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    43   0.001
Scas_613.5                                                             43   0.001
KLLA0B06501g complement(576636..579089) some similarities with s...    43   0.001
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    43   0.001
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    43   0.001
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    43   0.001
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    43   0.001
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    43   0.001
Sklu_2401.9 YGR092W, Contig c2401 17788-19521                          43   0.001
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    43   0.001
Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement         42   0.001
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    43   0.002
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    42   0.002
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    42   0.002
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    42   0.002
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    42   0.002
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    42   0.002
Scas_573.10                                                            42   0.003
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    42   0.003
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    42   0.003
Scas_648.17                                                            41   0.003
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    42   0.003
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    42   0.003
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    41   0.003
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    41   0.004
Kwal_27.11830                                                          41   0.004
Scas_716.73                                                            41   0.004
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    41   0.004
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    41   0.004
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    41   0.004
Sklu_1987.1 YBL016W, Contig c1987 623-1996                             41   0.004
Scas_568.13                                                            41   0.005
YHR079C (IRE1) [2368] chr8 complement(258245..261592) Protein ki...    41   0.005
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    41   0.006
YLR248W (RCK2) [3644] chr12 (634254..636086) Calcium/calmodulin-...    40   0.006
Kwal_23.3992                                                           40   0.007
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    40   0.007
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    40   0.008
Scas_651.3                                                             40   0.008
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    40   0.008
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    40   0.008
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    40   0.010
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    40   0.010

>CAGL0K11990g complement(1155395..1158370) some similarities with
           sp|P38080 Saccharomyces cerevisiae YBR059c AKL1
           Ark-family Kinase-Like protein, hypothetical start
          Length = 991

 Score = 1791 bits (4638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 883/976 (90%), Positives = 883/976 (90%)

Query: 1   MSDLSKTPSLDVRGENSKESQELRGKSSANLNAPGXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSDLSKTPSLDVRGENSKESQELRGKSSANLNAPG                         
Sbjct: 1   MSDLSKTPSLDVRGENSKESQELRGKSSANLNAPGTPVQTVVPSVVPPVAQPVAQPVVAP 60

Query: 61  XXMKDIXXXXXXXXXXXXXXXXXIPPVAQPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGF 120
             MKDI                 IPPVAQPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGF
Sbjct: 61  SAMKDIKSQTPVQVPQTQVKPQSIPPVAQPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGF 120

Query: 121 AQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQ 180
           AQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQ
Sbjct: 121 AQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQ 180

Query: 181 GAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFK 240
           GAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFK
Sbjct: 181 GAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFK 240

Query: 241 IMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAM 300
           IMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAM
Sbjct: 241 IMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAM 300

Query: 301 LSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLH 360
           LSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLH
Sbjct: 301 LSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLH 360

Query: 361 SKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVLYYLSEVTNREVPPTVLSDKYGQGP 420
           SKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVLYYLSEVTNREVPPTVLSDKYGQGP
Sbjct: 361 SKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVLYYLSEVTNREVPPTVLSDKYGQGP 420

Query: 421 YNFEKYTRFQKEXXXXXXXXXXXXAKINDPNSTMQPADWELYDRMYMSAFTIVPQLPVSD 480
           YNFEKYTRFQKE            AKINDPNSTMQPADWELYDRMYMSAFTIVPQLPVSD
Sbjct: 421 YNFEKYTRFQKESQQVQLQLSTLQAKINDPNSTMQPADWELYDRMYMSAFTIVPQLPVSD 480

Query: 481 RKIVAXXXXXXXXXXXXXXXXXXXXXXXXXNIPQIQQMPQLQVPPSQASNEFGTDDENFK 540
           RKIVA                         NIPQIQQMPQLQVPPSQASNEFGTDDENFK
Sbjct: 481 RKIVAQNQFIQPGQQQQSQIPQISNRPIQSNIPQIQQMPQLQVPPSQASNEFGTDDENFK 540

Query: 541 TSRSKSNQLGYQKENNDPKSGAIPNFDGDPFNSTLPRKDSNAEYRRSQLIVQGNIGPSRS 600
           TSRSKSNQLGYQKENNDPKSGAIPNFDGDPFNSTLPRKDSNAEYRRSQLIVQGNIGPSRS
Sbjct: 541 TSRSKSNQLGYQKENNDPKSGAIPNFDGDPFNSTLPRKDSNAEYRRSQLIVQGNIGPSRS 600

Query: 601 MGSVSPVQSPVNYNQNHPNFQALNLERGMEKPVNYHKGNPFEQDMPGNNGKFVQKGQPIQ 660
           MGSVSPVQSPVNYNQNHPNFQALNLERGMEKPVNYHKGNPFEQDMPGNNGKFVQKGQPIQ
Sbjct: 601 MGSVSPVQSPVNYNQNHPNFQALNLERGMEKPVNYHKGNPFEQDMPGNNGKFVQKGQPIQ 660

Query: 661 INQQPLYVGASSQMGQNMNKNQEKRSSDLEGKYNNTSSSNFDPSLLRENVPNKSSMSHLL 720
           INQQPLYVGASSQMGQNMNKNQEKRSSDLEGKYNNTSSSNFDPSLLRENVPNKSSMSHLL
Sbjct: 661 INQQPLYVGASSQMGQNMNKNQEKRSSDLEGKYNNTSSSNFDPSLLRENVPNKSSMSHLL 720

Query: 721 DKNGNQVELPPRPKRSSMQSQTMPSDNVPTNATSNHTRTRSVDAHKVSFEGSSDRGFSKG 780
           DKNGNQVELPPRPKRSSMQSQTMPSDNVPTNATSNHTRTRSVDAHKVSFEGSSDRGFSKG
Sbjct: 721 DKNGNQVELPPRPKRSSMQSQTMPSDNVPTNATSNHTRTRSVDAHKVSFEGSSDRGFSKG 780

Query: 781 NTNNKVQDKSAQNILXXXXXXXXXXXXRDYRKEVFTGQALRTINSSPQSARSDNSSHPSN 840
           NTNNKVQDKSAQNIL            RDYRKEVFTGQALRTINSSPQSARSDNSSHPSN
Sbjct: 781 NTNNKVQDKSAQNILEEEGFFENEYGNRDYRKEVFTGQALRTINSSPQSARSDNSSHPSN 840

Query: 841 AEFAQLGKKTLQGNFEKPNKKTLDIDYQEVDFSPALSDNTTRQGYFEGQSPGFSDQLSYD 900
           AEFAQLGKKTLQGNFEKPNKKTLDIDYQEVDFSPALSDNTTRQGYFEGQSPGFSDQLSYD
Sbjct: 841 AEFAQLGKKTLQGNFEKPNKKTLDIDYQEVDFSPALSDNTTRQGYFEGQSPGFSDQLSYD 900

Query: 901 LNDALEFDRRGKDSRHMTPGAFDTGGLQKLKSSSLNRSQGSISSGANEWPESSDRLHSAR 960
           LNDALEFDRRGKDSRHMTPGAFDTGGLQKLKSSSLNRSQGSISSGANEWPESSDRLHSAR
Sbjct: 901 LNDALEFDRRGKDSRHMTPGAFDTGGLQKLKSSSLNRSQGSISSGANEWPESSDRLHSAR 960

Query: 961 KSLDLDRARQLHNYQS 976
           KSLDLDRARQLHNYQS
Sbjct: 961 KSLDLDRARQLHNYQS 976

>YBR059C (AKL1) [250] chr2 complement(356821..360147)
           Serine/threonine protein kinase of unknown function
           [3327 bp, 1108 aa]
          Length = 1108

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/395 (67%), Positives = 315/395 (79%), Gaps = 12/395 (3%)

Query: 84  IPPVAQPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESM 143
           +  +  P +E ++  G +V VG+H+VEVV+YLAEGGFAQIYVVKF+EY NEF    D + 
Sbjct: 11  VSAMGHPAVE-RYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEF----DNTA 65

Query: 144 NQPLKPGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNI 203
           + PLK G  ACLKRVLVQDE GLN+MR+EVEVMKKL+GAPNIVQYFDSNASR RD     
Sbjct: 66  SVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDG---- 121

Query: 204 TQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRD 263
            QGFEVLLLMELCPNKSLLDYMNQRL+TKLTE EI KIMYD+ L+++QMHYLPV LIHRD
Sbjct: 122 VQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRD 181

Query: 264 IKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFK 323
           IKIENVLVDA NNFKL DFGSTSTCFP  T+ QDIA+L+Q++Y+HTTPQYRSPEMIDL++
Sbjct: 182 IKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYR 241

Query: 324 YIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLA 383
            +PINEKSDIWALGVFLYKLLFFTTPFE TGQFA+LHSK+EFP N YSSKLINLII+MLA
Sbjct: 242 CLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIMLA 301

Query: 384 ENPSLRPNIYQVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKEXXXXXXXXXXX 443
           ENP+LRPNIYQVLY+L E+ N EVP   + DKY +G YNF KYT+FQ +           
Sbjct: 302 ENPNLRPNIYQVLYHLCEILNVEVP---IEDKYAEGAYNFSKYTQFQNKLQNVQLQMYQL 358

Query: 444 XAKINDPNSTMQPADWELYDRMYMSAFTIVPQLPV 478
             K    N+ +  ++  L + M++S+F I  +LP+
Sbjct: 359 QQKKIMQNNKLSDSEENLLNDMFLSSFEISSKLPM 393

>CAGL0H10208g complement(996853..999936) similar to sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 1027

 Score =  532 bits (1371), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 246/385 (63%), Positives = 303/385 (78%), Gaps = 10/385 (2%)

Query: 93  EEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSP 152
           EEK+P G++++VG+HRVE+VSYLAEGGFAQIYVVKFVEY NEFE    +S    +  G  
Sbjct: 17  EEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSA---ITVGDI 73

Query: 153 ACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLL 212
           ACLKRV+V DE+GLN+MR+EVEVMKKL+ +PNIVQYFDSNASR  D       GFEVLLL
Sbjct: 74  ACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKP----GFEVLLL 129

Query: 213 MELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVD 272
           MELCPNKSLLDYMNQRL TKL+E EI KIMYD+++ ++ MHYL  PLIHRDIKIENVLVD
Sbjct: 130 MELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVD 189

Query: 273 ANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSD 332
           ANNNFKLCD GSTS C P   S QDIAM++Q++Y+HTTPQYR+PEMIDL++Y+PINEKSD
Sbjct: 190 ANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSD 249

Query: 333 IWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNI 392
           IWALG+FLYKLLF+TTPFE TGQ A+LHSK++FPPN YSSK+INLII+MLAENP+LRPNI
Sbjct: 250 IWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNI 309

Query: 393 YQVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKEXXXXXXXXXXXXAKINDPNS 452
           +QV+Y++  + N  VP   + D+YG GPYNF+ YT+FQ +             K+    S
Sbjct: 310 FQVVYHICSIMNLPVP---IEDRYGLGPYNFDLYTKFQSKVQTIQNQINYLQNKVVSSKS 366

Query: 453 TMQPADWELYDRMYMSAFTIVPQLP 477
            +   D  + D +Y+  F ++P++P
Sbjct: 367 KLSKEDGLVLDELYIKTFEMIPKIP 391

>Scas_661.27
          Length = 1095

 Score =  528 bits (1360), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 250/384 (65%), Positives = 304/384 (79%), Gaps = 10/384 (2%)

Query: 94  EKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPA 153
           E++  G  V VG+H+VE++ Y+AEGGFAQIY VKF+E+ NEFE   +  M   L+ G  A
Sbjct: 20  ERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFE---NNRMKPKLQMGDVA 76

Query: 154 CLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLM 213
           CLKRVLVQDE GLN+MR+EVEVMK+LQGAPNIVQY+DSNASR      N   GFEVLLLM
Sbjct: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRH----NGFPGFEVLLLM 132

Query: 214 ELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDA 273
           ELCPNKSLLDYMNQRLATKLTE+EI KIMYD+T AV+QMHYLP PL+HRDIKIENVLVDA
Sbjct: 133 ELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDA 192

Query: 274 NNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDI 333
            NNFKLCDFGSTST FP  T+ QDIA+L+Q++Y+HTTPQYRSPEMIDL++ +PI+EKSDI
Sbjct: 193 QNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDI 252

Query: 334 WALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIY 393
           WALG+FLYKLLFFTTPFE TGQFA+LHSK+EFP N+YSSKLINLII+MLAENP+LRPNIY
Sbjct: 253 WALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIY 312

Query: 394 QVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKEXXXXXXXXXXXXAKINDPNST 453
           QVL+ +  ++  +VP   + D+Y +GPY+FEKYT FQ +             K    N  
Sbjct: 313 QVLHNICSISGMKVP---IEDQYAEGPYDFEKYTHFQNKVQSVQYQLYLLQEKKFKTNGK 369

Query: 454 MQPADWELYDRMYMSAFTIVPQLP 477
           +  AD  L + +++++F I  ++P
Sbjct: 370 LPQADINLLNDLFVTSFDIASKVP 393

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 54/137 (39%), Gaps = 26/137 (18%)

Query: 860  KKTLDIDYQEVDFSPALSDNTTRQGYFEGQSPGFSDQLSYDLNDA----LEFDRRGKDS- 914
            +++LD+ YQE++FSP L  + +             +  S + +D+     E ++R +   
Sbjct: 936  RRSLDLRYQEINFSPDLRKDKSNSSTSVHHISSIREDESVNEDDSELTLTENEKRQRQQP 995

Query: 915  RHMTPGAFDTGG---------------------LQKLKSSSLNRSQGSISSGANEWPESS 953
            RH     FD+                       L+  K S+ N S  SI        E  
Sbjct: 996  RHHQHTHFDSSSNLNSKGANRSSSRGNIRGKQDLESYKHSTKNNSNSSIPISTTNTNEMK 1055

Query: 954  DRLHSARKSLDLDRARQ 970
                 AR+SLDL+R R+
Sbjct: 1056 KSFAKARQSLDLERVRR 1072

>Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement
          Length = 858

 Score =  502 bits (1293), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 238/385 (61%), Positives = 299/385 (77%), Gaps = 21/385 (5%)

Query: 94  EKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPA 153
           EK   G ++ VGSH+VE+V YLAEGGFA IYVVKFVE++NE E     + +  LK G  A
Sbjct: 30  EKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELE-----TPSSSLKEGDLA 84

Query: 154 CLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLM 213
           CLKRVLV DE GLN++R+EVEVMK+L+ + NIVQY+DSNASR RD S     G+EVLLLM
Sbjct: 85  CLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSP----GYEVLLLM 140

Query: 214 ELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDA 273
           ELCPNKSLLDYMNQRLATKL+E+E+ KIMYD+T AVAQMH+LP PLIHRDIKIENVLVD+
Sbjct: 141 ELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDS 200

Query: 274 NNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDI 333
            NNFKLCDFGSTS+CFP  T+ QDIA+L+ ++Y+HTTPQYR+PEMIDL++ +PI+EKSDI
Sbjct: 201 ENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDI 260

Query: 334 WALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIY 393
           WALG+FLYKLLF+TTPFE TGQFA+LHSK++ P N+YSSKLINLII+MLAENP+LRPNIY
Sbjct: 261 WALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIY 320

Query: 394 QVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKEXXXXXXXXXXXXAKINDPNST 453
           QV+Y +  +   +VP     DKY  GPY+F+KY+++Q++                   S 
Sbjct: 321 QVIYQVCAIMKVDVP---FEDKYQTGPYDFDKYSKYQEKLQAFQYQLYI---------SY 368

Query: 454 MQPADWELYDRMYMSAFTIVPQLPV 478
            Q  D +  + ++++ F I P+ P+
Sbjct: 369 HQKQDVDTLNDLFINCFEIAPKQPM 393

>Kwal_27.10945
          Length = 935

 Score =  496 bits (1277), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 246/398 (61%), Positives = 298/398 (74%), Gaps = 32/398 (8%)

Query: 92  IEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGS 151
           + E+   G  V VG+HRVE+V YLAEGGFA IYVV+F+EY NE E    +     L+ G 
Sbjct: 67  VLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELE----QVPTIKLEVGD 122

Query: 152 PACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLL 211
            ACLKRVLV DE GLN+MR+EV VMK+L G PNIVQY+DS+ASR RD S     GFEV L
Sbjct: 123 LACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSS----GFEVTL 178

Query: 212 LMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLV 271
           LMELCPN SLLDYMNQRLATKL+EQEI KIM+D+T A+AQMHYLPVPLIHRD+KIENVLV
Sbjct: 179 LMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLV 238

Query: 272 DANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKS 331
           DAN+NFKLCDFGSTSTCFP   + Q+IA+L+ ++Y+HTTPQYRSPEMIDL++ +PINEKS
Sbjct: 239 DANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKS 298

Query: 332 DIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPN 391
           DIWALG+FLYKLLF+TTPFE TGQFA+LHSK+EFP N+YSSKLINLII+MLAENP+LRPN
Sbjct: 299 DIWALGIFLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPN 358

Query: 392 IYQVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKEXXXXXXXXXXXXAKINDPN 451
           IYQV+  L  +   + P   L DKY  G Y+FEKY+++Q              AK+    
Sbjct: 359 IYQVMDNLCSILKVKNP---LEDKYQLGSYSFEKYSQYQ--------------AKLQKVQ 401

Query: 452 STMQPA-----DWELYDRMYMSAFTIVPQLPV--SDRK 482
             M  A       +  + M+++ F + P+ PV  SD+K
Sbjct: 402 YQMYLAYENKQQIDTLNDMFINCFEVAPKQPVDISDKK 439

>KLLA0F18612g 1711131..1713575 some similarities with sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 814

 Score =  481 bits (1237), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 228/377 (60%), Positives = 285/377 (75%), Gaps = 15/377 (3%)

Query: 102 VTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQ 161
           V VG+HR E++ +LAEGGFA IY VKF+E TNE +   D  +   LK G  ACLKRV+V 
Sbjct: 35  VVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKL---LKAGDIACLKRVIVP 91

Query: 162 DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSL 221
           DE GLN++R+EVE MK+L+G+PNIVQY+DSNASR  D S     GFE+LLLMELCP KSL
Sbjct: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSP----GFEILLLMELCPKKSL 147

Query: 222 LDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCD 281
           LDYMN +LATKLTE EI KIMYD++ A+AQMHYLP PLIHRDIKIENVLVD ++NFKLCD
Sbjct: 148 LDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCD 207

Query: 282 FGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLY 341
           FGSTS CFP  ++ QDIA+L+ ++Y+HTTPQYRSPEMIDL++ +PINEKSDIWALG+FLY
Sbjct: 208 FGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 267

Query: 342 KLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVLYYLSE 401
           KLLF+TTPFE TGQFA+LHSK+E P N YSSKLINLII+MLAENPSLRPNIYQV++++  
Sbjct: 268 KLLFYTTPFELTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCS 327

Query: 402 VTNREVPPTVLSDKYGQGPYNFEKYTRFQKEXXXXXXXXXXXXAKINDPNSTMQPADWEL 461
           +   +VP    +DKY  GPY+F KY+++  +                  N  +   D + 
Sbjct: 328 ILKCDVP---FTDKYELGPYDFAKYSQYHLKLQQIQYQMFELYK-----NEKVTSGDVDK 379

Query: 462 YDRMYMSAFTIVPQLPV 478
            + +++  F I P+ P+
Sbjct: 380 LNDLFIQNFEIAPKQPI 396

>AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH]
           (763309..766194) [2886 bp, 961 aa]
          Length = 961

 Score =  484 bits (1245), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 227/339 (66%), Positives = 271/339 (79%), Gaps = 12/339 (3%)

Query: 94  EKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPA 153
           E   AG  V VG H+VEV+ YLAEGGFA IY V FV YTNE +R++     + L+PG   
Sbjct: 27  EMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQD-----RILQPGDTV 81

Query: 154 CLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLM 213
           CLKRV V DE GLN++R+EVEVMKKL+   NIVQY+DSNASRL    G+   G+EVLLLM
Sbjct: 82  CLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRL----GDGKPGYEVLLLM 137

Query: 214 ELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDA 273
           ELCPN SLLDYMNQRLATKL+E E+ KIMYDIT+ ++ MHY   PLIHRDIKIENVLVDA
Sbjct: 138 ELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDA 197

Query: 274 NNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDI 333
           +NNFKLCDFGSTS C PA  S Q+IAML  ++Y+HTTPQYRSPEMIDL++ +PINEKSDI
Sbjct: 198 DNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDI 257

Query: 334 WALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIY 393
           WALG+FLYKLLF+TTPFE TGQFA+LHSK+E P NS+SSKLINL+I+MLAENP LRPN+Y
Sbjct: 258 WALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVY 317

Query: 394 QVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKE 432
           QV+Y++  +   EV    + D YGQGPYNF+ Y R+Q++
Sbjct: 318 QVMYHICSMMECEVK---IDDLYGQGPYNFDMYGRYQEK 353

>Kwal_27.11542
          Length = 791

 Score =  308 bits (788), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 156/314 (49%), Positives = 201/314 (64%), Gaps = 18/314 (5%)

Query: 96  FPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACL 155
           +  G  +TVGSH+  ++ YL  GGFA IY  +              S   P   G+ ACL
Sbjct: 9   YTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI-------------SPADPNSIGNVACL 55

Query: 156 KRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMEL 215
           KRVLV D+  LN +R+EV+ MK L+G  ++V Y DS+A++    SG     +EV LLME 
Sbjct: 56  KRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAK----SGAQDGSYEVFLLMEY 111

Query: 216 CPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANN 275
           C    L+D+MN RL  +LTE E+ KIM DIT  +A MH L  PLIHRDIKIENVL+  + 
Sbjct: 112 CSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDK 171

Query: 276 NFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWA 335
            FK+CDFGS         + Q+ + +  D+  +TT QYRSPEMIDL++  PINEKSDIWA
Sbjct: 172 TFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWA 231

Query: 336 LGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPSLRPNIYQ 394
           LGVFLYKL ++TTPFE+ G  A+LHS+F+FP    YS +L NLI VML+ENP+ RPNI Q
Sbjct: 232 LGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQ 291

Query: 395 VLYYLSEVTNREVP 408
           VL  +S + N   P
Sbjct: 292 VLEEVSRIQNVPCP 305

>Scas_601.6
          Length = 661

 Score =  294 bits (753), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 207/322 (64%), Gaps = 21/322 (6%)

Query: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148
           QPQI    P G ++TVGSH+V+VV YL  GGFAQIY V+ +   ++F   N         
Sbjct: 3   QPQIPLYQP-GTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTNTNV-------- 52

Query: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208
               ACLKRV+V D+  LN +R+EV+ MK L+   ++V Y DS+A++     G     +E
Sbjct: 53  ----ACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEG----SYE 104

Query: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268
           V LLME C    L+D+MN RL  +L E EI  IM  +T  +A MH L  PL+HRDIKIEN
Sbjct: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164

Query: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328
           VL+ +   +K+CDFGS        ++ Q+++ +  D+  +TT QYR+PEMIDL++ +PI+
Sbjct: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPID 224

Query: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFP--PNSYSSKLINLIIVMLAENP 386
           EKSDIWALGVFLYKL ++TTPFE+ G+ A+LH+ F+FP  P  YS +L  LI  ML E P
Sbjct: 225 EKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYP-QYSDRLKKLITYMLMEQP 283

Query: 387 SLRPNIYQVLYYLSEVTNREVP 408
           S RPN YQVL  +S + N + P
Sbjct: 284 SQRPNSYQVLEEVSSMQNVQCP 305

>Sklu_2226.7 YIL095W, Contig c2226 8986-11373
          Length = 795

 Score =  296 bits (758), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 152/325 (46%), Positives = 205/325 (63%), Gaps = 24/325 (7%)

Query: 87  VAQPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQP 146
           ++QP +E  +P+G V+TVGSH+  ++ YL  GGFA IY  +                  P
Sbjct: 1   MSQPPLET-YPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI----------------SP 43

Query: 147 LKPGSP--ACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNIT 204
             P S   ACLKRVLV D+  LN +R+EV+ MK L+    +V Y DS+A++    +G+  
Sbjct: 44  PDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGS-- 101

Query: 205 QGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDI 264
             +EV LLME C    L+D+MN RL  +L E E+ KIM  ++  VA MH L  PLIHRDI
Sbjct: 102 --YEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDI 159

Query: 265 KIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKY 324
           KIENVL+  + NFK+CDFGS         + Q++  +  D+  +TT QYRSPEMIDL++ 
Sbjct: 160 KIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRG 219

Query: 325 IPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLA 383
           +P++EKSDIWALGVFLYKL ++TTPFE+ G+ A+LHSKF+FP    YS +L NLI  +L 
Sbjct: 220 LPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLR 279

Query: 384 ENPSLRPNIYQVLYYLSEVTNREVP 408
           ENP  RPNI Q+L  +S +     P
Sbjct: 280 ENPMQRPNICQLLAEVSRIQGVPCP 304

>KLLA0E08371g complement(756205..758538) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1 serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization, start by similarity
          Length = 777

 Score =  294 bits (753), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 156/321 (48%), Positives = 205/321 (63%), Gaps = 19/321 (5%)

Query: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148
           QPQIE K+ +G ++ VGSH+V+V+ YLA GGFA +Y V+              S   P+ 
Sbjct: 3   QPQIE-KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI-------------SPPDPVC 48

Query: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208
           P + ACLKRV+V D+  LN +R+EV+ MK L+G   IV Y DS+A++     G     +E
Sbjct: 49  PDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGM----YE 104

Query: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268
           V LLME C    L+D+MN RL  +L E EI  IM  ++  VA MH L  PLIHRDIKIEN
Sbjct: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164

Query: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328
           VL+  N+ FKLCDFGS S    A  + ++   +  D+  +TT QYR PEMIDL++ +PI+
Sbjct: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPID 224

Query: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPS 387
           EKSDIWALGVFLYK  ++TTPFE+ G+ A+L SKFEFP    YS ++ NLI VML  +P 
Sbjct: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPL 284

Query: 388 LRPNIYQVLYYLSEVTNREVP 408
            RPNI QV+  +S +     P
Sbjct: 285 KRPNICQVVEEVSRIQGIPCP 305

>YNL020C (ARK1) [4567] chr14 complement(595621..597537)
           Serine/threonine protein kinase associated with cortical
           actin cytoskeleton [1917 bp, 638 aa]
          Length = 638

 Score =  290 bits (741), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 153/325 (47%), Positives = 206/325 (63%), Gaps = 27/325 (8%)

Query: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148
           QPQI   +  G  +TVGSH+VE++ YL  GGFAQ+Y                 ++  P  
Sbjct: 3   QPQIG-TYNVGTQLTVGSHQVEIIKYLTSGGFAQVY----------------SALINPPD 45

Query: 149 P---GSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQ 205
           P    S ACLKRV+V D+  LN +R+EV+ M+ L+    +V Y DS+A++   ++G    
Sbjct: 46  PHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNG---- 101

Query: 206 GFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIK 265
            +EV +LME C    L+D+MN RL  +L E EI +IM  +T  VA MH L  PLIHRDIK
Sbjct: 102 SYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIK 161

Query: 266 IENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYI 325
           IENVL+ ANN +KLCDFGS         + Q+++ + QD+  +TT QYRSPEMID F+ +
Sbjct: 162 IENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGL 221

Query: 326 PINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFP--PNSYSSKLINLIIVMLA 383
           PI+EKSDIWALG+FLYKL ++TTPFE+ G  A+L  KFEFP  PN YS +L  LI  +L 
Sbjct: 222 PIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPN-YSEQLKGLIRDILV 280

Query: 384 ENPSLRPNIYQVLYYLSEVTNREVP 408
           ++P  RPN+YQ+L  +S + N   P
Sbjct: 281 QDPRHRPNVYQLLKRISIMQNVPCP 305

>ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C
           (ARK1) - SH] complement(321493..323745) [2253 bp, 750
           aa]
          Length = 750

 Score =  292 bits (747), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 145/311 (46%), Positives = 201/311 (64%), Gaps = 19/311 (6%)

Query: 99  GKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRV 158
           G ++TVGSH V+++ YL  GGFAQIY  + +                P++ GS ACLKRV
Sbjct: 12  GIILTVGSHEVKIIQYLTSGGFAQIYSCEVLS-------------PGPIQ-GSLACLKRV 57

Query: 159 LVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPN 218
            V D+  LN +R+EV+ MK L+G  ++V Y DS+A++   + G     +EV LLME C  
Sbjct: 58  HVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT----YEVYLLMEYCLR 113

Query: 219 KSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFK 278
             L+D+MN RL T+L+E E+ KIM  +   +  MH L  PLIHRDIKIENVL+  + +FK
Sbjct: 114 GGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFK 173

Query: 279 LCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGV 338
           +CDFGS S       +  +   +  D+  +TT QYR+PEMIDL++ +P++EKSDIWALGV
Sbjct: 174 VCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGV 233

Query: 339 FLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPSLRPNIYQVLY 397
           FLYK+ +FTTPFE+ G+ A+L +KF+FP    Y+ +L NLI VML+E+P  RPNI QVL 
Sbjct: 234 FLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLE 293

Query: 398 YLSEVTNREVP 408
            +S +     P
Sbjct: 294 EVSRIQGVPCP 304

>Scas_671.16
          Length = 723

 Score =  290 bits (743), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 150/321 (46%), Positives = 202/321 (62%), Gaps = 19/321 (5%)

Query: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148
           QP I   +P G ++TVGSH  +++ YL  GGFAQIY       T E    N      P  
Sbjct: 3   QPNIP-TYPPGTLLTVGSHYCKIIKYLTSGGFAQIY-------TTEISPIN------PYN 48

Query: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208
               ACLKRV+V D+ GLN +R+EV+ MK L+   ++V Y DS+A+R    +G     +E
Sbjct: 49  NSQTACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAG----AYE 104

Query: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268
           V LLME C    L+D+MN RL  +LTE+EI  I+      V+ MH L   LIHRDIKIEN
Sbjct: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164

Query: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328
           VL+ A   FK+CDFGS  +      + Q++A +  D+  +TT QYR+PEM+DL++ +PIN
Sbjct: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224

Query: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPP-NSYSSKLINLIIVMLAENPS 387
           EKSDIWALGVFLYKL ++TTPFE+ G+ A+LHS++++P    Y+ KL NLI   L E+PS
Sbjct: 225 EKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPS 284

Query: 388 LRPNIYQVLYYLSEVTNREVP 408
            RPNI Q+L  +S +     P
Sbjct: 285 KRPNICQLLEEISRIQGIPCP 305

>CAGL0G02607g complement(240244..242310) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1, start by
           similarity
          Length = 688

 Score =  282 bits (721), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 151/323 (46%), Positives = 205/323 (63%), Gaps = 23/323 (7%)

Query: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148
           QP+++ +   G  +TVG+H V+++ YL  GGFAQIY V              E ++  L 
Sbjct: 3   QPELD-RINVGTQLTVGTHSVKILKYLTSGGFAQIYAV--------------EILSMGLF 47

Query: 149 PGS-PACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGF 207
            GS  ACLKRV V D++ LN +R+EV+ MK L    ++V Y DS+A+R     G     +
Sbjct: 48  NGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGT----Y 103

Query: 208 EVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267
           EV LLME C    L+D+MN RL  +LTE EI  IM   T  +A MH L  PL+HRDIKIE
Sbjct: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163

Query: 268 NVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPI 327
           NVL+     +K+CDFGS S       + Q++  +  D+  +TT QYR PEM+DL++ +PI
Sbjct: 164 NVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPI 223

Query: 328 NEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFP--PNSYSSKLINLIIVMLAEN 385
           +EK+DIWALGVFLYKL ++TTPFE+ G+ A+LH++F+FP  PN YS +L NLI  ML E+
Sbjct: 224 DEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPN-YSDRLKNLIKSMLREH 282

Query: 386 PSLRPNIYQVLYYLSEVTNREVP 408
           PS RPN+ QVL  +S + N   P
Sbjct: 283 PSDRPNVCQVLEEVSRMQNVPCP 305

>YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization [2433 bp, 810 aa]
          Length = 810

 Score =  283 bits (725), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 144/320 (45%), Positives = 200/320 (62%), Gaps = 20/320 (6%)

Query: 90  PQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKP 149
           PQI    P G ++TVGSH  +++ YL  GGFAQ+Y  +              S   P   
Sbjct: 4   PQISLYEP-GTILTVGSHHAKIIKYLTSGGFAQVYTAEI-------------SPPDPYSN 49

Query: 150 GSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEV 209
            + ACLKRV+V  + GLN +R+EV+ MK L+   ++V Y DS+A+R    +G     +EV
Sbjct: 50  ANIACLKRVIVPHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAAR--SVNG---IAYEV 104

Query: 210 LLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENV 269
            +LME C    L+D+MN RL  +L E EI +IM      +  MH L  PLIHRDIKIENV
Sbjct: 105 FVLMEFCERGGLIDFMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENV 164

Query: 270 LVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINE 329
           L+  +  +K+CDFGS S       + Q+   +  D+  +TT QYRSPEMIDL++ +PI+E
Sbjct: 165 LISHDGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDE 224

Query: 330 KSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPP-NSYSSKLINLIIVMLAENPSL 388
           KSDIWALGVFLYK+ ++TTPFE++G+  +LH+++++P    YS +L NLI +ML E PS 
Sbjct: 225 KSDIWALGVFLYKICYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQ 284

Query: 389 RPNIYQVLYYLSEVTNREVP 408
           RPNI QVL  +S + N+  P
Sbjct: 285 RPNICQVLEEVSRLQNKPCP 304

>CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces
           cerevisiae YNL020c ARK1 or sp|P40494 Saccharomyces
           cerevisiae YIL095w PRK1, start by similarity
          Length = 622

 Score =  278 bits (711), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 144/315 (45%), Positives = 198/315 (62%), Gaps = 18/315 (5%)

Query: 95  KFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPAC 154
           K+  G  VTVGSH V ++ YL  GG+AQIY  + +   ++F   N             A 
Sbjct: 8   KYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQFLGTN------------MAV 54

Query: 155 LKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLME 214
           LKRV+V D+  LN +R+EV+ MK+L+    IV Y DS+A++ +   G     +EV L+ME
Sbjct: 55  LKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGT----YEVFLIME 110

Query: 215 LCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDAN 274
            C    L+D+MN RL  +LTE EI  I   I+  VA MH L  PLIHRDIKIENVL+  +
Sbjct: 111 YCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISND 170

Query: 275 NNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIW 334
           + +KLCDFGS S       + +++A +  D+ M TT QYR+PEM+DL K   +N+KSDIW
Sbjct: 171 HKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIW 230

Query: 335 ALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPSLRPNIY 393
           ALGVFLYKL ++TTPFE+TG+  +L+   EFPP   YS  +  LI+ MLA+NP  RPNI+
Sbjct: 231 ALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIF 290

Query: 394 QVLYYLSEVTNREVP 408
           Q++  +S++ N   P
Sbjct: 291 QIIQTVSKLLNVNCP 305

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 87/292 (29%), Positives = 141/292 (48%), Gaps = 57/292 (19%)

Query: 114 YLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEV 173
           +L EGGFA+            F+ K+D+      K  +   + ++ ++ E    K+ SE+
Sbjct: 95  FLGEGGFARC-----------FQMKDDKG-----KVFAAKTVAKLSIKSEKTRRKLLSEI 138

Query: 174 EVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKL 233
           ++ K ++  PNIVQ+ D                  V +L+E+CPN S+++ + QR    L
Sbjct: 139 QIHKSMK-HPNIVQFTDC-----------FEDDTNVYILLEICPNGSVMELLRQR--KHL 184

Query: 234 TEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFT 293
           TE E+   M  I  A+  MH   V  IHRD+K+ N+  D   N K+ DFG          
Sbjct: 185 TEPEVRFCMIQIIGAIRYMHSRRV--IHRDLKLGNIFFDKEYNLKIGDFGLA-------- 234

Query: 294 SFQDIAMLSQD----LYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTP 349
                A+L+ D      +  TP Y +PE++   K+   + + DIW++GV LY LLF   P
Sbjct: 235 -----AVLANDKERKYTICGTPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPP 288

Query: 350 FERTGQFAMLHSK-----FEFPPNS-YSSKLINLIIVMLAENPSLRPNIYQV 395
           F+   +   ++ +     F FP +   SS   NLI  +L  NP+ RP++Y++
Sbjct: 289 FQ-AKEVETIYERIKCRDFIFPADKPVSSDAKNLISHLLQLNPAARPSLYEI 339

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 99.8 bits (247), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 98/319 (30%), Positives = 151/319 (47%), Gaps = 56/319 (17%)

Query: 114 YLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEV 173
           +L EGGFA+            F+ K+D       K  + A +K      E    K+ SE+
Sbjct: 87  FLGEGGFARC-----------FQIKDDSGEIFAAKTVAKASIK-----SEKTRKKLLSEI 130

Query: 174 EVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKL 233
           ++ K +   PNIVQ+ D       D S        V +L+E+CPN SL++ + +R    L
Sbjct: 131 QIHKSM-SHPNIVQFIDC----FEDDSN-------VYILLEICPNGSLMELLKRRKV--L 176

Query: 234 TEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFT 293
           TE E+      I  A+  MH   V  IHRD+K+ N+  D+N N K+ DFG  +       
Sbjct: 177 TEPEVRFFTTQICGAIKYMHSRRV--IHRDLKLGNIFFDSNYNLKIGDFGLAAV------ 228

Query: 294 SFQDIAMLSQDLY-MHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFE- 351
               +A  S+  Y +  TP Y +PE++ + K+   + + DIW+LGV LY LL    PF+ 
Sbjct: 229 ----LANESERKYTICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQA 283

Query: 352 ---RTGQFAMLHSKFEFP---PNSYSSKLINLIIVMLAENPSLRPNIYQVLYYLSEVTNR 405
               T    +    F FP   P S   K+  LI  +L+ +P  RP++ +++ Y+      
Sbjct: 284 RDVNTIYERIKCRDFSFPRDKPISDEGKI--LIRDILSLDPIERPSLTEIMDYVW--FRG 339

Query: 406 EVPPTVLSDKYGQGPYNFE 424
             PP++ S    + P NFE
Sbjct: 340 TFPPSIPSTVMSEAP-NFE 357

>Sklu_2419.9 YMR001C, Contig c2419 14049-16136
          Length = 695

 Score = 99.8 bits (247), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 84/300 (28%), Positives = 146/300 (48%), Gaps = 65/300 (21%)

Query: 114 YLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEV 173
           +L EGGFA+            F+ K+D       K  +   + ++ ++ E    K+ SE+
Sbjct: 82  FLGEGGFARC-----------FQMKDDSG-----KIFAAKTVAKISIKSEKTRKKLLSEI 125

Query: 174 EVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE----VLLLMELCPNKSLLDYMNQRL 229
           ++ K ++  PNIVQ+ D                FE    V +L+E+CPN SL+D + +R 
Sbjct: 126 QIHKSMK-HPNIVQFIDC---------------FEDDTNVYILLEICPNGSLMDLLKKRK 169

Query: 230 ATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCF 289
              LTE E+      I  A+  MH   V  IHRD+K+ N+  D+N N K+ DFG      
Sbjct: 170 V--LTEPEVRYFTTQIVGAIKYMHNRRV--IHRDLKLGNIFFDSNYNLKIGDFGLA---- 221

Query: 290 PAFTSFQDIAMLSQD----LYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLF 345
                    A+L+ D      +  TP Y +PE++   K+   + + DIW++GV +Y LL 
Sbjct: 222 ---------AVLANDRERKYTVCGTPNYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLI 271

Query: 346 FTTPFERTGQFAMLHSKFE-----FPPNSYSSKLINLIIV-MLAENPSLRPNIYQVLYYL 399
              PF+   +  +++ + +     FP    +SK + ++I  +L+ +P  RP++ +++ Y+
Sbjct: 272 GKPPFQ-AKEVNIIYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 99.0 bits (245), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 83/296 (28%), Positives = 142/296 (47%), Gaps = 57/296 (19%)

Query: 114 YLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEV 173
           +L EGGFA+            F+ K+D       K  +   + ++ ++ E    K+ SE+
Sbjct: 78  FLGEGGFARC-----------FQMKDDSG-----KVFAAKTVAKISIKSEKTRKKLLSEI 121

Query: 174 EVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKL 233
           ++ K ++  PNIVQ+ D                  V +L+E+CPN SL+D + QR   +L
Sbjct: 122 QIHKSMK-HPNIVQFTDC-----------FEDDTNVYILLEICPNGSLMDLLKQR--KQL 167

Query: 234 TEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFT 293
           TE E+      I  A+  MH   +  IHRD+K+ N+  D + N K+ DFG          
Sbjct: 168 TEPEVRFFTTQIVGAIKYMHSRRI--IHRDLKLGNIFFDKHFNLKIGDFGLA-------- 217

Query: 294 SFQDIAMLSQD----LYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTP 349
                A+L+ D      +  TP Y +PE++   K+   + + DIW++GV +Y LL    P
Sbjct: 218 -----AVLANDRERKYTICGTPNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPP 271

Query: 350 FERTGQFAMLHSK-----FEFPPNS-YSSKLINLIIVMLAENPSLRPNIYQVLYYL 399
           F+   +   ++ +     F FP +   SS+   LI  +L+ +P  RP++ +++ Y+
Sbjct: 272 FQ-AKEVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 95.5 bits (236), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 84/300 (28%), Positives = 141/300 (47%), Gaps = 65/300 (21%)

Query: 114 YLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEV 173
           +L EGGFA+ + +K            D+S     K  +   + ++ ++ E    K+ SE+
Sbjct: 86  FLGEGGFARCFQIK------------DDSG----KIFAAKTVAKISIKSEKTRKKLLSEI 129

Query: 174 EVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKL 233
           ++ K +    NIVQ+ D        +  N+     V +L+E+CPN SL++ + +R    +
Sbjct: 130 QIHKSMSHT-NIVQFIDC-------FEDNVN----VYILLEICPNGSLMELIKKR--KTI 175

Query: 234 TEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFT 293
           TE E+   M  I   +  MH   V  IHRD+K+ N+  D + N K+ DFG          
Sbjct: 176 TEPEVRFFMTQICGGIQYMHSNRV--IHRDLKLGNIFFDEHYNLKIGDFGLA-------- 225

Query: 294 SFQDIAMLSQD----LYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTP 349
                A+L+ D      +  TP Y +PE++ + K+   + + DIW++GV LY LL    P
Sbjct: 226 -----AVLANDRERKFTICGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPP 279

Query: 350 F---------ERTGQFAMLHSKFEFPPNSYSSKLINLII-VMLAENPSLRPNIYQVLYYL 399
           F         ER  Q       F +P +   S+    +I  +L+ NP  RP+I +++ Y+
Sbjct: 280 FQAKDVNTIYERIKQ-----RNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>Scas_700.28
          Length = 896

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 104/209 (49%), Gaps = 31/209 (14%)

Query: 203 ITQGFEVLLL-------MELCPNKSLLDYM--NQRLATKLTEQEIFKIMYDITLAVAQMH 253
           IT+ +EV++        +E CP K L D +    R+ T     E  ++   I   V   H
Sbjct: 91  ITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPT----DECVQLFAQIVGGVHYAH 146

Query: 254 YLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQY 313
            L    +HRD+K+EN+L+D + + KL DFG T  C    T+ + I           T  Y
Sbjct: 147 SLNC--VHRDLKLENILLDKSGDAKLTDFGFTRECMTK-TTLETIC---------GTTVY 194

Query: 314 RSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF----ERTGQFAMLHSKFEFPPNS 369
            +PE+I+   Y     K DIW+LGV LY ++  + PF    E   ++ ++H   +   N 
Sbjct: 195 MAPELIERKSYDGF--KIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENI 252

Query: 370 YSSKLINLIIVMLAENPSLRPNIYQVLYY 398
            ++   +LI+ +LA+NP+ RP + Q+L +
Sbjct: 253 VTADAKDLILRLLAKNPNDRPTVEQILKH 281

>Kwal_56.22476
          Length = 697

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 84/300 (28%), Positives = 143/300 (47%), Gaps = 65/300 (21%)

Query: 114 YLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEV 173
           +L EGGFA+            F+ K+D       K  +   + ++ ++ E    K+ SE+
Sbjct: 84  FLGEGGFARC-----------FQIKDDGG-----KIFAAKTVAKISIKSEKTRKKLLSEI 127

Query: 174 EVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE----VLLLMELCPNKSLLDYMNQRL 229
           ++ K ++   NIVQ+ D                FE    V +L+E+CPN SL+D + +R 
Sbjct: 128 QIHKSMRHT-NIVQFVDC---------------FEDDTNVYILLEICPNGSLMDLLKRR- 170

Query: 230 ATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCF 289
              LTE E+      I  AV  MH   V  IHRD+K+ N+  D + N K+ DFG      
Sbjct: 171 -KMLTEPEVRFFTTQIVGAVKYMHSRRV--IHRDLKLGNIFFDKHYNLKVGDFGLA---- 223

Query: 290 PAFTSFQDIAMLSQD----LYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLF 345
                    A+L+ D      +  TP Y +PE++   K+   + + DIW+ GV +Y LL 
Sbjct: 224 ---------AVLANDRERKYTVCGTPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLI 273

Query: 346 FTTPFERTGQFAMLHSK-----FEFPPNSYSS-KLINLIIVMLAENPSLRPNIYQVLYYL 399
              PF+   +  +++ +     F FP + + S + + LI  +L+ +P  RP++ +++ Y+
Sbjct: 274 GKPPFQ-AKEVNIIYERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine
           protein kinase with unknown role [2706 bp, 901 aa]
          Length = 901

 Score = 93.2 bits (230), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 104/208 (50%), Gaps = 29/208 (13%)

Query: 203 ITQGFEVL-------LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYL 255
           IT+ +EV+       + +E CP K L D++      +++  E  ++   I+ AV   H +
Sbjct: 94  ITKLYEVIVTESKVWMALEYCPGKELYDHLLS--LRRISLLECGELFAQISGAVYYAHSM 151

Query: 256 PVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRS 315
               +HRD+K+EN+L+D N N KL DFG T  C    T+ + +           T  Y +
Sbjct: 152 HC--VHRDLKLENILLDKNGNAKLTDFGFTRECMTK-TTLETVC---------GTTVYMA 199

Query: 316 PEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLI 375
           PE+I+   Y     K DIW+LGV LY L+    PF+   + A    K       Y +K+I
Sbjct: 200 PELIERRTYDGF--KIDIWSLGVILYTLITGYLPFDDDDE-AKTKWKIVNEEPKYDAKVI 256

Query: 376 -----NLIIVMLAENPSLRPNIYQVLYY 398
                +LI  +LA+NP  RP++ QVL +
Sbjct: 257 PDDARDLISRLLAKNPGERPSLSQVLRH 284

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 93.2 bits (230), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 138/313 (44%), Gaps = 66/313 (21%)

Query: 95  KFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQP--LKPGS- 151
           +F + ++V +G++++  V  + EG F ++Y+             N    +Q   LK G+ 
Sbjct: 25  QFSSNELVDIGNYKI--VKLIGEGSFGKVYLA------------NHRLTHQKVVLKTGNK 70

Query: 152 --PACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEV 209
             P  ++ V    +                   P+I + ++            I    +V
Sbjct: 71  NDPNVVREVFYHRQFDF----------------PHITKLYEV-----------IVTESKV 103

Query: 210 LLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENV 269
            + +E CP K L +Y+   +  +++ +E  K+   I  AV   H L    +HRD+K+EN+
Sbjct: 104 WMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQC--VHRDLKLENI 159

Query: 270 LVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINE 329
           L+D     K+ DFG T  C    T  + +           T  Y +PE+I+   Y     
Sbjct: 160 LLDKKGRAKITDFGFTREC-ATKTMLETVC---------GTTVYMAPELIERKSYDGF-- 207

Query: 330 KSDIWALGVFLYKLLFFTTPF----ERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAEN 385
           K DIW+LGV LY ++  T PF    E   ++ +++ +  +  +  S    +LI  +L ++
Sbjct: 208 KIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFYNDDVVSKDAKDLISQLLCKD 267

Query: 386 PSLRPNIYQVLYY 398
           PS RP + QVL +
Sbjct: 268 PSQRPQLSQVLAH 280

>Scas_644.15
          Length = 726

 Score = 92.4 bits (228), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 145/308 (47%), Gaps = 53/308 (17%)

Query: 114 YLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEV 173
           +L EGGFA+ + +K            DES     K  +   + ++ ++ E    K+ SE+
Sbjct: 97  FLGEGGFARCFQIK------------DESG----KIFAAKTVAKISIKTEKTKKKLLSEI 140

Query: 174 EVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKL 233
           ++ K ++  PNIV + D                  V +L+E+C N SL+D M +R    L
Sbjct: 141 QIHKSMK-HPNIVHFVDC-----------FEDDTNVYILLEICSNGSLMDLMKKR--KTL 186

Query: 234 TEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFT 293
           TE E+      I  AV  MH   V  IHRD+K+ N+  D + N K+ DFG  +       
Sbjct: 187 TEPEVRFFTTQICGAVKYMHSRRV--IHRDLKLGNIFFDKDYNLKVGDFGLAAV------ 238

Query: 294 SFQDIAMLSQDLY-MHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFER 352
               +A   +  Y +  TP Y +PE++ + K+   + + DIW++GV +Y LL    PF+ 
Sbjct: 239 ----LANNRERKYTVCGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQA 293

Query: 353 TGQFAMLH----SKFEFPPNSY-SSKLINLIIVMLAENPSLRPNIYQVLYYLSEVTNREV 407
                +       ++ +P + Y SS+   LI  +L  +P  RP+I ++   + +V  R +
Sbjct: 294 KDVNVIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREI---IDDVWFRGI 350

Query: 408 -PPTVLSD 414
            PP +  D
Sbjct: 351 FPPKITED 358

>Kwal_55.21545
          Length = 865

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 129/293 (44%), Gaps = 48/293 (16%)

Query: 153 ACLKRVL----VQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208
            C  +VL      DEV    ++ E++ +  L+  PNI  Y+           G+     +
Sbjct: 44  VCAIKVLNLDSADDEV--EDVQKEIQFLSSLKQVPNITHYY-----------GSYLNDTK 90

Query: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268
           + ++ME C   SL   +      K+ EQ I  IM ++  A+  +H   V  IHRDIK  N
Sbjct: 91  LWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELLTALMHIHKDGV--IHRDIKAAN 145

Query: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLY----MHTTPQYRSPEMIDLFKY 324
           VL+  + + KLCDFG               A LSQ       M  TP + +PE+I   + 
Sbjct: 146 VLITNDGHIKLCDFGVA-------------AQLSQTKIRRQTMAGTPYWMAPEVI--MEG 190

Query: 325 IPINEKSDIWALGVFLYKLLFFTTPF-ERTGQFAMLHSKFEFPP----NSYSSKLINLII 379
           +  + K DIW+LG+  Y++     P+ E     AM       PP      +SS L  +I 
Sbjct: 191 VYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIA 250

Query: 380 VMLAENPSLRPNIYQVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKE 432
           + L E+P  RP+   +L       ++ VP ++L +   +  Y   +  R Q+E
Sbjct: 251 LCLDEDPKERPSAEDLLKTKFIKLHKNVPVSILKELISR--YLLHRDKRSQRE 301

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 92/200 (46%), Gaps = 20/200 (10%)

Query: 203 ITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHR 262
           I    +V + +E CP K L D++  +  ++L   E  ++   IT AV   H L    +HR
Sbjct: 102 IVTETKVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLNC--VHR 157

Query: 263 DIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLF 322
           D+K+ENVL+D N N KL DFG T             A+L     +  T  Y +PEMI   
Sbjct: 158 DLKLENVLLDKNGNAKLTDFGFTRESMTK-------AVLET---VCGTTVYMAPEMIQHK 207

Query: 323 KYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLI----NLI 378
            Y     K DIW+LGV LY LL    PF+               P       I    NLI
Sbjct: 208 PYDGF--KVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPEAQNLI 265

Query: 379 IVMLAENPSLRPNIYQVLYY 398
             +L+++P+ RPN   +L +
Sbjct: 266 EQLLSKDPTERPNTSAILLH 285

>Kwal_26.8751
          Length = 848

 Score = 89.4 bits (220), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 114/229 (49%), Gaps = 34/229 (14%)

Query: 183 PNIVQYFDSNASRLRDYSGNITQGFEVL-------LLMELCPNKSLLDYMNQRLATK-LT 234
           PN+V+  +    R  DYS +IT+ +EV+       + +E CP K L +Y+   LA K + 
Sbjct: 73  PNVVR--EVFYHRQFDYS-HITKLYEVIVTENYVWMALEYCPGKELYEYL---LAKKHIP 126

Query: 235 EQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTS 294
            +E  ++   I  AV   H +    +HRD+K+EN+L+D   + KL DFG T  C      
Sbjct: 127 LEECSELFSQIVGAVYYAHSMKC--VHRDLKLENILLDKKGHAKLTDFGFTRECATK--- 181

Query: 295 FQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTG 354
                +L     +  T  Y +PE+I+   Y     K D W+LG+ LY ++  T PF+   
Sbjct: 182 ----GILET---ICGTTVYMAPELIERKPY--EGYKIDTWSLGIILYTMIHGTMPFDEVD 232

Query: 355 QFAMLHSKFEFPPNSYSSKLIN-----LIIVMLAENPSLRPNIYQVLYY 398
           +    +    + P +Y +  I+     LI  +L ++P+ RP++ QVL +
Sbjct: 233 EVKTKYKIVHYNP-TYDNDYIDSNGKELISQLLEKDPNQRPSLTQVLQH 280

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 89.0 bits (219), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 106/207 (51%), Gaps = 27/207 (13%)

Query: 203 ITQGFEVL-------LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYL 255
           IT+ +EV+       +++E C    L +++ +    +L+ +E  K+   I  AV   H L
Sbjct: 90  ITKLYEVIVTESRVWMVLEYCSGHELYEHLLKE--QRLSLEESKKLFSQIASAVYYAHEL 147

Query: 256 PVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRS 315
               +HRD+K+ENVL+D N + KL DFG T          +++A  SQ   +  T  Y +
Sbjct: 148 KC--VHRDLKLENVLLDGNGHAKLTDFGFT----------REMATRSQLETICGTTVYMA 195

Query: 316 PEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFER----TGQFAMLHSKFEFPPNSYS 371
           PE+I+   Y     K DIW+LG+ LY ++    PF+       +  +++ + +F     S
Sbjct: 196 PELIERKCYDGF--KVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWIS 253

Query: 372 SKLINLIIVMLAENPSLRPNIYQVLYY 398
              I+LI  ML +NP+ R ++ QVL +
Sbjct: 254 DDAIDLIQGMLRKNPNERISLAQVLSH 280

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 98/206 (47%), Gaps = 29/206 (14%)

Query: 203 ITQGFEVL-------LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYL 255
           IT+ +EV+       + +E CP   L DY+   L  ++   E  ++   I  AV   H L
Sbjct: 90  ITKLYEVIVTETRVWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSL 147

Query: 256 PVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRS 315
               +HRD+K+EN+L+D N    L DFG T  C          A  +Q   +  T  Y +
Sbjct: 148 QC--VHRDLKLENILLDKNGYAMLTDFGFTREC----------ATKTQLETVCGTTVYMA 195

Query: 316 PEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFE-----RTGQFAMLHSKFEFPPNSY 370
           PE+I    Y     K D W+LG+ LY +L    PF+     RTG   ++H +        
Sbjct: 196 PELIKREAY--DGYKVDTWSLGIILYTMLHGYMPFDEDDTVRTG-LKIMHEEPAVLDEYT 252

Query: 371 SSKLINLIIVMLAENPSLRPNIYQVL 396
           S +  +LI+ +L +N + RPN+ +VL
Sbjct: 253 SPQAKDLIVRLLDKNAAQRPNLNEVL 278

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 87.0 bits (214), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 108/240 (45%), Gaps = 42/240 (17%)

Query: 160 VQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNK 219
            +DEV    +R E++ +  L+  PNI  Y+    S L D         ++ ++ME C   
Sbjct: 52  TEDEV--EDIRKEIQFLSSLKQTPNITHYY---GSYLIDT--------KLWVIMEYCAGG 98

Query: 220 SLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKL 279
           SL   +   +   + E+ I  IM +I +A+  +H   V  IHRDIK  N+L+  N + KL
Sbjct: 99  SLRTLLRPGI---IEEKYIGVIMREILVALISIHRDNV--IHRDIKAANILIANNGSVKL 153

Query: 280 CDFGSTSTCFPAFTSFQDIAMLSQDLY----MHTTPQYRSPEMIDLFKYIPINEKSDIWA 335
           CDFG               A LSQ +     M  TP + +PE+I   + +  + K DIW+
Sbjct: 154 CDFGVA-------------AQLSQSMLKRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWS 198

Query: 336 LGVFLYKLLFFTTPFERTGQF-AMLHSKFEFPP----NSYSSKLINLIIVMLAENPSLRP 390
           LG+  Y++     P+       AM       PP      YS  L   I + L E+P  RP
Sbjct: 199 LGITAYEIATGNPPYCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 85.9 bits (211), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 118/259 (45%), Gaps = 34/259 (13%)

Query: 161 QDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKS 220
           +DEV    ++ E++ +  L+  PNI +Y+           G+  +G  + ++ME C   S
Sbjct: 53  EDEV--EDVQREIQFLASLKQIPNITRYY-----------GSYLRGTSLWIIMEYCAGGS 99

Query: 221 LLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLC 280
           L   +      K+ E+ I  IM ++ +A+  +H   V  IHRDIK  NVL+      KLC
Sbjct: 100 LRSLLR---PGKIDEKYIGVIMRELLVALKVIHKDNV--IHRDIKAANVLITNEGQVKLC 154

Query: 281 DFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFL 340
           DFG  +            ++  Q   M  TP + +PE+I   + +  + K DIW+LG+  
Sbjct: 155 DFGVAA-------QLNQTSLRRQT--MAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITA 203

Query: 341 YKLLFFTTPFE-----RTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQV 395
           Y++     P+      R  Q  +          +Y+ +L   I + L E+P  R +  ++
Sbjct: 204 YEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDEDPQERLSAEEL 263

Query: 396 LYYLSEVTNREVPPTVLSD 414
           L      T++  P T+L +
Sbjct: 264 LKTKFIKTHKATPTTILKE 282

>Sklu_2419.10 , Contig c2419 14439-16135
          Length = 566

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 115/231 (49%), Gaps = 48/231 (20%)

Query: 183 PNIVQYFDSNASRLRDYSGNITQGFE----VLLLMELCPNKSLLDYMNQRLATKLTEQEI 238
           PNIVQ+ D                FE    V +L+E+CPN SL+D + +R    LTE E+
Sbjct: 4   PNIVQFIDC---------------FEDDTNVYILLEICPNGSLMDLLKKRKV--LTEPEV 46

Query: 239 FKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDI 298
                 I  A+  MH   V  IHRD+K+ N+  D+N N K+ DFG               
Sbjct: 47  RYFTTQIVGAIKYMHNRRV--IHRDLKLGNIFFDSNYNLKIGDFGLA------------- 91

Query: 299 AMLSQD----LYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTG 354
           A+L+ D      +  TP Y +PE++   K+   + + DIW++GV +Y LL    PF+   
Sbjct: 92  AVLANDRERKYTVCGTPNYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-AK 149

Query: 355 QFAMLHSKFE-----FPPNSYSSKLINLIIV-MLAENPSLRPNIYQVLYYL 399
           +  +++ + +     FP    +SK + ++I  +L+ +P  RP++ +++ Y+
Sbjct: 150 EVNIIYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 200

>Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement
          Length = 364

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 79/150 (52%), Gaps = 8/150 (5%)

Query: 261 HRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMID 320
           H+DIK  N++  ++    +CD GS S      +S   +    +    H T  +RSPE+++
Sbjct: 212 HKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLVEFQEWCNEHCTLPFRSPELLN 271

Query: 321 LFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQ-------FAMLHSKFEFPPNS-YSS 372
           +     I+EK DIW+LG  LY + F  +PFER  Q       +A+   KF  PPN+ YS 
Sbjct: 272 VTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGASMTYAIATGKFSIPPNTNYSP 331

Query: 373 KLINLIIVMLAENPSLRPNIYQVLYYLSEV 402
           +LI +I   +  +   RP+I ++L  L ++
Sbjct: 332 ELIKIIKDCIEVDSKKRPSIDELLARLQDL 361

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 67/161 (41%), Gaps = 39/161 (24%)

Query: 102 VTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERK-------NDESMNQPLKPGSPAC 154
           V +      +   L EGGF+ +Y+V+  E  + F  K       N ES+++ ++      
Sbjct: 21  VLINGQHYAIQRLLGEGGFSFVYLVQSRENNDLFALKKIHCPFGNIESVSEAMR------ 74

Query: 155 LKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLME 214
                            EV   KK + +P I     S    L++  G+ T    V +L+ 
Sbjct: 75  -----------------EVNSYKKFR-SPYITHCVSSQV--LQEQDGSKT----VFILLP 110

Query: 215 LCPNKSLLDYMNQRL--ATKLTEQEIFKIMYDITLAVAQMH 253
             P  SLLD +N  L   T ++E+EI +I+  +   +  MH
Sbjct: 111 YFPTGSLLDKINTHLLDGTTISEEEIVRILVSVARGLRTMH 151

>Scas_580.6
          Length = 1015

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 70/236 (29%), Positives = 109/236 (46%), Gaps = 32/236 (13%)

Query: 159 LVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPN 218
           L  DE  +  ++ EV+ +  L+  PNI +Y+    S L+D S        + ++ME C  
Sbjct: 70  LDSDEDEVEDVQREVQFLSSLKQIPNITRYY---GSYLKDTS--------LWIIMEYCAG 118

Query: 219 KSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFK 278
            SL   +      K+ E+ I  IM ++ +A+  +H   V  IHRDIK  NVL+    + K
Sbjct: 119 GSLRSLLR---PGKIDEKYIGVIMRELLVALKYIHKDNV--IHRDIKAANVLITNEGSVK 173

Query: 279 LCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGV 338
           LCDFG  +    +    Q +A          TP + +PE+I   + +  + K DIW+LG+
Sbjct: 174 LCDFGVAAQLNQSTLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGI 222

Query: 339 FLYKLLFFTTPF-ERTGQFAMLHSKFEFPP----NSYSSKLINLIIVMLAENPSLR 389
             Y++     P+ E     AM       PP     SY+  L   I + L E+P  R
Sbjct: 223 TAYEIATGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 109/241 (45%), Gaps = 34/241 (14%)

Query: 161 QDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKS 220
           +DEV    ++ E++ +  L+  PNI +Y+           G+     ++ ++ME C   S
Sbjct: 62  EDEV--EDVQKEIQFLASLKQVPNITRYY-----------GSYLYDTKLWVIMEYCAGGS 108

Query: 221 LLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLC 280
           L   +      K+ E+ +  I+  + +A+  +H   V  IHRDIK  NVL+    + KLC
Sbjct: 109 LRTLLR---PGKIDEKYLGVIVRKLLIALVYIHKDNV--IHRDIKAANVLITNEGHVKLC 163

Query: 281 DFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFL 340
           DFG  +    A    Q +A          TP + +PE+I   + +  N K+DIW+LG+  
Sbjct: 164 DFGVAAQLTAANHKRQTMA---------GTPYWMAPEVI--MEGVYYNTKADIWSLGITA 212

Query: 341 YKLLFFTTPFERTGQF-AMLHSKFEFPP----NSYSSKLINLIIVMLAENPSLRPNIYQV 395
           Y++     P+       AM       PP     +YS  L   I + L E+P  RP    +
Sbjct: 213 YEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEERPTAEDL 272

Query: 396 L 396
           L
Sbjct: 273 L 273

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 105/245 (42%), Gaps = 50/245 (20%)

Query: 110 EVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLN-- 167
           E+   L +G F ++Y V+ +E                   G    LK +  +D +  N  
Sbjct: 110 EIGKVLGKGKFGRVYCVRHIE------------------SGFVCALKAMEKKDIIQYNIE 151

Query: 168 -KMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMN 226
            + R EVE+   L+  PN+ Q +           G       V LLME   N  L  ++ 
Sbjct: 152 KQFRREVEIQSSLR-HPNLTQLY-----------GYFHDEKRVYLLMEYLVNGELYKHLK 199

Query: 227 QRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTS 286
            R  +   +      +Y +  A+  MH   +  +HRDIK EN+++  NN  KL DFG  S
Sbjct: 200 GR--SHFNDVVASYYVYQMADALDYMHERNI--LHRDIKPENIIIGFNNTIKLTDFG-WS 254

Query: 287 TCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFF 346
              P  +  + +           T  Y SPE+I   +Y   NEK D+WALGV  Y+LL  
Sbjct: 255 VITPKGSKRKTLC---------GTVDYLSPELIRSREY---NEKVDVWALGVLTYELLVG 302

Query: 347 TTPFE 351
           + PFE
Sbjct: 303 SPPFE 307

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 105/233 (45%), Gaps = 34/233 (14%)

Query: 162 DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSL 221
           DEV    ++ E++ +  L+   NI +Y+    S L+D S        + ++ME C   SL
Sbjct: 61  DEV--EDVQREIQFLASLKQISNITRYY---GSYLKDTS--------LWIIMEHCAGGSL 107

Query: 222 LDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCD 281
              +      K+ E+ I  IM ++ +A+  +H   V  IHRDIK  NVL+    N KLCD
Sbjct: 108 RSLLR---PGKIDEKYIGVIMRELLVALKCIHKDNV--IHRDIKAANVLITNEGNVKLCD 162

Query: 282 FGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLY 341
           FG  +         Q +A          TP + +PE+I   + +  + K DIW+LG+  Y
Sbjct: 163 FGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTY 211

Query: 342 KLLFFTTPFE-----RTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLR 389
           ++     P+      R  Q  +          SYS+ L   I + L E+P  R
Sbjct: 212 EIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKER 264

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 107/234 (45%), Gaps = 40/234 (17%)

Query: 175 VMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLT 234
           ++ KL   PN+++ FD        +  N     ++ L++E      L + + +R    L 
Sbjct: 81  IIMKLLNHPNVLRLFDV-------WETN----SDLYLVLEYAEKGELFNMLVER--GPLP 127

Query: 235 EQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTS 294
           E E  +    I + ++  H L V  +HRD+K EN+L+D   N K+ DFG           
Sbjct: 128 ENEAVRAFRQIIIGISYCHSLGV--VHRDLKPENLLLDNKLNIKIADFGMA--------- 176

Query: 295 FQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFE 351
               A+ S+D  + T   +P Y +PE+I    Y   +  SD+W+ GV L+ LL    PF+
Sbjct: 177 ----ALESEDKLLETSCGSPHYAAPEIISGLPYEGFS--SDVWSCGVILFALLTGRLPFD 230

Query: 352 ------RTGQFAMLHSKFEFPPNSYSSKLI-NLIIVMLAENPSLRPNIYQVLYY 398
                 R     +   +FE P +   +K   +L+  +L  +PS R  I ++L +
Sbjct: 231 EEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284

>Kwal_56.24274
          Length = 346

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 77/155 (49%), Gaps = 8/155 (5%)

Query: 261 HRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMID 320
           HRD+K  N+++   +   + D GS S       S Q +    +    + T  Y +PE++D
Sbjct: 191 HRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCTLSYAAPEILD 250

Query: 321 LFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQ-------FAMLHSKFEFP-PNSYSS 372
           +     I EK DIW+ G  +Y + F  +PFER  Q       +A+   K+  P   SYSS
Sbjct: 251 VKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRGTSYSS 310

Query: 373 KLINLIIVMLAENPSLRPNIYQVLYYLSEVTNREV 407
            LI LI   L+ NP  RP++ +++  L E+  + V
Sbjct: 311 SLIELIGKCLSVNPEQRPSVNELIALLMELQGQCV 345

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 105/234 (44%), Gaps = 40/234 (17%)

Query: 175 VMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLT 234
           ++ KL   PN+++ +D   +             ++ +++E      L + + +R    L 
Sbjct: 78  IIMKLLNHPNVLRLYDVWET-----------SKDLYMVLEYVEKGELFNLLVER--GPLP 124

Query: 235 EQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTS 294
           E E  +    I + ++  H L +  +HRD+K EN+L+D   N KL DFG           
Sbjct: 125 ENEAVRFFRQIIIGISYCHALGI--VHRDLKPENLLLDHKFNVKLADFGMA--------- 173

Query: 295 FQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFE 351
               A+ S+D  + T   +P Y +PE++    Y     +SD+W+ GV LY LL    PF+
Sbjct: 174 ----ALESKDKLLETSCGSPHYAAPEIVSGLPYHGF--ESDVWSCGVILYALLTGRLPFD 227

Query: 352 ------RTGQFAMLHSKFEFP-PNSYSSKLINLIIVMLAENPSLRPNIYQVLYY 398
                 R     +   KFE P  +  SS+  +LI  +L  +P  R    ++L +
Sbjct: 228 EEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKH 281

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 104/234 (44%), Gaps = 40/234 (17%)

Query: 175 VMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLT 234
           ++ KL   PN+++ +D   +             ++ +++E      L + + QR    L 
Sbjct: 80  IIMKLLNHPNVLRLYDVWET-----------AQDLYMVLEYVEKGELFNLLVQR--GPLP 126

Query: 235 EQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTS 294
           E E  +    I + ++  H L +  +HRD+K EN+L+D   N KL DFG           
Sbjct: 127 ENEAVRFFRQIIIGISYCHALGI--VHRDLKPENLLLDHKFNIKLADFGMA--------- 175

Query: 295 FQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFE 351
               A+ S+D  + T   +P Y +PE++    Y     +SD+W+ GV LY LL    PF+
Sbjct: 176 ----ALESKDKLLETSCGSPHYAAPEIVSGLPYHGF--ESDVWSCGVILYALLTGRLPFD 229

Query: 352 ------RTGQFAMLHSKFEFP-PNSYSSKLINLIIVMLAENPSLRPNIYQVLYY 398
                 R     +   K+E P  +  S +  +LI+ +L   P  R    ++L +
Sbjct: 230 EEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283

>Scas_693.17
          Length = 1049

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 95/203 (46%), Gaps = 21/203 (10%)

Query: 211 LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVL 270
           +L E      LLDY+ Q  + K +    F     I  A+  +H   +  +HRD+KIEN++
Sbjct: 177 MLFEYVSGGQLLDYIIQHGSLKESRARTF--TRQICSALKYLHSHNI--VHRDLKIENIM 232

Query: 271 VDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEK 330
           +  + N KL DFG ++     +     +      LY      + +PE++    Y  I  +
Sbjct: 233 ISKDGNIKLIDFGLSN----LYDKCNKLKTYCGSLY------FAAPELLKATPY--IGPE 280

Query: 331 SDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFE----FPPNSYSSKLINLIIVMLAENP 386
            D+W+ GV LY L+    PF+      +LH K +    F P   S ++I+L+  ML  +P
Sbjct: 281 IDVWSFGVVLYVLVCGKVPFDDENS-NVLHEKIKQGKVFYPQFLSIEVISLLSKMLVVDP 339

Query: 387 SLRPNIYQVLYYLSEVTNREVPP 409
             R  + QV+ +   V + + PP
Sbjct: 340 FKRATLDQVMNHHWMVRDCDGPP 362

>Scas_564.7
          Length = 1210

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 101/222 (45%), Gaps = 28/222 (12%)

Query: 199 YSGNITQGFEVL-------LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQ 251
           Y  +I + FE+        +L E      LLDY+ Q  +  L E    K    I  A+  
Sbjct: 244 YHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQHGS--LREHHARKFARGIASALEY 301

Query: 252 MHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTP 311
           +H   +  +HRD+KIEN+++  +   K+ DFG ++     F   + +      LY     
Sbjct: 302 IHANNI--VHRDLKIENIMISTSGEIKIIDFGLSN----VFDRKKQLHTFCGSLY----- 350

Query: 312 QYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFP----P 367
            + +PE++    Y     + D+W+ GV LY L+    PF+     ++LH K +      P
Sbjct: 351 -FAAPELLKAHPY--TGPEVDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVDYP 406

Query: 368 NSYSSKLINLIIVMLAENPSLRPNIYQVLYYLSEVTNREVPP 409
           N  S ++I+L+  ML  +P  R ++ QV+ +       + PP
Sbjct: 407 NHLSIEVISLLSKMLVVDPLRRASLKQVVEHPWMTRGYDYPP 448

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 139/300 (46%), Gaps = 55/300 (18%)

Query: 105 GSH--RVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQD 162
           G+H    ++V  L EG F +   VK   +T   ++   + +N           K+VL + 
Sbjct: 49  GAHIGNYQIVKTLGEGSFGK---VKLAYHTTTGQKVALKIIN-----------KKVLAKS 94

Query: 163 EVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLL 222
           ++   ++  E+  ++ L+  P+I++ +D   S+            E+++++E   N+ L 
Sbjct: 95  DMQ-GRIEREISYLRLLRH-PHIIKLYDVIKSK-----------DEIIMVIEYAGNE-LF 140

Query: 223 DYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDF 282
           DY+ QR   K++EQE  +    I  AV   H   +  +HRD+K EN+L+D + N K+ DF
Sbjct: 141 DYIVQR--DKMSEQEARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADF 196

Query: 283 GSTSTCFPAFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWALGVF 339
           G ++             +++   ++ T   +P Y +PE+I    Y     + D+W+ GV 
Sbjct: 197 GLSN-------------IMTDGNFLKTSCGSPNYAAPEVISGKLY--AGPEVDVWSCGVI 241

Query: 340 LYKLLFFTTPFERTG---QFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVL 396
           LY +L    PF+       F  + +     P   S     LI  ML  NP  R +I++++
Sbjct: 242 LYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIM 301

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 139/300 (46%), Gaps = 55/300 (18%)

Query: 105 GSH--RVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQD 162
           G H  + +++  L EG F +   VK   + +  ++   + +N           K+VL + 
Sbjct: 29  GQHIGKYQIIKTLGEGSFGK---VKLAYHISTGQKVALKIIN-----------KKVLAKS 74

Query: 163 EVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLL 222
           ++   ++  E+  ++ L+  P+I++ +D   S+            E+++++E   N+ L 
Sbjct: 75  DMQ-GRIEREISYLRLLR-HPHIIKLYDVIKSK-----------DEIIMVIEYAGNE-LF 120

Query: 223 DYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDF 282
           DY+ QR   K+ EQE  +    I  AV   H   +  +HRD+K EN+L+D + N K+ DF
Sbjct: 121 DYIVQR--DKMPEQEARRFFQQIISAVDYCHRHKI--VHRDLKPENLLLDEHLNVKIADF 176

Query: 283 GSTSTCFPAFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWALGVF 339
           G ++             +++   ++ T   +P Y +PE+I    Y     + D+W+ GV 
Sbjct: 177 GLSN-------------IMTDGNFLKTSCGSPNYAAPEVISGKLY--AGPEVDVWSSGVI 221

Query: 340 LYKLLFFTTPFERTG---QFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVL 396
           LY +L    PF+       F  + +     PN  S    +LI  ML  NP  R  +++++
Sbjct: 222 LYVMLCRRLPFDDESIPVLFKNISNGVYTIPNFLSQGAASLIKKMLIVNPVNRITVHEIM 281

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 102/232 (43%), Gaps = 39/232 (16%)

Query: 175 VMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLT 234
           ++ KL   PNI+  ++   ++            E+ L++E      L DY+  R   KL 
Sbjct: 116 IIMKLITHPNIMALYEVWENK-----------SELYLVLEYVEGGELFDYLIAR--GKLP 162

Query: 235 EQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVD-ANNNFKLCDFGSTSTCFPAFT 293
           EQE       I   V+  H   +   HRD+K EN+L+D  N   K+ DFG          
Sbjct: 163 EQEAIHYFKQIVQGVSYCHNFNI--CHRDLKPENLLLDKKNKTVKIADFGMA-------- 212

Query: 294 SFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
                A+ + +  + T   +P Y SPE++   KY      SD+W+ G+ L+ LL    PF
Sbjct: 213 -----ALETTNRLLETSCGSPHYASPEIVMGQKY--HGSPSDVWSCGIILFALLTGHLPF 265

Query: 351 E----RTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVLYY 398
                R     + H +++ P N  S +  +LI  +L  +P  R  + ++L +
Sbjct: 266 NDDNVRKLLLKVQHGRYQMPSN-VSKEAKDLISKILVVDPEKRITVDKILEH 316

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 122/290 (42%), Gaps = 49/290 (16%)

Query: 110 EVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKM 169
           E+   L +G F ++Y VK  E                L     A  K+ +VQ  +   + 
Sbjct: 101 EIGKILGKGKFGKVYCVKHRE--------------TGLICALKAMEKKEIVQYTIQ-KQF 145

Query: 170 RSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRL 229
           R EVE+    +   N+ Q +           G       V LLME      L  ++    
Sbjct: 146 RREVEIQGSFK-HKNLTQLY-----------GFFYDEKRVYLLMEYVYYGELYKFLKNNG 193

Query: 230 ATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCF 289
               T    F  +Y +  A+  MH     ++HRDIK EN+L+  NN  KL DFG      
Sbjct: 194 PLNETLASYF--VYQMANALDYMH--SKNILHRDIKPENILIGFNNTIKLTDFG------ 243

Query: 290 PAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTP 349
             ++ + +     + L    T  Y SPE+I   +Y   N K D+WALGV  Y+LL  + P
Sbjct: 244 --WSVYNEDGQKRKTLC--GTIDYLSPELIKSREY---NNKVDVWALGVLTYELLVGSPP 296

Query: 350 FER-TGQFA---MLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQV 395
           FE  T +     +L    +FP N  S +  +LI+ +L   PS R  + +V
Sbjct: 297 FEEDTKEMTYRRILRCDLKFPLNV-SPQARDLIVRLLQFEPSKRIPLSEV 345

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 102/223 (45%), Gaps = 30/223 (13%)

Query: 199 YSGNITQGFEVL-------LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQ 251
           Y  +I + FE+        +L E      LLDY+ Q     L E+   K    I  A+  
Sbjct: 138 YHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQH--GSLRERHARKFARGIASALQY 195

Query: 252 MHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTP 311
           +H   +  +HRD+KIEN+++ ++   ++ DFG ++   P     + +      LY     
Sbjct: 196 LHLNNI--VHRDLKIENIMISSSGEIRIIDFGLSNMYDPK----KQLHTFCGSLY----- 244

Query: 312 QYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKF-----EFP 366
            + +PE++    Y     + DIW+ GV LY L+    PF+     ++LH K      E+P
Sbjct: 245 -FAAPELLKAHPY--TGPEVDIWSFGVVLYVLVCGKVPFDDENA-SVLHEKIKQGKVEYP 300

Query: 367 PNSYSSKLINLIIVMLAENPSLRPNIYQVLYYLSEVTNREVPP 409
            +  S  +I+L+  ML  +P  R  + QV+++       + PP
Sbjct: 301 QH-LSIDVISLLSKMLVVDPYKRATLKQVVHHQWMQKGYDFPP 342

>Scas_660.28
          Length = 623

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 137/300 (45%), Gaps = 55/300 (18%)

Query: 105 GSH--RVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQD 162
           GSH    ++V  L EG F +   VK   +    ++   + +N           K+VL + 
Sbjct: 40  GSHIGNYQIVKTLGEGSFGK---VKLAYHMTTGQKVALKIIN-----------KKVLAKS 85

Query: 163 EVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLL 222
           ++   ++  E+  ++ L+  P+I++ +D   S+            E++++ME   N+ L 
Sbjct: 86  DMQ-GRIEREISYLRLLR-HPHIIKLYDVIKSK-----------DEIIMVMEYAGNE-LF 131

Query: 223 DYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDF 282
           DY+ QR   K++E E  +    I  AV   H   +  +HRD+K EN+L+D + N K+ DF
Sbjct: 132 DYIVQR--DKMSEDEARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADF 187

Query: 283 GSTSTCFPAFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWALGVF 339
           G ++             +++   ++ T   +P Y +PE+I    Y     + D+W+ GV 
Sbjct: 188 GLSN-------------IMTDGNFLKTSCGSPNYAAPEVISGKLY--AGPEVDVWSCGVI 232

Query: 340 LYKLLFFTTPFERTG---QFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVL 396
           LY +L    PF+       F  +++     P   S     LI  ML  NP  R +I +++
Sbjct: 233 LYVMLCRRLPFDDESIPVLFKNINNGVYTIPKFLSQGASTLIKKMLIVNPLNRISIQEIM 292

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 72.8 bits (177), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 136/295 (46%), Gaps = 53/295 (17%)

Query: 108 RVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLN 167
           + +V+  L EG F +   VK   + +  ++   + +N           K+VL + ++   
Sbjct: 38  KYQVIKTLGEGSFGK---VKLAHHVSTGQKVALKIIN-----------KKVLAKSDMQ-G 82

Query: 168 KMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQ 227
           ++  E+  ++ L+  P+I++ +D   S+            E+++++E   N+ L DY+ Q
Sbjct: 83  RIEREISYLRLLR-HPHIIKLYDVIKSK-----------DEIIMVIEYAGNE-LFDYIVQ 129

Query: 228 RLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTST 287
           R   K++E E  +    I  AV   H   +  +HRD+K EN+L+D + N K+ DFG ++ 
Sbjct: 130 R--DKMSENEARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADFGLSN- 184

Query: 288 CFPAFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLL 344
                       +++   ++ T   +P Y +PE+I    Y     + D+W+ GV LY +L
Sbjct: 185 ------------IMTDGNFLKTSCGSPNYAAPEVISGKLY--AGPEVDVWSSGVILYVML 230

Query: 345 FFTTPFERTG---QFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVL 396
               PF+       F  + +     P   S    NLI  ML  NP  R  I++++
Sbjct: 231 CRRLPFDDESIPVLFKNISNGVYSIPKFLSQGAANLIKRMLIVNPLNRITIHEIM 285

>Kwal_47.18233
          Length = 598

 Score = 72.8 bits (177), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 147/321 (45%), Gaps = 56/321 (17%)

Query: 108 RVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLN 167
           + +++  L EG F +   VK   +    ++   + +N           K+VL + ++   
Sbjct: 30  KYQIIKTLGEGSFGK---VKLAYHVTTGQKVALKIIN-----------KKVLAKSDMQ-G 74

Query: 168 KMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQ 227
           ++  E+  ++ L+  P+I++ +D   S+            E+++++E   N+ L DY+ Q
Sbjct: 75  RIEREISYLRLLR-HPHIIKLYDVVKSK-----------DEIVMVIEYAGNE-LFDYIVQ 121

Query: 228 RLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTST 287
           R   K++E E  +    I  AV   H   +  +HRD+K EN+L+D + N K+ DFG ++ 
Sbjct: 122 R--DKMSENEARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADFGLSN- 176

Query: 288 CFPAFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLL 344
                       +++   ++ T   +P Y +PE+I    Y     + D+W+ GV LY +L
Sbjct: 177 ------------IMTDGNFLRTSCGSPNYAAPEVISGKLY--AGPEVDVWSSGVILYVML 222

Query: 345 FFTTPFERTG---QFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVL---YY 398
               PF+       F  + +     P   S    NLI  ML  NP  R  I++++   ++
Sbjct: 223 CRRLPFDDESIPVLFKNISNGIYTLPKFLSPGAANLIKRMLIVNPLNRITIHEIMQDEWF 282

Query: 399 LSEVTNREVPPTVLSDKYGQG 419
             ++ +  +PP + ++    G
Sbjct: 283 KVDMQDYLIPPDLKNEAENHG 303

>Scas_707.36
          Length = 915

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 102/226 (45%), Gaps = 43/226 (19%)

Query: 167 NKMRSEVEVMKKL--QGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDY 224
           NK++ E+ +MKK   +    +++  D  +SR            ++ L++E C    +L  
Sbjct: 142 NKIKKEIAIMKKCNNKHVVKLIEILDDLSSR------------KIYLVLEYCEKGPILWC 189

Query: 225 ------MNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFK 278
                 ++ R   +L+ Q   +I  D+ L +  +H   +  IHRDIK  N+L+D N   K
Sbjct: 190 PRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLHSQGI--IHRDIKPANLLMDKNGVVK 247

Query: 279 LCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMI--------------DLFKY 324
           + DFG +        +  D   L++ +    TP + +PE+               +LF  
Sbjct: 248 ISDFGVSLAANGNIDTNDDELELTKTV---GTPVFYAPEICLGAAAMERFNLDKDELFNG 304

Query: 325 IPINEKSDIWALGVFLYKLLF----FTTPFERTGQFAMLHSKFEFP 366
             I+ K DIWALG+ LY LLF    F + FE      +++ K  FP
Sbjct: 305 SCISFKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFP 350

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 103/234 (44%), Gaps = 40/234 (17%)

Query: 175 VMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLT 234
           ++ KL   PN+++ +D        +  N     ++ L++E      L + + +R    L 
Sbjct: 83  IIMKLLNHPNVLRLYDV-------WETNT----DLYLVLEYAEKGELFNLLVER--GPLP 129

Query: 235 EQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTS 294
           E E  +    I + V+  H L +  +HRD+K EN+L+D   N K+ DFG           
Sbjct: 130 EHEAIRFFRQIIIGVSYCHALGI--VHRDLKPENLLLDHKYNIKIADFGMA--------- 178

Query: 295 FQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFE 351
               A+ ++   + T   +P Y +PE++    Y      SD+W+ GV L+ LL    PF+
Sbjct: 179 ----ALETEGKLLETSCGSPHYAAPEIVSGIPYQGF--ASDVWSCGVILFALLTGRLPFD 232

Query: 352 ------RTGQFAMLHSKFEFPP-NSYSSKLINLIIVMLAENPSLRPNIYQVLYY 398
                 RT    +   +FE P  +  S +  +LI  +L  +P  R     +L +
Sbjct: 233 EEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 99/207 (47%), Gaps = 17/207 (8%)

Query: 196 LRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYL 255
           + +Y   + +   + ++ME C   S  D + +     L E+++  I++++TL +  +H  
Sbjct: 76  ITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLH-- 133

Query: 256 PVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRS 315
               IHRDIK  N+L++     KL DFG          S    + L +D ++  TP + +
Sbjct: 134 EQRKIHRDIKAANILLNEEGMVKLGDFG---------VSGHIRSTLKRDTFV-GTPYWMA 183

Query: 316 PEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPP----NSYS 371
           PE++   +    NEK+DIW+LG+  Y+LL    P  +     ++ +  +  P      +S
Sbjct: 184 PEVV-CCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFS 242

Query: 372 SKLINLIIVMLAENPSLRPNIYQVLYY 398
               + +   L + P+ RP+ Y +L +
Sbjct: 243 DAAKDFVAGCLVKTPADRPSAYNLLSF 269

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 127/300 (42%), Gaps = 33/300 (11%)

Query: 103 TVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQD 162
           TVG+  +  V  +      +I V+K V   ++       S+  P K  S    ++  ++ 
Sbjct: 104 TVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQHSLPSP-KNESEILERQKRLEK 162

Query: 163 EVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLL 222
           E+  +K       + ++   P+I + F+             T      +L E      LL
Sbjct: 163 EIARDKRTVREASLGQILYHPHICRLFEM-----------CTMSNHFYMLFEYVSGGQLL 211

Query: 223 DYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDF 282
           DY+ Q     L E    K    I  A+  +H   +  +HRD+KIEN+++ ++   K+ DF
Sbjct: 212 DYIIQH--GSLKEHHARKFARGIASALQYLHANNI--VHRDLKIENIMISSSGEIKIIDF 267

Query: 283 GSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYK 342
           G ++     F   + +      LY      + +PE++    Y     + DIW+ G+ LY 
Sbjct: 268 GLSNI----FDYRKQLHTFCGSLY------FAAPELLKAQPY--TGPEVDIWSFGIVLYV 315

Query: 343 LLFFTTPFERTGQFAMLHSKFEFP----PNSYSSKLINLIIVMLAENPSLRPNIYQVLYY 398
           L+    PF+     ++LH K +      P+  S ++I+L+  M+  +P  R  +  V+ +
Sbjct: 316 LVCGKVPFDDENS-SILHEKIKKGKVDYPSHLSIEVISLLTRMIVVDPLRRATLKNVVEH 374

>Sklu_2323.3 YPL209C, Contig c2323 5241-6443
          Length = 400

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 107/248 (43%), Gaps = 46/248 (18%)

Query: 168 KMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYM-- 225
           + R EVE+   L+  PN+ Q +           G       V LLME   N  L  ++  
Sbjct: 184 QFRREVEIQASLRH-PNLTQLY-----------GYFYDDKRVYLLMEYLVNGELYRHLRV 231

Query: 226 ----NQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCD 281
               N  LA+    Q     M D   A+  MH   V  +HRDIK EN+L+   N  KL D
Sbjct: 232 NGPFNDILASYYVNQ-----MAD---ALNYMHDRNV--LHRDIKPENILIGFQNTLKLTD 281

Query: 282 FGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLY 341
           FG +                ++   +  T  Y SPE++   KY   +EK D+WALGV  Y
Sbjct: 282 FGWSVISTTG----------AKRKTLCGTLDYLSPELV---KYREYDEKVDVWALGVLAY 328

Query: 342 KLLFFTTPFERTGQFA----MLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVLY 397
           +LL  T PFE   +      ++     F P+  S    +LI  +L  +PS R ++  VL 
Sbjct: 329 ELLVGTPPFEEASKELTYKRIVRRDLRF-PDQMSIDARDLIGRLLENDPSTRISLKDVLS 387

Query: 398 YLSEVTNR 405
           +   V N+
Sbjct: 388 HPWIVKNK 395

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 136/293 (46%), Gaps = 53/293 (18%)

Query: 110 EVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKM 169
           ++V  L EG F +   VK   +    ++   + +N           K+VL + ++   ++
Sbjct: 40  QIVKTLGEGSFGK---VKLAYHVTTGQKVALKIIN-----------KKVLAKSDMQ-GRI 84

Query: 170 RSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRL 229
             E+  ++ L+  P+I++ +D   S+            E+++++E   N+ L DY+ QR 
Sbjct: 85  EREISYLRLLR-HPHIIKLYDVIKSK-----------DEIIMVIEYAGNE-LFDYIVQR- 130

Query: 230 ATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCF 289
             K++EQE  +    I  AV   H   +  +HRD+K EN+L+D + N K+ DFG ++   
Sbjct: 131 -NKMSEQEARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADFGLSN--- 184

Query: 290 PAFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFF 346
                     +++   ++ T   +P Y +PE+I    Y     + D+W+ GV LY +L  
Sbjct: 185 ----------IMTDGNFLKTSCGSPNYAAPEVISGKLY--AGPEVDVWSCGVILYVMLCR 232

Query: 347 TTPFERTG---QFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVL 396
             PF+       F  + +     P   S    +LI  ML  NP  R +I++++
Sbjct: 233 RLPFDDESIPVLFKNISNGVYTLPKFLSPGASDLIKRMLIVNPLNRISIHEIM 285

>YPL236C (YPL236C) [5213] chr16 complement(101608..102702)
           Serine/threonine protein kinase of unknown function
           [1095 bp, 364 aa]
          Length = 364

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 139/344 (40%), Gaps = 69/344 (20%)

Query: 102 VTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQ 161
           + V   R  +   L EGG + +Y+V+          KN   ++  +       LK+++  
Sbjct: 23  IRVNDKRYRIQRLLGEGGMSFVYLVQL--------SKNSLIIDNGIATPELYALKKIICP 74

Query: 162 DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSL 221
               ++    E+E  K+ Q +P +++  DS   + +D S  I   + VL    L    SL
Sbjct: 75  SVESISNGMREIENYKRFQ-SPYVIKSIDSQVMQEKDGSKTI---YIVLPYYSL---GSL 127

Query: 222 LDYMNQRL--ATKLTEQEIFKIMYDITLAVAQMH-------------------------- 253
            D +N+RL   T ++E E  +IM  +T  +  +H                          
Sbjct: 128 QDSINRRLLEGTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDET 187

Query: 254 ------------------YLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSF 295
                                +   HRDI   N+L  ++    + D GS S       + 
Sbjct: 188 AMLLEDTPLEMDMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENR 247

Query: 296 QDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQ 355
             ++ L + +  + T  Y  PE+++L     ++ K DIW+LG   Y L+F  +PFER  Q
Sbjct: 248 HQLSELQEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQ 307

Query: 356 -------FAMLHSKFEFPPNS-YSSKLINLIIVMLAENPSLRPN 391
                  +A+   K+ FP NS +S  L+++I   +  +P  RP 
Sbjct: 308 IHGASLTYAINTGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRPT 351

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 106/233 (45%), Gaps = 31/233 (13%)

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLAT 231
           E   ++KL  +P++V+ F    S  +D S        +  L+E  PN   L  M +  + 
Sbjct: 227 EKTALQKLNNSPSVVRLF----STFQDESS-------LYFLLEYAPNGDFLSLMKKYGSL 275

Query: 232 KLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPA 291
             T    +     I  A+  +H     +IHRDIK EN+L+D     KL DFG+     P 
Sbjct: 276 DETCARYYAAQ--IIDAIDYLH--SNGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNPT 331

Query: 292 FTSFQ----DIAMLSQDLYMHTTPQYRSPEMI-DLFKYIPINEKSDIWALGVFLYKLLFF 346
             S      D++  S+      T +Y SPE++ D F     + + DIWA G  L++++  
Sbjct: 332 NNSVSKPEYDLSTRSKSFV--GTAEYVSPELLNDSF----TDYRCDIWAFGCILFQMIAG 385

Query: 347 TTPFERTGQF----AMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQV 395
             PF+ T ++     ++  ++ F P  +   + +L+  +L +N   R  I Q+
Sbjct: 386 KPPFKATNEYLTFQKVMKVQYAFTP-GFPLIIRDLVKKILVKNLDRRLTISQI 437

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 103/223 (46%), Gaps = 30/223 (13%)

Query: 199 YSGNITQGFEVL-------LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQ 251
           Y  +I + FE+        +L E      LLDY+ Q  + +  E +  K    I  A+  
Sbjct: 202 YHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYIIQHGSIR--EHQARKFARGIASALIY 259

Query: 252 MHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTP 311
           +H   +  +HRD+KIEN+++  ++  K+ DFG ++     + S + +      LY     
Sbjct: 260 LHANNI--VHRDLKIENIMISDSSEIKIIDFGLSNI----YDSRKQLHTFCGSLY----- 308

Query: 312 QYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKF-----EFP 366
            + +PE++    Y     + D+W+ GV L+ L+    PF+     ++LH K      E+ 
Sbjct: 309 -FAAPELLKANPY--TGPEVDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEY- 363

Query: 367 PNSYSSKLINLIIVMLAENPSLRPNIYQVLYYLSEVTNREVPP 409
           P   S ++I+L+  ML  +P  R  + QV+ +   V     PP
Sbjct: 364 PQHLSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFNGPP 406

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 98/210 (46%), Gaps = 30/210 (14%)

Query: 199 YSGNITQGFEVL-------LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQ 251
           Y  +I + FE+        +L E      LLDY+ Q     L E+   K +  I  A+  
Sbjct: 180 YHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQH--GSLRERHARKFVRGIASALQY 237

Query: 252 MHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTP 311
           +H   +  +HRD+KIEN+++  +   K+ DFG ++     + + + +      LY     
Sbjct: 238 LHLNNI--VHRDLKIENIMISTSGEIKIIDFGLSNL----YDNKKQLHTFCGSLY----- 286

Query: 312 QYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKF-----EFP 366
            + +PE++    Y  I  + DIW+ GV +Y L+    PF+     ++LH K      E+ 
Sbjct: 287 -FAAPELLKANPY--IGPEVDIWSFGVVIYVLVCGKVPFDDENA-SVLHEKIKKGKVEY- 341

Query: 367 PNSYSSKLINLIIVMLAENPSLRPNIYQVL 396
           P   S + I+L+  ML  +P  R ++ QV 
Sbjct: 342 PQHLSIECISLLSKMLVVDPLKRASLKQVC 371

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 128/295 (43%), Gaps = 52/295 (17%)

Query: 86  PVAQPQIEEKFPAGKVVTVGSH-RVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMN 144
           P+ + QI   F     +  G + +V++   L  G    I ++      N FE+++  S+ 
Sbjct: 40  PLTKRQILNNFEILATLGNGQYGKVKLARDLGTGALVAIKIL------NRFEKRSGYSLQ 93

Query: 145 QPLKPGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNIT 204
             LK  +P               ++  E+EVMK+     N+V+ ++     L D      
Sbjct: 94  --LKVENP---------------RVNQEIEVMKRCHHE-NVVELYEI----LND-----P 126

Query: 205 QGFEVLLLMELCPNKSLLDYMNQRLATK------LTEQEIFKIMYDITLAVAQMHYLPVP 258
           +  +V L++E C    +      ++  K      LT Q+  K++ D+   +  +H   + 
Sbjct: 127 ESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPSILTFQQSRKVVLDVVSGLEYLHSQGI- 185

Query: 259 LIHRDIKIENVLVDANNNFKLCDFG---STSTCFPAFTSFQDIAMLSQDLYMHTTPQYRS 315
             HRDIK  N+L+ +N   K+ DFG   ST+T      S  +  + S+ L    TP + +
Sbjct: 186 -THRDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQSSHEQLLKSRAL---GTPAFFA 241

Query: 316 PEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQF----AMLHSKFEFP 366
           PE+    K    +   DIW+LGV +Y LLF   PF          ++++   EFP
Sbjct: 242 PELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFNANSGLELFDSIINKPLEFP 296

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 99/212 (46%), Gaps = 30/212 (14%)

Query: 199 YSGNITQGFEVL-------LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQ 251
           Y  +I + FE+        +L E      LLDY+ Q     L E    K    +  A+  
Sbjct: 190 YHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYIIQH--GSLREHHARKFARGVASALQY 247

Query: 252 MHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTP 311
           +H   +  +HRD+KIEN+++  +   K+ DFG ++     + + + +      LY     
Sbjct: 248 LHANNI--VHRDLKIENIMISNSGEIKIIDFGLSN----VYDTRKQLHTFCGSLY----- 296

Query: 312 QYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKF-----EFP 366
            + +PE++    Y     + D+W+ GV LY L+    PF+     ++LH K      E+ 
Sbjct: 297 -FAAPELLKAHPY--TGPEVDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKRGKVEY- 351

Query: 367 PNSYSSKLINLIIVMLAENPSLRPNIYQVLYY 398
           P   S ++++L+  ML  +PS R ++ QV+ +
Sbjct: 352 PQHLSIEVMSLLSKMLVVDPSRRASLKQVVEH 383

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 77/324 (23%), Positives = 128/324 (39%), Gaps = 59/324 (18%)

Query: 96  FPAGKVVTVGSH-RVEVVSYLAEGGFAQIYVVKFVEYTNEF---------------ERKN 139
           +  GK +  GS  RV +   +  G  A I +V    Y                   + K+
Sbjct: 93  WKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTDSKD 152

Query: 140 DESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDY 199
             +   P+K G+ + L    ++ E+          V+ KL   PN++   +   ++    
Sbjct: 153 SSNREDPIKNGTDSALNPYGIEREI----------VIMKLISHPNVMGLLEVWENK---- 198

Query: 200 SGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPL 259
                   E+ L++E      L DY+  +   KL+E E       I   V+  H   +  
Sbjct: 199 -------SELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFNI-- 247

Query: 260 IHRDIKIENVLVDANNN-FKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEM 318
            HRD+K EN+L+D  N   K+ DFG  +   P         +L        +P Y SPE+
Sbjct: 248 CHRDLKPENLLLDKKNKVIKIADFGMAALELPN-------KLLETSC---GSPHYASPEI 297

Query: 319 IDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAML----HSKFEFPPNSYSSKL 374
           +    Y      SD+W+ G+ L+ LL    PF       +L      +F+ PP   ++  
Sbjct: 298 VMGKPY--HGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPP-YLTNDA 354

Query: 375 INLIIVMLAENPSLRPNIYQVLYY 398
            +LI  +L  NP  R  I ++L +
Sbjct: 355 KDLITRILVTNPEKRLTINEILNH 378

>Scas_493.2
          Length = 1117

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 110/245 (44%), Gaps = 51/245 (20%)

Query: 169 MRSEVEVMKKLQGAPNIVQYFD-----SNASRLRDYSGNITQGFEVLLLMELCPNKSLLD 223
           +  E+ +MK L+ A N++  +D     SN   + +Y+    +G    LL+E  P      
Sbjct: 81  IEREIIIMKLLRHA-NVLSLYDVWETNSNLYMILEYA---EKGELFNLLVEKGP------ 130

Query: 224 YMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFG 283
                    L E+E  +    I + ++  H L +  +HRD+K EN+L+D   N K+ DFG
Sbjct: 131 ---------LPEKEAVRFFRQIIIGISYCHALGI--VHRDLKPENLLLDHKFNIKIADFG 179

Query: 284 STSTCFPAFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWALGVFL 340
                          A+ ++D  + T   +P Y +PE++    Y     +SD+W+ GV L
Sbjct: 180 MA-------------ALETEDKLLETSCGSPHYAAPEIVSGIPYHGF--ESDVWSCGVIL 224

Query: 341 YKLLFFTTPFE------RTGQFAMLHSKFEFPPNSYSSK-LINLIIVMLAENPSLRPNIY 393
           + LL    PF+      R     +   +FE P +   S+   +LI  +L  +P+ R    
Sbjct: 225 FALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTR 284

Query: 394 QVLYY 398
           ++L +
Sbjct: 285 EILKH 289

>Kwal_56.23717
          Length = 858

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 91/191 (47%), Gaps = 23/191 (12%)

Query: 211 LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVL 270
           +L E      LLDY+ Q     L E+   K    I  A+  +H   +  +HRD+KIEN++
Sbjct: 10  MLFEYVSGGQLLDYIIQH--GSLRERSARKFARGIASALQYLHMNNI--VHRDLKIENIM 65

Query: 271 VDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEK 330
           +  +   K+ DFG ++   P     + +      LY      + +PE++    Y     +
Sbjct: 66  ISTSGEIKIIDFGLSNMYNPK----KQLHTFCGSLY------FAAPELLKACPY--TGPE 113

Query: 331 SDIWALGVFLYKLLFFTTPFERTGQFAMLHSKF-----EFPPNSYSSKLINLIIVMLAEN 385
            D+W+ GV L+ L+    PF+     ++LH K      E+ P   S ++I+L+  ML  +
Sbjct: 114 VDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEY-PQHLSIEVISLLSKMLVVD 171

Query: 386 PSLRPNIYQVL 396
           P+ R ++ QV+
Sbjct: 172 PTKRASLKQVV 182

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 115/247 (46%), Gaps = 33/247 (13%)

Query: 153 ACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLL 212
             +K V+ +++  LN + +E+ ++K L            N + +  Y G I + +E+ +L
Sbjct: 51  VAIKEVVYENDEELNDIMAEISLLKNL------------NHNNIVKYHGFIRKSYELYIL 98

Query: 213 MELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVD 272
           +E C N SL   ++ R +T L+E E    +    L +  +H   V  IHRDIK  N+L+ 
Sbjct: 99  LEYCANGSLRRLIS-RSSTGLSENESKTYVTQTLLGLKYLHGEGV--IHRDIKAANILLS 155

Query: 273 ANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSD 332
           A+N  KL DFG ++             + S  L +  T  + +PE++        +  SD
Sbjct: 156 ADNTVKLADFGVSTI------------VNSSALTLAGTLNWMAPEILG---NRGASTLSD 200

Query: 333 IWALGVFLYKLLFFTTPFERTGQ---FAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLR 389
           IW+LG  + ++L    P+        +  + +   +PP+S+S  L + +     +N   R
Sbjct: 201 IWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKR 260

Query: 390 PNIYQVL 396
           P   Q+L
Sbjct: 261 PTADQLL 267

>Kwal_23.5668
          Length = 1689

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 98/203 (48%), Gaps = 25/203 (12%)

Query: 209  VLLLMELCPNKSLLDYMN-QRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267
            + + ME C N++L D ++ + L  +  ++E +++  +I  A++ +H     +IHRD+K  
Sbjct: 812  LFIQMEYCENRTLFDLIHTENLCAQ--KEEYWRLFREILDALSYIH--SQGIIHRDLKPM 867

Query: 268  NVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPI 327
            N+ +D + N K+ DFG            + + +L  D ++ T         I    Y+  
Sbjct: 868  NIFIDESRNIKIGDFGLAKNV------HKSVDLLRMDSHISTASTEDLTSAIGTALYVAT 921

Query: 328  ---------NEKSDIWALGVFLYKLLF-FTTPFERTGQFAMLH-SKFEFPPNSYSSKLI- 375
                     NEK D+++LG+  +++++ F T  ER      +  S  +FP +  SSKL  
Sbjct: 922  EVLTGSGNYNEKIDMYSLGIIFFEMVYSFNTGMERVNDIKKIRTSAIDFPSDFDSSKLAV 981

Query: 376  --NLIIVMLAENPSLRPNIYQVL 396
               +I  +L  +P+ RPN   +L
Sbjct: 982  EKKIITQLLDHDPNRRPNAKTLL 1004

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 91/203 (44%), Gaps = 21/203 (10%)

Query: 211 LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVL 270
           +  E      LLDY+ Q     L E    K+   I  A+  +H     ++HRD+KIEN++
Sbjct: 168 MFFEFISGGQLLDYIIQH--GSLKENHARKVSRGILSALQYLH--ANNIVHRDLKIENIM 223

Query: 271 VDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEK 330
           +      KL DFG ++   P     + +      LY      + +PE++    Y  +  +
Sbjct: 224 LSKTGEIKLIDFGLSNMYDPR----KSLQTFCGSLY------FAAPELLKAHPY--LGPE 271

Query: 331 SDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSY----SSKLINLIIVMLAENP 386
            D+W+ GV LY L+    PF+     A LH K +    +Y    S  +I+L+  +L  +P
Sbjct: 272 VDVWSFGVVLYVLVCGKVPFDDENSSA-LHEKIKKGKVTYPQFLSIDVISLLSKILVVDP 330

Query: 387 SLRPNIYQVLYYLSEVTNREVPP 409
             R  + QV+ +   +   + PP
Sbjct: 331 QKRATLQQVVNHQWMLKGYDFPP 353

>Kwal_33.13112
          Length = 505

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 94/202 (46%), Gaps = 18/202 (8%)

Query: 199 YSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVP 258
           Y     +   + ++ME C   S  D +      +L E ++  I+ ++   +  +H     
Sbjct: 97  YYKTYVEDVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLH--SQR 154

Query: 259 LIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEM 318
            IHRD+K  N+L+      KL DFG          S Q +A L ++ ++  TP + +PE+
Sbjct: 155 KIHRDVKAANILLTDEGEVKLGDFG---------VSGQIMATLKRNTFV-GTPYWMAPEI 204

Query: 319 IDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQF-AMLHSKFEFPP---NSYSSKL 374
           I   +    +EK+DIW+LG+   +LL    P+ +      +++     PP     ++S  
Sbjct: 205 IA--RDNGYDEKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPPRLQGRFTSSA 262

Query: 375 INLIIVMLAENPSLRPNIYQVL 396
            + I + L ++P+LRP    +L
Sbjct: 263 RDFIALCLTKDPALRPTASDLL 284

>Sklu_2073.3 YER129W, Contig c2073 2194-5742
          Length = 1182

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 118/286 (41%), Gaps = 70/286 (24%)

Query: 110 EVVSYLAEGGFAQIYVVK--------FVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQ 161
           E++  L  G   ++ + +         ++  +  E+KN+           P  LK+   +
Sbjct: 118 EIIKELGHGQHGKVKLARDLLTKQLVAIKIVDRHEKKNN-----------PWKLKKTNTE 166

Query: 162 DEVGLNKMRSEVEVMKKL--QGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNK 219
           ++    K++ E+ +MKK   +    +++  D   SR            ++ L++E C   
Sbjct: 167 ND----KIKREIAIMKKCHHEHVVKLIEVLDDFKSR------------KIYLVLEYCSKG 210

Query: 220 SLLDYMNQRLATK------LTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDA 273
            +      +L TK      LT Q   +++  + L +  +HY  +  IHRDIK  N+LV  
Sbjct: 211 EIKWCPGDQLETKARGPPLLTFQRAREVLRGVVLGLEYLHYQGI--IHRDIKPANLLVSE 268

Query: 274 NNNFKLCDFG-----STSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMI----DLFKY 324
               K+ DFG     ST+     F    ++A  +       TP + +PE+      L K+
Sbjct: 269 TGTVKISDFGVSLAASTTEDGNGFIDELELAKTA------GTPAFFAPEICLGHDALEKF 322

Query: 325 IP----------INEKSDIWALGVFLYKLLFFTTPFERTGQFAMLH 360
            P          I+   DIWALGV L+ LLF   PF    +  + H
Sbjct: 323 NPDKKATKKGLCISFMIDIWALGVTLHCLLFGQLPFISEFELELFH 368

>Kwal_47.17263
          Length = 1127

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 91/210 (43%), Gaps = 41/210 (19%)

Query: 165 GLNKMRSEVEVMKKL--QGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLL 222
           G +K++ E+ +MKK   +    +V+  D + SR            ++ L++E C    + 
Sbjct: 154 GSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSR------------KIYLVLEYCSKGEVK 201

Query: 223 DYMNQRLATK------LTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNN 276
                +L T+      LT Q   +I   + L +  +HY  +  IHRDIK  N+L+  +  
Sbjct: 202 WCPGDQLETEARGPPLLTFQRAREIFRGVVLGLEYLHYQGI--IHRDIKPANLLISESGT 259

Query: 277 FKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHT--TPQYRSPEMI----DLFKYIP---- 326
            K+ DFG     F A  S      L +     T  TP + +PE+        ++ P    
Sbjct: 260 VKISDFG---VSFAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHEASERFAPDRPS 316

Query: 327 ------INEKSDIWALGVFLYKLLFFTTPF 350
                 I+   DIWA+GV L+ LLF   PF
Sbjct: 317 SDHGSIISYNIDIWAIGVTLHCLLFGMLPF 346

>Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement
          Length = 466

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 106/238 (44%), Gaps = 32/238 (13%)

Query: 167 NKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMN 226
           N +  EV +  +     NI++  D N S+  DY         + + ME+     L D + 
Sbjct: 4   NDVSKEVIIHSRCSKHSNILKVIDCNISK--DY---------LWIAMEMADGGDLFDKIE 52

Query: 227 QRLATKLTEQEIFKIMYDITL-AVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGST 285
             +     + E+ +  +   L A+  +H +   + HRDIK EN+L+D N N KL DFG  
Sbjct: 53  PDIGV---DAEVAQFYFQQLLRAIHHLHEV-CGIAHRDIKPENILLDKNGNLKLADFGLA 108

Query: 286 STCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLF 345
           S     F        L++D     +P Y +PE+I   +Y    + +DIW+ G+ ++ LL 
Sbjct: 109 S----QFRRKDGTKRLARD--QRGSPPYMAPEIIYSSEYYA--DTTDIWSCGILVFVLLT 160

Query: 346 FTTPFERTG-------QFAMLHSKFEFPPNS-YSSKLINLIIVMLAENPSLRPNIYQV 395
             TP+E          +F   +    F P +      +NL+  +L  NPS R  I Q+
Sbjct: 161 GETPWELPSEDDYNFREFLEDNGNLSFGPWAKIDFTQLNLLRKILQPNPSKRATILQL 218

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 89/199 (44%), Gaps = 28/199 (14%)

Query: 208 EVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267
           E+ L++E      L DY+  +   KL E E       I  AVA  H   +   HRD+K E
Sbjct: 148 ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFNI--CHRDLKPE 203

Query: 268 NVLVDANN-NFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTT---PQYRSPEMIDLFK 323
           N+L+D    + K+ DFG               A+ + D  + T+   P Y SPE++   K
Sbjct: 204 NLLLDKKKRSIKIADFGMA-------------ALETSDKLLETSCGSPHYASPEIVLGRK 250

Query: 324 YIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAML----HSKFEFPPNSYSSKLINLII 379
           Y      SD+W+ G+ L+ LL    PF       +L      K++  P   S +  +LI 
Sbjct: 251 YH--GSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQM-PQWLSVEAKDLIS 307

Query: 380 VMLAENPSLRPNIYQVLYY 398
            +L  +P+ R  I Q+L +
Sbjct: 308 RILVVDPNRRITIDQILQH 326

>Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement
          Length = 488

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 88/196 (44%), Gaps = 25/196 (12%)

Query: 150 GSPACLKRV--LVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGF 207
           G    +K++  +   EV L +   E++ M   +G  NI+   D +    + Y G      
Sbjct: 147 GVRIAIKKITNIFHREVLLKRAIRELKFMNYFKGHKNIINLLDLDIVSEKPYDG------ 200

Query: 208 EVLLLMELCPNKSLLDYMNQRL---ATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDI 264
                  L   + L+DY   R+   + +L+E  I   +Y I   +  +H     +IHRD+
Sbjct: 201 -------LYCYQELIDYDLARVIHSSVQLSEFHIKSFLYQILCGLKYIH--SADVIHRDL 251

Query: 265 KIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKY 324
           K  N+L   + N K+CDFG      P F   + ++ ++  +    T  YR+PE+I    +
Sbjct: 252 KPGNILCTIHGNLKICDFGLARGVSPQFFQGRTVSHITNYV---ATRWYRAPELI--LSH 306

Query: 325 IPINEKSDIWALGVFL 340
              ++  D+WA+G  L
Sbjct: 307 KNYSKAIDMWAVGCIL 322

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 89/197 (45%), Gaps = 27/197 (13%)

Query: 209 VLLLMELCPNKSLLDYMN-QRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267
           +  +M+L P   LL  +  QR+    +E      M  +   V  +H + V  IHRD+K E
Sbjct: 86  LYFVMDLAPGGELLQLLRRQRV---FSEAWARHYMCQLVDTVEYIHSMGV--IHRDLKPE 140

Query: 268 NVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQD---LYMHTTPQYRSPEMIDLFKY 324
           NVL+D      + DFG+      A+T  Q  A    D        T +Y SPE++   K 
Sbjct: 141 NVLLDKEGRLMIADFGA------AYTVGQSDAGSDGDKPATSFVGTAEYVSPELLLENKS 194

Query: 325 IPINEKSDIWALGVFLYKLLFFTTPF------ERTGQFAMLHSKFEFPPNSYSSKLINLI 378
                 SD+WALG  LY+ L  T PF      E   Q   L   +  P N  ++ L++ I
Sbjct: 195 Y---YSSDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPANPLAAGLVSKI 251

Query: 379 IVMLAENPSLRPNIYQV 395
           +V+   +PS R  + Q+
Sbjct: 252 LVL---DPSQRYTLEQI 265

>Kwal_26.7788
          Length = 1267

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 101/232 (43%), Gaps = 39/232 (16%)

Query: 175 VMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLT 234
           ++ KL   PN++  ++   ++L           E+ L++E      L DY+  R   +L 
Sbjct: 109 IIMKLISHPNVMGLYEVWENKL-----------ELFLVLEYVDGGELFDYLVSR--GRLP 155

Query: 235 EQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNN-FKLCDFGSTSTCFPAFT 293
           E+E       I    A  H   +   HRD+K EN+L+D  N   K+ DFG          
Sbjct: 156 EKEAIHYFRQIIEGTAYCHGFNI--CHRDLKPENLLLDKKNKRIKIADFGMA-------- 205

Query: 294 SFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
                A+ + +  + T   +P Y SPE++    Y      SD+W+ G+ L+ LL    PF
Sbjct: 206 -----ALQTSNKLLETSCGSPHYASPEIVMGKNY--NGGPSDVWSCGIILFALLTGHLPF 258

Query: 351 ERTGQFAML----HSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVLYY 398
                  +L      K++  P S SS   +LI  +L  +P  R +I ++L +
Sbjct: 259 NDDNIKRLLLKVQAGKYQM-PQSVSSGAQDLISRILVVDPDKRISINEILAH 309

>Kwal_56.22693
          Length = 984

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 99/212 (46%), Gaps = 21/212 (9%)

Query: 195 RLRDYSGNITQGF------EVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLA 248
           RL D  G I   F       +  L+E  PN   L  + +     L+++        I  A
Sbjct: 212 RLNDGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKK--FGSLSQECAVYYSAQILDA 269

Query: 249 VAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMH 308
           +  +H+  +  +HRDIK EN+L+D +   KL DFG T+       + Q   +L +     
Sbjct: 270 IDYLHHKGI--VHRDIKPENILLDKDMKVKLTDFG-TARILEKDETTQTFNLLERSKSFV 326

Query: 309 TTPQYRSPEMI-DLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQF----AMLHSKF 363
            T +Y SPE++ D +    ++ K DIWA G  L++++    PF+ T ++     ++  ++
Sbjct: 327 GTAEYVSPELLNDNY----VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQY 382

Query: 364 EFPPNSYSSKLINLIIVMLAENPSLRPNIYQV 395
            F    +   + +LI  +L ++P  R +  Q+
Sbjct: 383 AFTAG-FPLVIRDLIKKILVKSPEQRLDASQI 413

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 80/150 (53%), Gaps = 22/150 (14%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++TLA+  +H+  +  I+RD+K EN+L+D N + K+ DFG            +++  ++ 
Sbjct: 157 EVTLALEYLHFHNI--IYRDLKPENILLDRNGHIKITDFGFA----------KEVETVTW 204

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQF----AML 359
            L    TP Y +PE+I      P N+  D W+LGV +Y++L   TPF  T        +L
Sbjct: 205 TL--CGTPDYIAPEVIAT---KPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKIL 259

Query: 360 HSKFEFPPNSYSSKLINLIIVMLAENPSLR 389
           H K  + P  ++S +I+L+  +L  + + R
Sbjct: 260 HGKVVY-PQFFNSDVIDLLSKLLTADLTRR 288

>YJL187C (SWE1) [2737] chr10 complement(76802..79261)
           Serine/tyrosine dual-specificity protein kinase,
           phosphorylates Cdc28p on tyrosine and inhibits its
           activity, involved in G2 phase cell-cycle checkpoint
           control [2460 bp, 819 aa]
          Length = 819

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 114/235 (48%), Gaps = 38/235 (16%)

Query: 112 VSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRS 171
           V  + +G F+ +Y V F +   ++  K        +KP     LKR+L++ ++ LN++ +
Sbjct: 447 VHSIGKGQFSTVYQVTFAQTNKKYAIK-------AIKPNKYNSLKRILLEIKI-LNEVTN 498

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLAT 231
           ++ + +  +G   I+ Y  S   +   Y           ++ ELC N +L  ++ +++  
Sbjct: 499 QITMDQ--EGKEYIIDYISSWKFQNSYY-----------IMTELCENGNLDGFLQEQVIA 545

Query: 232 K---LTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTC 288
           K   L +  I+KI+ +++LA+  +H     ++H D+K  NV++    N KL DFG  +  
Sbjct: 546 KKKRLEDWRIWKIIVELSLALRFIHD-SCHIVHLDLKPANVMITFEGNLKLGDFGMATHL 604

Query: 289 FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKL 343
                SF++              +Y +PE+I    Y   + K+DI++LG+ + ++
Sbjct: 605 PLEDKSFEN----------EGDREYIAPEIISDCTY---DYKADIFSLGLMIVEI 646

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 100/212 (47%), Gaps = 22/212 (10%)

Query: 194 SRLRD-YSGNITQGFEV----LLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLA 248
           S LR  Y  N    F V     ++ME C   S  + +      K+TE++   I+ ++ + 
Sbjct: 71  SELRSPYITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIG 130

Query: 249 VAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMH 308
           +  +H      IHRDIK  N+L+  N + KL DFG          S Q +    +D ++ 
Sbjct: 131 LDYLH--SQRKIHRDIKSANILLTDNGHVKLGDFG---------VSGQMMVTRKRDTFV- 178

Query: 309 TTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQF-AMLHSKFEFPP 367
            TP + +PE+ID  K    NE +DIW+LG+ + +LL    P ++     A++      PP
Sbjct: 179 GTPFWMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPP 237

Query: 368 ---NSYSSKLINLIIVMLAENPSLRPNIYQVL 396
                +SS   + +   L ++PS RP   ++L
Sbjct: 238 KLDKRFSSHARDFVAQCLIKDPSQRPTAAELL 269

>YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specific
           protein kinase of the MAP family required for completion
           of sporulation [1167 bp, 388 aa]
          Length = 388

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 102/259 (39%), Gaps = 41/259 (15%)

Query: 87  VAQPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQP 146
           +  PQ    F   ++   G +  E++ +L +G +  +  VKF                + 
Sbjct: 18  LGAPQQRTIFAKERISIPGYY--EIIQFLGKGAYGTVCSVKF----------------KG 59

Query: 147 LKPGSPACLKRV--LVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNIT 204
             P +   +K++  +   E+ L +   E++ M   +G  NIV   D        Y G   
Sbjct: 60  RSPAARIAVKKISNIFNKEILLKRAIRELKFMNFFKGHKNIVNLIDLEIVTSSPYDG--- 116

Query: 205 QGFEVLLLMELCPNKSLLDYMNQRL---ATKLTEQEIFKIMYDITLAVAQMHYLPVPLIH 261
                     L   + L+DY   ++   + +L+E  I   +Y I   +  +H     +IH
Sbjct: 117 ----------LYCYQELIDYDLAKVIHSSVQLSEFHIKYFLYQILCGLKYIH--SADVIH 164

Query: 262 RDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDL 321
           RD+K  N+L   N   K+CDFG        F             Y+  T  YR+PE+  L
Sbjct: 165 RDLKPGNILCTLNGCLKICDFGLARGIHAGFFKCHSTVQPHITNYV-ATRWYRAPEL--L 221

Query: 322 FKYIPINEKSDIWALGVFL 340
               P ++  DIWA+G  L
Sbjct: 222 LSNQPYSKSVDIWAVGCIL 240

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 127/299 (42%), Gaps = 59/299 (19%)

Query: 153 ACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASR--LRDYSGNITQGFEV- 209
           A +K+  +  +V    +   V V+K   G    V+ F   A R  L++YS  +T  F   
Sbjct: 258 ALIKKFGIPGKVPGKGVSGSVSVIKSTDGQLFAVKRFRPRAPRETLKEYSRKVTSEFCTG 317

Query: 210 ---------------------LLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLA 248
                                L++ME CP     D+ N  ++ ++T+ E++     I   
Sbjct: 318 STLRHQNIIETLDMLQEGELFLVVMEYCP----YDFFNLVMSNQMTKHEVWCYFKQICRG 373

Query: 249 VAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIA--MLSQDLY 306
           V  +H     L HRD+K++N +V A+   KL DFGS       F S  + A  ++  D Y
Sbjct: 374 VDYLH--SQGLAHRDLKLDNCVVTADGILKLIDFGSAIIFRYNFNSKLEPAKGIVGSDPY 431

Query: 307 MHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQ----FAML--- 359
           +       +PE++    Y P    +D+W++ V  Y +     P+++  +    F +    
Sbjct: 432 L-------APELLTQLYYDP--SAADVWSIAVMFYCMSLRRFPWKKPSEDVPSFKLFCQK 482

Query: 360 ------HSKFEFPPNSYSSKLINLIIV-MLAENPSLRPNIYQVL---YYLS-EVTNREV 407
                 HSK  +       +   L+I  ML  +P  R +I +++   ++LS E  ++++
Sbjct: 483 PDDENDHSKGPYRLLKLLPRATRLLISRMLELDPKKRASITEIIQDPWFLSIEACDKDL 541

>Scas_627.7
          Length = 349

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 113/251 (45%), Gaps = 38/251 (15%)

Query: 154 CLKRVLVQDEV---GLNK-MRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEV 209
           C  +V+ + E+    L K  R EVE+   L   PN+ + +           G+      V
Sbjct: 117 CALKVMDKAEIVQYNLQKQFRREVEIQTSL-NHPNLTKLY-----------GHFHDEKRV 164

Query: 210 LLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENV 269
            LLME      L  Y   R      +    + ++ I  A+  +H     +IHRD+K EN+
Sbjct: 165 YLLMEYLVYGEL--YKLLRSHGPFNDVIASRFVFQIADALNYLH--DKQIIHRDLKPENI 220

Query: 270 LVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINE 329
           L+  NN  KL DFG  S   P     + +           T  Y SPEMI   +Y   ++
Sbjct: 221 LIGFNNVIKLTDFG-WSIINPRGVKRKTLC---------GTIDYLSPEMIRSREY---DD 267

Query: 330 KSDIWALGVFLYKLLFFTTPFER-TGQFA---MLHSKFEFPPNSYSSKLINLIIVMLAEN 385
           K D+WALGV  Y+L+  + PFE  T +     +L +  +F P + S  + +LI  +L  N
Sbjct: 268 KVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKF-PETVSHDVKDLISKLLKYN 326

Query: 386 PSLRPNIYQVL 396
           PS R ++  V+
Sbjct: 327 PSERISMRDVM 337

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 114/273 (41%), Gaps = 60/273 (21%)

Query: 167 NKMRSEVEVMKKL--QGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDY 224
           +K++ E+ +MKK   +    +++  D   SR            ++ L++E C    +   
Sbjct: 194 DKIKREIAIMKKCHHKHVVKLIEVLDDLKSR------------KIYLVLEYCSRGEVKWC 241

Query: 225 MNQRLATK------LTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFK 278
               L T+      L+ Q   +I+  + L +  +HY  +  IHRDIK  N+L+      K
Sbjct: 242 PPDCLETEAKGPSPLSFQFTREILRGVVLGLEYLHYQGI--IHRDIKPANLLLSETGIVK 299

Query: 279 LCDFGSTSTCFPAFTSFQDIAMLSQDLYMHT-TPQYRSPEMI--------------DLFK 323
           + DFG +     +     D  +   +L     TP + +PE+               +LFK
Sbjct: 300 ISDFGVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFK 359

Query: 324 YIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAM----LHSKFEFPPNSYSSKLIN--- 376
              I+ K DIWALGV LY L+F   PF  + +  +    ++   +FP   YS  L N   
Sbjct: 360 GSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPK--YSDMLKNNQV 417

Query: 377 --------------LIIVMLAENPSLRPNIYQV 395
                         L+  +L +NP  R NI ++
Sbjct: 418 LQMTEEAEYEAAKDLLTRLLEKNPIKRINIEEI 450

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 108/250 (43%), Gaps = 47/250 (18%)

Query: 106  SHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVG 165
            S R +  S++  G F Q+Y                 ++N  L+ G    +K + + D   
Sbjct: 1031 SMRWQKRSFIGGGTFGQVY----------------SAIN--LENGEILAVKEIKIHDTTT 1072

Query: 166  LNKM----RSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSL 221
            + K+    + E+ V++ L   PNIVQY+     R +           V + ME C   SL
Sbjct: 1073 MKKIFPLIKEEMTVLEMLN-HPNIVQYYGVEVHRDK-----------VNIFMEYCEGGSL 1120

Query: 222  LDYMNQ-RLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLC 280
               ++  R+  ++  Q      +++   +A +H   V  +HRDIK EN+L+D N   K  
Sbjct: 1121 ASLLDHGRIEDEMVTQ---VYTFELLEGLAYLHQSGV--VHRDIKPENILLDFNGIIKYV 1175

Query: 281  DFGSTSTCFPAFT------SFQDIAMLSQDL-YMHTTPQYRSPEMIDLFKYIPINEKSDI 333
            DFG+  T   + T      + QD  + ++ L  M  TP Y +PE I            D+
Sbjct: 1176 DFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDV 1235

Query: 334  WALGVFLYKL 343
            WALG  + ++
Sbjct: 1236 WALGCVVLEM 1245

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 91/192 (47%), Gaps = 15/192 (7%)

Query: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268
           +  L+E  PN   L  M +R  T L+E+        I  A+  +H   +  IHRD+K EN
Sbjct: 276 LYFLLEYAPNGDFLSVM-KRFGT-LSEECTKYYGAQILDAIHHLHKQGI--IHRDVKPEN 331

Query: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMI-DLFKYIPI 327
           +L+D     KL DFG T+         +   + ++      T +Y SPE++ D +    +
Sbjct: 332 ILLDKTMKIKLTDFG-TAKLIGREDENKPYDLNTRSKSFVGTAEYVSPELLNDNY----V 386

Query: 328 NEKSDIWALGVFLYKLLFFTTPFERTGQF----AMLHSKFEFPPNSYSSKLINLIIVMLA 383
           + + DIWA G  L++++    PF+ T ++     ++  ++ F    +   L +LI  +L 
Sbjct: 387 DSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAG-FPMILRDLIKQLLV 445

Query: 384 ENPSLRPNIYQV 395
           + P  R  I Q+
Sbjct: 446 KKPEQRLTILQI 457

>Kwal_23.6325
          Length = 1542

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 117/280 (41%), Gaps = 41/280 (14%)

Query: 147  LKPGSPACLKRVLVQDEVGLNK----MRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGN 202
            L  G    +K + +QD   + +    ++ E+ V++ L   PN+VQY+     R +     
Sbjct: 1269 LDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLN-HPNVVQYYGVEVHRDK----- 1322

Query: 203  ITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHR 262
                  V L ME C   SL     Q L     E E+   +Y + +     +     ++HR
Sbjct: 1323 ------VNLFMEYCEGGSL----AQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVHR 1372

Query: 263  DIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDL---YMHTTPQYRSPEMI 319
            DIK EN+L+D N   K  DFG+  +     T   ++    +      M  TP Y SPE I
Sbjct: 1373 DIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPESI 1432

Query: 320  DLFKYIPINEKSDIWALGVFLYKLLFFTTP-FERTGQFAMLH-----------SKFEFPP 367
               K        DIW+LG  + +++    P F    ++A+++           +K E  P
Sbjct: 1433 TGAKKGKFG-SGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPTKEELSP 1491

Query: 368  NSYSSKLINLIIVMLAENPSLRPNIYQVLYYLSEVTNREV 407
                   I+ ++  L ++P+ R    ++L +   +  RE+
Sbjct: 1492 QG-----IDFLLRCLKQDPNKRSTAMELLLHPWMIEIREL 1526

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 131/305 (42%), Gaps = 49/305 (16%)

Query: 102 VTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQ 161
           +TVG    E +  L +G   ++Y+VK  + TN        S ++ +K      +KR+L +
Sbjct: 490 ITVGPQSFEKIRLLGQGDVGKVYLVK-EKRTNRLYALKIFSKSEMIKRKK---IKRILAE 545

Query: 162 DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSL 221
            E+                  P +V  + S  S   DY         + L ME C     
Sbjct: 546 QEI------------LATSNHPFVVTLYHSFQSE--DY---------LYLCMEYCMGGEF 582

Query: 222 LDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCD 281
              +  R +  ++E++      ++T A+  +H L    I+RD+K EN+L+  + +  L D
Sbjct: 583 FRALQTRKSKCISEEDAKFYASEVTAALEYLHLLG--FIYRDLKPENILLHQSGHIMLSD 640

Query: 282 FG----STSTCFP-----AFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINE 329
           F     +     P     A ++  D  + S     ++   T +Y +PE+I    +     
Sbjct: 641 FDLSIQAKDAKVPVVKGNAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAA-- 698

Query: 330 KSDIWALGVFLYKLLFFTTPF--ERTGQ-FA-MLHSKFEFPPNSYSSK-LINLIIVMLAE 384
             D W LG+ +Y++LF  TPF  E T + F+ +L     FP N+  S+   +LI  +L +
Sbjct: 699 -VDWWTLGILIYEMLFGFTPFKGENTNETFSNILKKDVTFPNNNEVSRNCKDLIKKLLIK 757

Query: 385 NPSLR 389
           N S R
Sbjct: 758 NESKR 762

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 108/245 (44%), Gaps = 44/245 (17%)

Query: 196 LRDYSGNITQGFE------VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAV 249
           L+  +G I   F       +  L+E  PN   L  + ++  T L E+        I  A+
Sbjct: 174 LKSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLI-KKFGT-LNEECTIYYSAQIIDAI 231

Query: 250 AQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTC--------FPAFTSFQDIAML 301
             MH   +  IHRDIK EN+L+D N   KL DFG+             P +       +L
Sbjct: 232 GSMHSHGI--IHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYN------LL 283

Query: 302 SQDLYMHTTPQYRSPEMI-DLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQF---- 356
           ++      T +Y SPE++ D +     + K DIWA G  +Y+++    PF+ T ++    
Sbjct: 284 TRSSSFVGTAEYVSPELLSDNY----TDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQ 339

Query: 357 AMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVLYYL---------SEVTNREV 407
            ++  +F F    + + + +L+  +L + P  R  I Q+  +          + V NR+ 
Sbjct: 340 KVMKVQFAFTA-GFPTIIRDLVKNILVKQPEKRLTIPQIKEHCLFENINFSDNSVWNRD- 397

Query: 408 PPTVL 412
           PP +L
Sbjct: 398 PPKIL 402

>ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH]
           (692321..693913) [1593 bp, 530 aa]
          Length = 530

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 98/209 (46%), Gaps = 44/209 (21%)

Query: 163 EVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMEL--CPNKS 220
           E+  N++  E+ +MK ++   NIV ++ +  + ++++        E+++LME   C +  
Sbjct: 232 ELVKNQLMRELTIMKNVKEQKNIVGFYGAYYTAIKNH--------EIIILMEYMDCGSLD 283

Query: 221 LLDYMNQRLATK-----------LTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENV 269
            +    +R  ++            TE  + KI Y +   ++ + Y    +IHRDIK  N+
Sbjct: 284 KISSTYRRYCSRNKVPMNASTSWFTELSLSKISYAVLNGLSYL-YQDYKIIHRDIKPSNI 342

Query: 270 LVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINE 329
           L+++    K+CDFG +     +            D ++ T+  Y SPE I    Y   N 
Sbjct: 343 LINSKGFVKICDFGVSKKMIDSIA----------DTFVGTS-TYMSPERIQGSCY---NT 388

Query: 330 KSDIWALGVFLYKLLFFTTPFERTGQFAM 358
           K D+W+LG+ + +L+        TG+F +
Sbjct: 389 KGDVWSLGLMIIELV--------TGEFPL 409

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 102/231 (44%), Gaps = 34/231 (14%)

Query: 175 VMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLT 234
           V+ KL   PN++  +D     + + + N+       L++E      L + +       L 
Sbjct: 79  VIMKLLSHPNVLSLYD-----VWETNNNL------YLILEYAEKGELFNLLVDH--GPLP 125

Query: 235 EQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTS 294
           E+E       I + ++  H L +  +HRD+K EN+L+D+  N K+ DFG       A  +
Sbjct: 126 EREAINCFRQIIIGISYCHALGI--VHRDLKPENLLLDSFYNIKIADFG-----MAALQT 178

Query: 295 FQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFE--- 351
             D+   S       +P Y +PE++    Y      SD+W+ GV L+ LL    PF+   
Sbjct: 179 DADLLETS-----CGSPHYAAPEIVSGLPYEGF--ASDVWSCGVILFALLTGRLPFDEEN 231

Query: 352 ---RTGQFAMLHSKFEFPPNSYSSK-LINLIIVMLAENPSLRPNIYQVLYY 398
              R     +   +FE P ++  S+   +LI  +L  +P  R  I  +L +
Sbjct: 232 GNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH 282

>YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capable
           of suppressing DNA polymerase alpha mutations [3429 bp,
           1142 aa]
          Length = 1142

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 92/207 (44%), Gaps = 37/207 (17%)

Query: 167 NKMRSEVEVMKKL--QGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLL-- 222
           +K++ E+ +MKK   +    +++  D   SR            ++ L++E C    +   
Sbjct: 187 DKIKREIAIMKKCHHKHVVQLIEVLDDLKSR------------KIYLVLEYCSRGEVKWC 234

Query: 223 --DYM--NQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFK 278
             D M  + +  + L+ QE  +I+  + L +  +HY  +  IHRDIK  N+L+  +   K
Sbjct: 235 PPDCMESDAKGPSLLSFQETREILRGVVLGLEYLHYQGI--IHRDIKPANLLISGDGTVK 292

Query: 279 LCDFG-STSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMI--------------DLFK 323
           + DFG S +      +   +     +      TP + +PEM               +LF+
Sbjct: 293 ISDFGVSLAASSTNSSDSSESLDELELAKTVGTPAFFAPEMCLGEDAFTRYNLTKENLFR 352

Query: 324 YIPINEKSDIWALGVFLYKLLFFTTPF 350
              I+   DIWA+GV LY LLF   PF
Sbjct: 353 GSCISFMIDIWAVGVTLYCLLFGMLPF 379

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 104/252 (41%), Gaps = 64/252 (25%)

Query: 110 EVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVG---- 165
           EV   L +G F ++Y V+                    K     C  + + ++E+     
Sbjct: 101 EVGRKLGKGKFGKVYCVRH-------------------KKSGFICALKAIEKNEILQFNL 141

Query: 166 LNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYM 225
           L +++ EV++   +   PNI++ +       R Y           LLME   N  L   +
Sbjct: 142 LKQLKREVDIQLGMD-HPNIIKLYAHFHDEKRVY-----------LLMEHSINGELYKSL 189

Query: 226 ------NQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKL 279
                 N  LA+          +Y I  A+  MH     +IHRD+K ENVL+  +N  KL
Sbjct: 190 KNNGPFNDVLASHY--------IYQIADALHYMH--KKRIIHRDVKPENVLIGFDNVVKL 239

Query: 280 CDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVF 339
            DFG  S   P  +  + +           T  Y SPEMI   +Y   +E+ D+WALGV 
Sbjct: 240 ADFG-WSILNPEGSKRKTLC---------GTIDYLSPEMITPREY---DEQVDVWALGVL 286

Query: 340 LYKLLFFTTPFE 351
            Y+L+    PFE
Sbjct: 287 AYELVVGVPPFE 298

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 122/298 (40%), Gaps = 45/298 (15%)

Query: 110 EVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRV-LVQDEVGLNK 168
           +++  + +G F  +Y+  ++         N E  +  +    P  +K + L      ++ 
Sbjct: 8   QLLECVGKGNFGDVYLAHYLG-------SNQEPTDPKIPKNVPLAIKCINLEHSNEPIDL 60

Query: 169 MRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQR 228
           +  E+  +  L   P I  Y+           G  T    + ++ME C N SLL+ +  R
Sbjct: 61  LLKEIYFLSTLH-CPYITHYY-----------GTFTGDCNLYIVMEYCSNGSLLNLL--R 106

Query: 229 LATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTC 288
             ++LTEQ    I+  +  A+  +H     LIHRD+K  N+L++ +   +L D G T   
Sbjct: 107 YYSRLTEQTTCFIILQVCHALEYLH--EKRLIHRDLKAANILLNDDGEVRLADLGVTGQ- 163

Query: 289 FPAFTSFQDIAMLSQDLYMHT-TPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFT 347
                 F       ++L     TP + +PE+I    Y   + K DIW+LG+   +LL   
Sbjct: 164 ----LKFNSTRHGGKNLNTFVGTPFWMAPEIIKNQSY---DGKCDIWSLGITTLELLNGK 216

Query: 348 TPFERTGQFAMLHSKFEFPPNSYSSKLINL---------IIVMLAENPSLRPNIYQVL 396
            P         L      P  +  S L N+         I   L ++P+ RP   Q+L
Sbjct: 217 PPMSHLDSMKAL---MRIPKLNADSILRNMDISPLGKDFIRSCLQQDPNQRPTCKQLL 271

>Kwal_26.7154
          Length = 1213

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 107/253 (42%), Gaps = 47/253 (18%)

Query: 156  KRVLVQDEV---GLNKMRSEVEVMKKLQGAPN-----IVQYFDSNASRLRDYSGNITQGF 207
            +R+LV   V    L  + SE+++M  L   P+     ++ +F+ +     + + + T G 
Sbjct: 987  ERILVDTWVRDRKLGTIPSEIQIMATLNAKPHENILMLLDFFEDDDYYYIETAVHGTSG- 1045

Query: 208  EVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267
                      +  L D +  +  T +TE E   I   I   +  +H     ++HRDIK E
Sbjct: 1046 ----------SIDLFDLIEMK--TDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDE 1091

Query: 268  NVLVDANNNFKLCDFGSTSTC----FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFK 323
            NV+VD N   K+ DFGS +      F  F                 T  Y +PE++    
Sbjct: 1092 NVIVDCNGFVKIVDFGSAAYVKSGPFDVFVG---------------TIDYAAPEVLGGEP 1136

Query: 324  YIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEF-PPNSYSSKLINLIIVML 382
            Y    +  DIWA+GV LY +++   PF    +  +L +          S   I LI  +L
Sbjct: 1137 Y--EGKPQDIWAIGVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKIL 1192

Query: 383  AENPSLRPNIYQV 395
              + S RP+I ++
Sbjct: 1193 NRSVSKRPSIDEI 1205

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 100/213 (46%), Gaps = 22/213 (10%)

Query: 195 RLRDYSGNITQGF------EVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLA 248
           RL++  G I+  F       +  L+E  PN  LL  M  R    + E+        I  A
Sbjct: 209 RLKNTKGIISLYFTFQDESSLYFLLEYAPNGDLLSLM--RKHGSVNEKCTQYYAAQIIDA 266

Query: 249 VAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIA--MLSQDLY 306
           +  MH   V  IHRD+K EN+L+D +   KL DFG+        TS  D+   +L++   
Sbjct: 267 LGFMHDKGV--IHRDLKPENILLDVDMKVKLTDFGTARLL--DSTSEDDLKYDLLTRSNS 322

Query: 307 MHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQF----AMLHSK 362
              T +Y SPE+++   Y+    + DIWA G  L++++    PF+   ++     ++  +
Sbjct: 323 FVGTAEYVSPELLN-DNYVDF--RCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKVQ 379

Query: 363 FEFPPNSYSSKLINLIIVMLAENPSLRPNIYQV 395
           F F    +   + +L+  +L +NP  R  I Q+
Sbjct: 380 FAFTA-GFPMTVRDLVKNILIKNPERRLLINQI 411

>Scas_675.2
          Length = 527

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 93/201 (46%), Gaps = 29/201 (14%)

Query: 152 PACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLL 211
           P C K  L + ++       EV +  +    PN+++  D N ++  DY         + +
Sbjct: 50  PTCKKNGLTEKDIS-----REVLLHSRCSKNPNVLRLIDCNIAK--DY---------MWM 93

Query: 212 LMELCPNKSLLDYMNQRLATKLTEQEIFKIMYD-ITLAVAQMHYLPVPLIHRDIKIENVL 270
           +ME+     L D +   +     + E+ +  +  +  A++ +H     + HRDIK EN+L
Sbjct: 94  IMEMADGGDLFDKIEPDVGV---DSEVAQFYFQQLVRAISYLHE-ECGVAHRDIKPENIL 149

Query: 271 VDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEK 330
           +D N N KL DFG +S     +        +S D     +P Y +PE++    Y      
Sbjct: 150 LDKNGNLKLADFGLSS----QYRRKDGTLRISTD--QRGSPPYMAPEILHSRGYYA--HS 201

Query: 331 SDIWALGVFLYKLLFFTTPFE 351
           +DIW++G+ L+ LL   TP+E
Sbjct: 202 TDIWSIGILLFVLLTGETPWE 222

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 79/167 (47%), Gaps = 28/167 (16%)

Query: 184 NIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMY 243
           NIV Y DS  S           G ++ ++ME      L D +   +   LTE +I  +  
Sbjct: 623 NIVNYIDSYLS-----------GLDLWVVMEYMEGGCLTDVVTYCV---LTEGQIGAVCR 668

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++   +  +H   V  +HRDIK +NVL+  N + KL DFG     F A  +   I   + 
Sbjct: 669 EVLQGLEFLHSKGV--LHRDIKSDNVLLSMNGDIKLTDFG-----FCAQVNDTVIKRTT- 720

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
              M  TP + +PE++   +Y P   K DIW+LG+ + +++    P+
Sbjct: 721 ---MVGTPYWMAPEIVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 761

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 110/240 (45%), Gaps = 39/240 (16%)

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLAT 231
           E+ VMK  +  PNIV + DS           + +G ++ ++ME     SL D +   +  
Sbjct: 665 EILVMKGSKH-PNIVNFIDSY----------VLKG-DLWVIMEYMEGGSLTDVVTHCI-- 710

Query: 232 KLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPA 291
            LTE +I  +  +    +  +H   V  +HRDIK +N+L+    + KL DFG     F A
Sbjct: 711 -LTEGQIGAVCRETLSGLEFLHSKGV--LHRDIKSDNILLSMEGDIKLTDFG-----FCA 762

Query: 292 FTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFE 351
             +  ++   +    M  TP + +PE++   +Y P   K DIW+LG+ + +++    P+ 
Sbjct: 763 QINELNLKRTT----MVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYL 815

Query: 352 RTGQFAMLH-------SKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVLY--YLSEV 402
                  L+        K + P N  SS L   +   L   P  R +  ++L+  Y++E+
Sbjct: 816 NETPLRALYLIATNGTPKLKEPEN-LSSSLKKFLDWCLCVEPEDRASATELLHDEYITEI 874

>Scas_598.6
          Length = 790

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 120/272 (44%), Gaps = 39/272 (14%)

Query: 85  PPVAQPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYT-NEFERKNDESM 143
           P ++  +I  K  +  + T  S   +++    +G    +Y+ + +     EF+   +   
Sbjct: 478 PSMSNAEIMSKLKSVTINTDPSPYFQMIEKAGQGASGSVYLAERIAIPPGEFDETPEV-- 535

Query: 144 NQPLKPGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNI 203
                 G    +K++++  +     + +E+ VMK  +   NIV + ++      D     
Sbjct: 536 ------GDKVAIKQMILSKQPRKELIVNEILVMKDSRHK-NIVNFLEAYLKTEDD----- 583

Query: 204 TQGFEVLLLMELCPNKSLLDYMNQRLAT-----KLTEQEIFKIMYDITLAVAQMHYLPVP 258
                + ++ME     SL D +    AT      LTE +I  I+ +    +  +H   + 
Sbjct: 584 -----LWVVMEFMEGGSLTDIIENSPATGSSSSPLTEPQIAYIVRETCQGLKFLHDKHI- 637

Query: 259 LIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEM 318
            IHRDIK +NVL+D N   K+ DFG     F A  + Q     S+   M  TP + +PE+
Sbjct: 638 -IHRDIKSDNVLLDNNARVKITDFG-----FCAKLTDQR----SKRATMVGTPYWMAPEV 687

Query: 319 IDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
           +   +Y   +EK D+W+LG+   ++L    P+
Sbjct: 688 VKQREY---DEKVDVWSLGIMTIEMLESEPPY 716

>Kwal_56.24091
          Length = 381

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 82/184 (44%), Gaps = 29/184 (15%)

Query: 168 KMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQ 227
           + R EVE+   L+  PN+ + +           G       V LLME   N  L  Y + 
Sbjct: 167 QFRREVEIQSSLK-HPNLTRLY-----------GYFHDEKRVYLLMEYLVNGEL--YKHL 212

Query: 228 RLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTST 287
           R      +      ++ +  A+  MH     ++HRDIK EN+L+   N  KL DFG    
Sbjct: 213 RSHGPFNDITASHFVHQMADALNYMH--SKNILHRDIKPENILLGFQNTLKLTDFG---- 266

Query: 288 CFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFT 347
                 S  ++   S+   +  T  Y SPE+I   +Y   + K D+WALGV  Y+LL  +
Sbjct: 267 -----WSVSNVGN-SKRKTLCGTMDYLSPELIKSREY---DNKVDVWALGVLTYELLVGS 317

Query: 348 TPFE 351
            PFE
Sbjct: 318 PPFE 321

>Scas_502.2
          Length = 1116

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 75/150 (50%), Gaps = 12/150 (8%)

Query: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268
           +  L+E  PN  LL  M +     L E+        I  A+  MH   +  IHRDIK EN
Sbjct: 248 LYFLLEYAPNGDLLSLMKK--FGSLNEECCCYYGAQIIDAIKFMHSKGI--IHRDIKPEN 303

Query: 269 VLVDANNNFKLCDFGSTSTC--FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIP 326
           +L+D +   K+ DFG+       P  TS+    +L++      T +Y SPE+++   Y  
Sbjct: 304 ILLDKDMKVKITDFGTAKILDNKPPGTSYD---LLTRSKSFVGTAEYVSPELLN-DNY-- 357

Query: 327 INEKSDIWALGVFLYKLLFFTTPFERTGQF 356
            + +SDIWA G  +++++    PF+ T ++
Sbjct: 358 TDARSDIWAFGCIVFQMIAGKPPFKATNEY 387

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 93/207 (44%), Gaps = 31/207 (14%)

Query: 152 PACLKRV---LVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208
           PA  K+V   L++ +  +     E+++ +++    ++      N  RL +   N      
Sbjct: 74  PAVSKQVAIKLIRRDTIVKNSEKEIKIYREINALKHLTH---PNVVRLEEVLQN---SKY 127

Query: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268
           + +++E         Y+ ++   +L E    ++   +   V  MH     L+HRD+K+EN
Sbjct: 128 IGIVLEYASGGEFYKYIQRK--RRLKESTACRLFAQLISGVTYMH--SKNLVHRDLKLEN 183

Query: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHT---TPQYRSPEM-IDLFKY 324
           +L+D N N  + DFG  +   P             + YM T   +P Y +PE+ I    Y
Sbjct: 184 LLLDKNENLVITDFGFVNEFLP------------DNEYMKTSCGSPCYAAPELVISTRPY 231

Query: 325 IPINEKSDIWALGVFLYKLLFFTTPFE 351
           +    K+D+W+ G+ LY +L    P++
Sbjct: 232 VA--RKADVWSCGIILYAMLAGYLPWD 256

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 79/185 (42%), Gaps = 23/185 (12%)

Query: 159 LVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPN 218
           + Q EV L +   E++ M   +G  NIV   +      + Y G             L   
Sbjct: 110 IFQREVLLKRAIRELKFMHYFKGHKNIVSLINLEIVNEKPYDG-------------LYCY 156

Query: 219 KSLLDYMNQRLA---TKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANN 275
           + L+DY   R+     + +E  I    Y I   V  +H   V  IHRD+K  N+L   + 
Sbjct: 157 QELIDYDLARVIHSNVQFSEFHIKHFTYQILCGVKYIHSADV--IHRDLKPGNILCSISG 214

Query: 276 NFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWA 335
             K+CDFG      P FT+ +    ++  +    T  YR+PE+I    +   N+  D+WA
Sbjct: 215 QLKICDFGLARGISPLFTNTKTSNHITNYV---ATRWYRAPELI--LSHKRYNKSIDMWA 269

Query: 336 LGVFL 340
           +G  L
Sbjct: 270 IGCIL 274

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 81/164 (49%), Gaps = 16/164 (9%)

Query: 245 ITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQD 304
           I  AV  +H + +  IHRDIK EN+L+D N   KL DFG T+   P   S         D
Sbjct: 233 IIDAVDSLHNIGI--IHRDIKPENILLDKNMKVKLTDFG-TAKILPEEPSNTADGKPYFD 289

Query: 305 LYMHT-----TPQYRSPEMI-DLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAM 358
           LY  +     T +Y SPE++ D +     + + DIWA G  LY++L    PF+   ++  
Sbjct: 290 LYAKSKSFVGTAEYVSPELLNDNY----TDSRCDIWAFGCILYQMLAGKPPFKAANEYLT 345

Query: 359 LHS--KFEFPPNSYSSKLI-NLIIVMLAENPSLRPNIYQVLYYL 399
                K ++   +   +++ +L+  +L  +P+ R  I Q+  +L
Sbjct: 346 FQKVMKIQYAFTAGFPQIVKDLVKKLLVRDPNDRLTIKQIKAHL 389

>Scas_667.18
          Length = 437

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 87/200 (43%), Gaps = 30/200 (15%)

Query: 152 PACLKRV--LVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRD-YSGNITQGFE 208
           P  +K+V  + Q E+ L +   E++ M   QG  NIV   D         Y G       
Sbjct: 106 PVAIKKVTNIFQKEILLKRAIRELKFMNFFQGHKNIVNLIDLEIINENSPYDG------- 158

Query: 209 VLLLMELCPNKSLLDYMNQRL---ATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIK 265
                 L   + L+DY   ++   + KLTE  I   MY I   +  +H     +IHRD+K
Sbjct: 159 ------LYCYQELIDYDLAKVIHSSIKLTEFHIQYFMYQILSGLKYIH--SADVIHRDLK 210

Query: 266 IENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLS----QDLYMHT-TPQYRSPEMID 320
             N+L   N N K+CDFG      P F  + D   L+     D+  +  T  YR+PE+I 
Sbjct: 211 PGNILCTLNGNLKICDFGLARGINPKF--YNDNGNLASPKLHDITNYVATRWYRAPELI- 267

Query: 321 LFKYIPINEKSDIWALGVFL 340
              +    +  D+W++G  L
Sbjct: 268 -LSHKMYTKAIDLWSVGCIL 286

>Kwal_26.7861
          Length = 955

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 85/179 (47%), Gaps = 29/179 (16%)

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLAT 231
           E+ VMK  + A NIV + DS   R            ++ ++ME     SL D +   +  
Sbjct: 712 EILVMKASKHA-NIVNFIDSYLLR-----------GDLWVVMEYMEGGSLTDVVTHCI-- 757

Query: 232 KLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPA 291
            LTE +I  +  +    +  +H   V  IHRDIK +NVL+  +   KL DFG     F A
Sbjct: 758 -LTEGQIGAVSRETLKGLQFLHSKGV--IHRDIKSDNVLLSMSGEIKLTDFG-----FCA 809

Query: 292 FTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
                +I +  +   M  TP + +PE++   +Y P   K DIW+LG+ + +++    P+
Sbjct: 810 --QINEINL--KRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 861

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 84/185 (45%), Gaps = 28/185 (15%)

Query: 168 KMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVL-LLMELCPNKSLLDYMN 226
           K+  E+  +K L   PNI+            Y   + Q  + + +++E         Y+ 
Sbjct: 96  KIYREINALKHLT-HPNII------------YLEEVLQNSKYIGIVLEFVSGGEFYKYIQ 142

Query: 227 QRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTS 286
           ++   +L E    ++   +   V  MHY    L+HRD+K+EN+L+D + N  + DFG  +
Sbjct: 143 RK--RRLKESSACRLFAQLISGVNYMHY--KGLVHRDLKLENLLLDKHENLVITDFGFVN 198

Query: 287 TCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFF 346
                   F+D  ++        +P Y +PE++   K      K+D+W+ GV LY +L  
Sbjct: 199 EF------FEDNELMKTSC---GSPCYAAPELVVSTKAYEA-RKADVWSCGVILYAMLAG 248

Query: 347 TTPFE 351
             P++
Sbjct: 249 YLPWD 253

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 86/196 (43%), Gaps = 22/196 (11%)

Query: 208 EVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267
           E+ L++E      L DY+  +   KL E+E       I   V+  H   +   HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFNI--CHRDLKPE 243

Query: 268 NVLVDANN-NFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIP 326
           N+L+D  N   K+ DFG  +   P         +L        +P Y SPE++    Y  
Sbjct: 244 NLLLDKKNRRIKIADFGMAALELPN-------KLLKTSC---GSPHYASPEIVMGRPY-- 291

Query: 327 INEKSDIWALGVFLYKLLFFTTPFERTGQFAML----HSKFEFPPNSYSSKLINLIIVML 382
               SD+W+ G+ L+ LL    PF       +L      K++ P N  SS+  +LI  +L
Sbjct: 292 HGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSN-LSSEARDLISKIL 350

Query: 383 AENPSLRPNIYQVLYY 398
             +P  R    ++L +
Sbjct: 351 VIDPEKRITTQEILKH 366

>YDR283C (GCN2) [1112] chr4 complement(1025062..1030041)
           Serine/threonine protein kinase that regulates
           initiation of translation by phosphorylation of
           eIF2alpha (Sui2p), involved in general amino acid
           control response and salt tolerance [4980 bp, 1659 aa]
          Length = 1659

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 102/204 (50%), Gaps = 27/204 (13%)

Query: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQ--EIFKIMYDITLAVAQMHYLPVPLIHRDIKI 266
           + + ME C N++L D ++   +  L +Q  E +++   I  A++ +H     +IHRD+K 
Sbjct: 784 LFIQMEYCENRTLYDLIH---SENLNQQRDEYWRLFRQILEALSYIH--SQGIIHRDLKP 838

Query: 267 ENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAML-SQDL--------YMHTTPQYRSPE 317
            N+ +D + N K+ DFG       +     DI  L SQ+L            T  Y + E
Sbjct: 839 MNIFIDESRNVKIGDFGLAKNVHRSL----DILKLDSQNLPGSSDNLTSAIGTAMYVATE 894

Query: 318 MIDLFKYIPINEKSDIWALGVFLYKLLF-FTTPFERTGQFAMLHS-KFEFPPNSYSSKL- 374
           ++D   +   NEK D+++LG+  +++++ F+T  ER      L S   EFPP+   +K+ 
Sbjct: 895 VLDGTGH--YNEKIDMYSLGIIFFEMIYPFSTGMERVNILKKLRSVSIEFPPDFDDNKMK 952

Query: 375 --INLIIVMLAENPSLRPNIYQVL 396
               +I +++  +P+ RP    +L
Sbjct: 953 VEKKIIRLLIDHDPNKRPGARTLL 976

>Scas_668.22
          Length = 893

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 87/179 (48%), Gaps = 29/179 (16%)

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLAT 231
           E+ VMK  +  PNIV + DS    L D         ++ ++ME     SL D +   +  
Sbjct: 656 EILVMKGSR-HPNIVNFIDS---YLLD--------GDLWVIMEYMEGGSLTDVVTHCI-- 701

Query: 232 KLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPA 291
            LTE +I  +  +    +  +H   V  +HRDIK +N+L+  + + KL DFG     F A
Sbjct: 702 -LTEGQIGAVCRETLSGLQFLHSKGV--LHRDIKSDNILLSISGDIKLTDFG-----FCA 753

Query: 292 FTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
                +I +  +   M  TP + +PE++   +Y P   K DIW+LG+ + +++    P+
Sbjct: 754 --QINEINL--KRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 805

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 87/179 (48%), Gaps = 29/179 (16%)

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLAT 231
           E+ VMK  +   NIV + DS           + +G ++ ++ME     SL D +   +  
Sbjct: 728 EILVMKGSRHN-NIVNFIDSY----------LLKG-DLWVIMEYMEGGSLTDVVTHCI-- 773

Query: 232 KLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPA 291
            LTE +I  +  +    +  +H   V  IHRDIK +N+L+  + N KL DFG     F A
Sbjct: 774 -LTEGQIAAVSRETLRGLHFLHSKGV--IHRDIKSDNILLSMDGNIKLTDFG-----FCA 825

Query: 292 FTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
             +  ++   +    M  TP + +PE++   +Y P   K DIW+LG+ + +++    P+
Sbjct: 826 QINETNLKRTT----MVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 877

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 104/246 (42%), Gaps = 42/246 (17%)

Query: 154 CLKRVLVQDEV---GLNK-MRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEV 209
           C  +V+ ++E+    L K  R EVE+   L   PN+ + +           G       V
Sbjct: 130 CALKVMEKEEIIKYNLQKQFRREVEIQTSL-NHPNLTKSY-----------GYFHDEKRV 177

Query: 210 LLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENV 269
            LLME   N  +  Y   RL     +      +Y I  A+  MH   +  IHRDIK EN+
Sbjct: 178 YLLMEYLVNGEM--YKLLRLHGPFNDILASDYIYQIANALDYMHKKNI--IHRDIKPENI 233

Query: 270 LVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINE 329
           L+  NN  KL DFG  S   P     + +           T  Y SPEM++  +Y   + 
Sbjct: 234 LIGFNNVIKLTDFG-WSIINPPENRRKTVC---------GTIDYLSPEMVESREY---DH 280

Query: 330 KSDIWALGVFLYKLLFFTTPFERT------GQFAMLHSKFEFPPNSYSSKLINLIIVMLA 383
             D WALGV  ++LL    PFE         + A L  K    P++ S    +LI+ +L 
Sbjct: 281 TIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKM---PSNISQDAQDLILKLLK 337

Query: 384 ENPSLR 389
            +P  R
Sbjct: 338 YDPKDR 343

>YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine
           protein kinase of unknown function [2682 bp, 893 aa]
          Length = 893

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 74/309 (23%), Positives = 131/309 (42%), Gaps = 57/309 (18%)

Query: 102 VTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQ 161
           + VG    E +  L +G   ++++V+        E+K +                +VL +
Sbjct: 489 IMVGPQSFEKIRLLGQGDVGKVFLVR--------EKKTNR-----------VYALKVLSK 529

Query: 162 DE-VGLNKMR---SEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCP 217
           DE +  NK++   +E E++      P IV  + S  S   DY         + L ME C 
Sbjct: 530 DEMIKRNKIKRVLTEQEILA-TSNHPFIVTLYHSFQSE--DY---------LYLCMEYCM 577

Query: 218 NKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNF 277
                  +  R    + E +      ++T A+  +H L    I+RD+K EN+L+  + + 
Sbjct: 578 GGEFFRALQTRKTKCICEDDARFYASEVTAALEYLHLLG--FIYRDLKPENILLHQSGHI 635

Query: 278 KLCDFG----STSTCFP-----AFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYI 325
            L DF     +  +  P     A ++  D  + S     ++   T +Y +PE+I    + 
Sbjct: 636 MLSDFDLSIQAKDSKVPVVKGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHT 695

Query: 326 PINEKSDIWALGVFLYKLLFFTTPFE---RTGQFA-MLHSKFEFPPNSYSSKLI-NLIIV 380
                 D W LG+ +Y++LF  TPF+       F  +L ++  FP N+  S+   +LI  
Sbjct: 696 AA---VDWWTLGILIYEMLFGFTPFKGDNTNETFTNILKNEVSFPNNNEISRTCKDLIKK 752

Query: 381 MLAENPSLR 389
           +L +N S R
Sbjct: 753 LLTKNESKR 761

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 101/248 (40%), Gaps = 41/248 (16%)

Query: 105 GSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKP-GSPACLKRVLVQDE 163
           G+HR +V   +  G F+       V +  + +   D ++    KP  +P  L++V     
Sbjct: 3   GNHRYKVGRLIQSGSFS------VVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAAL-- 54

Query: 164 VGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLD 223
                + +E  ++++L    NI Q  D        Y    T  F    ++E C    L D
Sbjct: 55  -----VHNEYAILRRLGTHRNICQLLDF-------YEDADTYVF----VLEYCAYGDLYD 98

Query: 224 YMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFG 283
           ++                ++ +  A++  H   V   HRDIK ENVL+D     KL DFG
Sbjct: 99  FIKAIRERPTMRINFHSFLFQLCSAISYCHSKDVS--HRDIKPENVLMDDRGQVKLTDFG 156

Query: 284 STSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKL 343
                         I  +S+D Y   T +Y +PE     +       +D W+LG+ ++ L
Sbjct: 157 -----------LSQIGSVSKD-YCIGTEKYLAPET--FLREYHNTFATDYWSLGITIFCL 202

Query: 344 LFFTTPFE 351
           +F + PFE
Sbjct: 203 MFGSCPFE 210

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 89/191 (46%), Gaps = 14/191 (7%)

Query: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268
           +  L+E  PN   L  M +     L E+        +  A+  +H   V  +HRDIK EN
Sbjct: 256 LYFLLEYAPNGDFLSVMKK--FGSLNEECCRYYGAQMLDAIDFIHKNGV--VHRDIKPEN 311

Query: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328
           +L+D +   KL DFG+         S  ++   S+      T +Y SPE+++      +N
Sbjct: 312 ILLDEHMKVKLTDFGTAKLLDRDEKSGYNLLKKSRSFV--GTAEYVSPELLN---DNCVN 366

Query: 329 EKSDIWALGVFLYKLLFFTTPFERTGQF----AMLHSKFEFPPNSYSSKLINLIIVMLAE 384
            K DIWA G  LY+++    PF+ T ++     ++  ++ F    +   + +L+  +L +
Sbjct: 367 YKCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAG-FPLVIRDLVKQLLVK 425

Query: 385 NPSLRPNIYQV 395
           +P  R N  QV
Sbjct: 426 SPEARLNASQV 436

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 102/231 (44%), Gaps = 35/231 (15%)

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLAT 231
           E+ VM++ + + NIV + DS  ++            ++ ++ME     SL D +   L  
Sbjct: 665 EILVMRESKHS-NIVNFIDSYLAK-----------GDLWIVMEYMEGGSLTDVVTHCL-- 710

Query: 232 KLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPA 291
            L+E +I  +  +    +  +H   V  +HRDIK +N+L+    N KL DFG     F A
Sbjct: 711 -LSEGQIGAVCRETLKGLQFLHSKGV--LHRDIKSDNILLSLKGNIKLTDFG-----FCA 762

Query: 292 FTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLL------F 345
             +  ++   +    M  TP + +PE++   +Y P   K DIW+LG+ + +++       
Sbjct: 763 QINENNLKRTT----MVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYL 815

Query: 346 FTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVL 396
             TP       A   +     P + S  L   +   L  +PS R    ++L
Sbjct: 816 NETPLRALYLIATNGTPKLKEPEALSDTLTKFLDWCLKVDPSERATATELL 866

>Scas_458.1
          Length = 367

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 57/107 (53%), Gaps = 9/107 (8%)

Query: 308 HTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQ-------FAMLH 360
           H T Q+ +PE++ L     I  K DIW+LG  LY ++F  +PFER  Q       + +  
Sbjct: 258 HCTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFGISPFEREEQLNGGVVKYCIKM 317

Query: 361 SKFEFP--PNSYSSKLINLIIVMLAENPSLRPNIYQVLYYLSEVTNR 405
            K+  P    +YS ++I+++   L  +PS RP++  +L  L E+  +
Sbjct: 318 GKYSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNGILNNLQEIQGK 364

>Scas_629.16
          Length = 918

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 128/307 (41%), Gaps = 49/307 (15%)

Query: 100 KVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVL 159
           K +TVG    E +  L +G   ++Y+V+  + TN        S ++ +K      +KR+L
Sbjct: 510 KDITVGPQSFEKIKLLGQGDVGKVYLVR-EKKTNRLYALKIFSKSEMIKRKK---IKRIL 565

Query: 160 VQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNK 219
            + E+                  P +V  + S  S   DY         +   ME C   
Sbjct: 566 AEQEI------------LATSNHPFVVTLYHSFQSE--DY---------LYFCMEYCMGG 602

Query: 220 SLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKL 279
                +  R    ++E +      ++T A+  +H L    I+RD+K EN+L+  + +  L
Sbjct: 603 EFFRALQTRRTKCISEDDARFYASEVTAALEYLHLLG--FIYRDLKPENILLHKSGHIML 660

Query: 280 CDFG----STSTCFP-----AFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPI 327
            DF     +     P     A ++  D  + S     ++   T +Y +PE+I    +   
Sbjct: 661 SDFDLSVQAKDAKVPVMKGSAESTVVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHT-- 718

Query: 328 NEKSDIWALGVFLYKLLFFTTPFERTGQ---FA-MLHSKFEFPPNS-YSSKLINLIIVML 382
               D W LG+ +Y++LF  TPF+ +     F+ +L +   FP N+  S    +LI  +L
Sbjct: 719 -AAVDWWTLGILIYEMLFGFTPFKGSSSNETFSNILKNDVSFPNNNDISRNCKDLIKKLL 777

Query: 383 AENPSLR 389
            +N + R
Sbjct: 778 CKNEAKR 784

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 101/237 (42%), Gaps = 28/237 (11%)

Query: 169  MRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQR 228
            +R E+ V++ L   PN+VQY+     R R           V + ME C   SL       
Sbjct: 1237 IRDEMTVLEMLN-HPNVVQYYGVEVHRDR-----------VNIFMEYCEGGSLASL---- 1280

Query: 229  LATKLTEQEIFKIMYDITL--AVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTS 286
            LA    E E+   +Y + +   +A +H   V   HRDIK EN+L+D N   K  DFG+  
Sbjct: 1281 LAHGRIEDEMVTQVYSLQMLEGLAYLHESGVD--HRDIKPENILLDFNGIIKYVDFGAAK 1338

Query: 287  TCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFF 346
                  +   ++    +   M  TP Y SPE I    Y       DIW+LG  + +++  
Sbjct: 1339 VLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAISGTGYGKFG-SDDIWSLGCVILEMVTG 1397

Query: 347  TTPFERT-GQFAMLHSKFE-----FPP-NSYSSKLINLIIVMLAENPSLRPNIYQVL 396
              P+     Q+A+++         FP  N  S   I  +   L ++P+ R    ++L
Sbjct: 1398 RRPWANLDNQWAIIYQVAAGQIPMFPSKNEMSQAGIKFLSRCLIQDPNQRSTAVELL 1454

>Scas_703.5
          Length = 749

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 127/303 (41%), Gaps = 47/303 (15%)

Query: 92  IEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGS 151
           I+ ++ + K    G +  EV+  L +G F Q+Y VK          K D      +K  S
Sbjct: 327 IKWEYSSTKKRHYGPNDFEVLRLLGKGTFGQVYQVK----------KKDTKRIYAMKVLS 376

Query: 152 PACLKRVLVQ-DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVL 210
               K+V+V+ +EV        + V    + +P IV    S  +             ++ 
Sbjct: 377 ----KKVIVKKNEVAHTIGERNILVTTATKASPFIVGLKFSFQTPT-----------DLY 421

Query: 211 LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVL 270
           L+ +      L  ++ +    + TE+     + ++ LA+  +H     +++RD+K EN+L
Sbjct: 422 LVTDFMSGGELFWHLQKE--GRFTEERAKFYIAELVLALEYLH--DNDIVYRDLKPENIL 477

Query: 271 VDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEK 330
           +DAN N  LCDFG +       T          + +  TT +Y +PE+  L       + 
Sbjct: 478 LDANGNIALCDFGLSKADLKDRT----------NTFCGTT-EYLAPEL--LLDEAGYTKM 524

Query: 331 SDIWALGVFLYKLLFFTTPFERTGQFAMLH----SKFEFPPNSYSSKLINLIIVMLAENP 386
            D W+LGV ++++    +PF       M       K +FP +  S +  + +  +L  NP
Sbjct: 525 VDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNP 584

Query: 387 SLR 389
             R
Sbjct: 585 KHR 587

>Kwal_26.8709
          Length = 829

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 110/255 (43%), Gaps = 42/255 (16%)

Query: 100 KVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVL 159
           K VT G + V   S L EG F ++ +         + + ++ SM+ P +       +  +
Sbjct: 33  KHVTFGPYIVG--STLGEGEFGKVKL--------GWSKTSNSSMDVPKQVAIKLIRRDTI 82

Query: 160 VQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNK 219
            ++     K+  E+  +K L   PNIV        RL +   N      + +++E     
Sbjct: 83  PKNSEKEIKIYREINALKHLN-HPNIV--------RLEEVLQN---SKYIGIVLEYASGG 130

Query: 220 SLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKL 279
               Y+ ++   +L E    ++   +   V  MH     L+HRD+K+EN+L+D N N  +
Sbjct: 131 EFYKYIQKK--RRLKEGPACRLFAQLISGVYYMHSKG--LVHRDLKLENLLLDKNENLLI 186

Query: 280 CDFGSTSTCFPAFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWAL 336
            DFG  +   P            ++  M T   +P Y +PE++   +      K+D+W+ 
Sbjct: 187 TDFGFVNEFLP------------ENELMKTSCGSPCYAAPELVVTARPYEA-RKADVWSC 233

Query: 337 GVFLYKLLFFTTPFE 351
           GV LY +L    P++
Sbjct: 234 GVILYAMLAGYLPWD 248

>Scas_616.10
          Length = 1461

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 100/229 (43%), Gaps = 33/229 (14%)

Query: 175 VMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLT 234
           V+ KL   PN++  ++   ++            E+ L++E      L DY+  +   KL+
Sbjct: 188 VIMKLISHPNVMALYEVWENK-----------SELYLVLEYVDGGELFDYLVSK--GKLS 234

Query: 235 EQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVD-ANNNFKLCDFGSTSTCFPAFT 293
           E+E       I   V+  H   +   HRD+K EN+L+D  N + K+ DFG  +   P   
Sbjct: 235 EKEAVHYFKQIIQGVSYCHSFNI--CHRDLKPENLLLDKKNKSIKIADFGMAALELPN-- 290

Query: 294 SFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERT 353
                 +L        +P Y SPE++    Y      SD+W+ G+ L+ LL    PF   
Sbjct: 291 -----KLLQTSC---GSPHYASPEIVMGKSY--HGGPSDVWSCGIILFALLTGHLPFNDD 340

Query: 354 GQFAML----HSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVLYY 398
               +L      KF   P++ S +  +LI  +L  +PS R    ++L +
Sbjct: 341 NIKKLLLKVQAGKFRM-PSTLSPEAQDLISRILVIDPSKRITTDRILNH 388

>Kwal_23.5290
          Length = 819

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 106/240 (44%), Gaps = 31/240 (12%)

Query: 116 AEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEVEV 175
            +G    +Y+ +  +     E   +E + +P + G    +K++++  +     + +E+ V
Sbjct: 532 GQGASGSVYLAQRTQLPAYGEGGLNEQIGEP-EIGDKVAIKQMILSKQPRKELIVNEILV 590

Query: 176 MKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLA----- 230
           MK  Q   NIV + ++      D          + ++ME     SL D +    A     
Sbjct: 591 MKDSQHK-NIVNFLEAYLKTEDD----------LWVVMEYMEGGSLTDLIENSPANGSSH 639

Query: 231 TKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFP 290
           + LTE +I  I+ +    +  +H   +  IHRDIK +NVL+D     K+ DFG  +    
Sbjct: 640 SPLTEPQIAYIVRETCQGLKFLHDKHI--IHRDIKSDNVLLDNRARVKITDFGFCAKL-- 695

Query: 291 AFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
                      S+   M  TP + +PE++   +Y   +EK D+W+LG+   ++L    P+
Sbjct: 696 -------TDKRSKRATMVGTPYWMAPEVVKQREY---DEKVDVWSLGIMTIEMLEGEPPY 745

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 116/258 (44%), Gaps = 48/258 (18%)

Query: 155 LKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLME 214
           +K+ L  ++V L  +  E++++++L   PNIV + D   S+ + Y           ++ +
Sbjct: 69  IKKALKGNKVQLEALYDELDILQRLH-HPNIVAFKDWFESKDKFY-----------IITQ 116

Query: 215 LCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVL-VDA 273
           L     L D + ++   K TE++  +I+ +I  AV  MH   +  +HRD+K EN+L +D 
Sbjct: 117 LAKGGELFDRILKK--GKFTEEDAVRILVEILSAVKYMHSQNI--VHRDLKPENLLYIDK 172

Query: 274 NNN--FKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQ----YRSPEMIDLFKYIPI 327
           ++     + DFG                 L  D  +   P     Y +PE++    +   
Sbjct: 173 SDESPLVVADFGIAKR-------------LKSDEELLYKPAGSLGYVAPEVLTQDGH--- 216

Query: 328 NEKSDIWALGVFLYKLLFFTTPF--ERTGQFAMLHSKFEFPP-------NSYSSKLINLI 378
            +  DIW++GV  Y LL   + F  ER   F    +  E+P        +S S+K    I
Sbjct: 217 GKPCDIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFI 276

Query: 379 IVMLAENPSLRPNIYQVL 396
           +  L  +PS RP   ++L
Sbjct: 277 LKALNLDPSKRPTAAELL 294

>CAGL0H00979g complement(94328..95527) similar to tr|Q12003
           Saccharomyces cerevisiae YPL236c, hypothetical start
          Length = 399

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 9/157 (5%)

Query: 248 AVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYM 307
           +++    +PV   H+ +   N++  +N    + + GS S       + + +  L ++   
Sbjct: 236 SISTTSVVPVSYSHKMLSPSNIIFSSNGLPIISELGSCSKADVEIKTAKQLNRL-REWVD 294

Query: 308 HTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQ-------FAMLH 360
                Y +PE +DL     ++ K D+W+ G   Y LLF   PFER  Q       +A+  
Sbjct: 295 DNFNSYMAPEFLDLKTNSKLSTKVDVWSFGCICYALLFGMNPFEREEQLYGASIKYAIST 354

Query: 361 SKFEFPPNS-YSSKLINLIIVMLAENPSLRPNIYQVL 396
            KF FP  S YS  ++++I   L  +PS RP++  VL
Sbjct: 355 GKFSFPSQSRYSDSILDIIRSCLQVDPSERPSVSIVL 391

>Kwal_0.96
          Length = 427

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/267 (25%), Positives = 116/267 (43%), Gaps = 49/267 (18%)

Query: 155 LKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLME 214
           LK+ L   +V L  +  E+ +++KL   PNIV++ D   S+ + Y           ++ +
Sbjct: 78  LKKALKGKDVELQMLYDELSILQKLD-HPNIVKFKDWFESKDKFY-----------IVTQ 125

Query: 215 LCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLV--- 271
           L     L D + ++   K TE++  +I+Y I  AV  +H     ++HRD+K EN+L    
Sbjct: 126 LATGGELFDRILKQ--GKFTEEDAVRIVYQILKAVEYLH--SRNIVHRDLKPENLLYLTE 181

Query: 272 DANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQ---YRSPEMIDLFKYIPIN 328
            A++   L DFG                + + D  +H       Y +PE++    +    
Sbjct: 182 AADSQLVLGDFGIAK------------ELKNDDELIHKAAGSMGYVAPEVVTTSGH---G 226

Query: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHS--------KFEFPPNS-YSSKLINLII 379
           +  DIW+LGV  Y LL   +PF        L           F  P  S  S++  + I+
Sbjct: 227 KPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYWSNISNEAKDFIL 286

Query: 380 VMLAENPSLRPNIYQVL---YYLSEVT 403
             L  NP  RP   ++L   + +S+ T
Sbjct: 287 RALTVNPHDRPTATELLQDAWIISKTT 313

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 97/220 (44%), Gaps = 51/220 (23%)

Query: 168 KMRSEVEVMKKL--QGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYM 225
           K+R E+ +MKK   +    +++  D   SR            ++ L++E C    +    
Sbjct: 161 KIRREIAIMKKCDHEHVVKLIEVLDDMKSR------------KIYLVLEYCSKGEVKWCP 208

Query: 226 NQRLATK------LTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKL 279
             +L         LT Q   +I+  + L +  +HY  +  IHRDIK  N+L+  ++  K+
Sbjct: 209 GDQLEAAARGPPLLTFQRTREILRGVVLGLEYLHYQGI--IHRDIKPANLLLSEHDIVKI 266

Query: 280 CDFG----STSTCFPAFTSFQDIAMLS-------QDLYMHTT---PQYRSPEMI---DLF 322
            DFG    S+++  P+  S    ++          DL +  T   P + +PE+    D +
Sbjct: 267 SDFGVSLASSNSGTPSSRSSSSSSVKGVLGAEGPDDLELAKTAGTPAFFAPEICLGSDAY 326

Query: 323 KYIPINEKS------------DIWALGVFLYKLLFFTTPF 350
           + + I+ +S            DIWALGV LY LLF   PF
Sbjct: 327 EKLNIDRQSNPCSGSLISYMIDIWALGVTLYCLLFGKLPF 366

>Scas_651.18
          Length = 371

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 77/150 (51%), Gaps = 22/150 (14%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++ LA+  +H + +  I+RD+K EN+L+D N + K+ DFG     F  +    DI     
Sbjct: 165 EVCLALEYLHSMDI--IYRDLKPENILLDKNGHIKITDFG-----FAKYVP--DITYT-- 213

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFA----ML 359
              +  TP Y +PE++      P N+  D W+ G+ +Y++L   TPF  +        +L
Sbjct: 214 ---LCGTPDYIAPEVVST---KPYNKSVDWWSFGILIYEMLAGYTPFYDSNTMKTYENIL 267

Query: 360 HSKFEFPPNSYSSKLINLIIVMLAENPSLR 389
           + K +F PN +   + +L+  ++ +N + R
Sbjct: 268 NCKLKF-PNFFHDDVKDLLSKLITKNLTER 296

>Scas_653.25
          Length = 666

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 91/195 (46%), Gaps = 25/195 (12%)

Query: 183 PNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATK--LTEQEIFK 240
           PNI++  D       + SG I++      +ME CP+    D+ N  ++    LT +E F 
Sbjct: 329 PNIIETLDI----FYNPSGQISE------IMEWCPH----DFFNIVMSRTHLLTRRETFC 374

Query: 241 IMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAM 300
               +   V  +H L +   HRD+K++N ++  N   KL DFGS +T F    S ++   
Sbjct: 375 YFKQLCNGVRYLHTLGI--AHRDLKLDNCVITYNGILKLIDFGS-ATIFQLNKSTEEKPE 431

Query: 301 LSQDLYMHTTPQYRSPEMIDLFKYIPINEK-SDIWALGVFLYKLLF----FTTPFERTGQ 355
           L     +  +  Y +PE++ L K IP +   +D+W+LG+    ++     +  P      
Sbjct: 432 LIPSRGIVGSDPYLAPEVL-LSKEIPYDASLADVWSLGIIFCAIMLKRFPWRIPLASKDH 490

Query: 356 FAMLHSKFEFPPNSY 370
              L+SK +  P+ Y
Sbjct: 491 NYELYSKPDLEPHDY 505

>Scas_548.6
          Length = 1382

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 101/251 (40%), Gaps = 41/251 (16%)

Query: 156  KRVLVQDEV---GLNKMRSEVEVMKKLQGAP--NIVQYFDSNASRLRDYSGNITQGFEVL 210
            +R+LV   V    L  + SE+++M  L   P  NI+   D        Y      G    
Sbjct: 1156 ERILVDTWVRDRQLGTIPSEIQIMATLNKKPHDNILSLLDFFEDDDYYYIETPVHGETGC 1215

Query: 211  LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVL 270
            +         L D +     T +TE E   I   I   +  +H     ++HRDIK ENV+
Sbjct: 1216 I--------DLFDLI--EFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVI 1263

Query: 271  VDANNNFKLCDFGSTSTC----FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIP 326
            VD+    K+ DFGS +      F  F                 T  Y +PE++    Y  
Sbjct: 1264 VDSKGCVKIIDFGSAAYVKSGPFDVFVG---------------TIDYAAPEVLSGEPY-- 1306

Query: 327  INEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEF-PPNSYSSKLINLIIVMLAEN 385
              +  DIWA+G+ LY ++F   PF    +  +L  + +F   N  S   I LI  +L  +
Sbjct: 1307 EGKPQDIWAIGILLYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRS 1364

Query: 386  PSLRPNIYQVL 396
               RP I ++ 
Sbjct: 1365 VPKRPLIEEIF 1375

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 85/179 (47%), Gaps = 29/179 (16%)

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLAT 231
           E+ VMK  +   NIV + DS   R            ++ ++ME     SL D +   +  
Sbjct: 743 EILVMKGSKHN-NIVNFIDSYLFR-----------GDLWVVMEYMEGGSLTDVVTHCI-- 788

Query: 232 KLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPA 291
            LTE +I  +  +    +  +H   V  IHRDIK +N+L+  N + KL DFG     F A
Sbjct: 789 -LTEGQIGAVSRETLKGLQFLHSKGV--IHRDIKSDNILLSMNGDIKLTDFG-----FCA 840

Query: 292 FTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
             +  ++   +    M  TP + +PE++   +Y P   K DIW+LG+ + +++    P+
Sbjct: 841 QINEVNLKRTT----MVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 892

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 124/274 (45%), Gaps = 35/274 (12%)

Query: 85  PPVAQPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEY---TNEFERKNDE 141
           P ++  +I  K     V    S   +V+    +G    +Y+ +       +N  E  N++
Sbjct: 522 PTMSTAEIMSKLKKVTVNADPSQCFKVIEKAGQGASGSVYLAERTHIPTESNMIELINND 581

Query: 142 SMNQPLKPGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSG 201
            +++P   G    +K++++  +     + +E+ VMK  +   NIV + ++   R  D   
Sbjct: 582 -IDEP-HVGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHK-NIVNFLEAYL-RTDD--- 634

Query: 202 NITQGFEVLLLMELCPNKSLLDYM-----NQRLATKLTEQEIFKIMYDITLAVAQMHYLP 256
                 ++ ++ME     SL D +     N    + LTE +I  I+ +    +  +H   
Sbjct: 635 ------DLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKH 688

Query: 257 VPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSP 316
           +  IHRDIK +NVL+D     K+ DFG     F A  + +     S+   M  TP + +P
Sbjct: 689 I--IHRDIKSDNVLLDTRARVKITDFG-----FCARLTDKR----SKRATMVGTPYWMAP 737

Query: 317 EMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
           E++   +Y   +EK D+W+LG+   ++L    P+
Sbjct: 738 EVVKQREY---DEKIDVWSLGIMTIEMLEGEPPY 768

>YKL048C (ELM1) [3211] chr11 complement(346859..348781)
           Serine/threonine protein kinase that regulates
           pseudohyphal growth [1923 bp, 640 aa]
          Length = 640

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 86/180 (47%), Gaps = 29/180 (16%)

Query: 240 KIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNF-KLCDFGSTSTCF--PAFTSFQ 296
           KI+ D+T  +  +H      IHRDIK  N+L+D      KL DFGS   C   P    F 
Sbjct: 238 KILEDMTKGLEYLH--SQGCIHRDIKPSNILLDEEEKVAKLSDFGS---CIFTPQSLPFS 292

Query: 297 DIAMLSQDLY------MHTTPQYRSPEMIDL----FKYIPINEKSDIWALGVFLYKLLFF 346
           D     +D +      +  TP + +PE+  L      ++    K DIW+LGV LY LL+ 
Sbjct: 293 DANF--EDCFQRELNKIVGTPAFIAPELCHLGNSKRDFVTDGFKLDIWSLGVTLYCLLYN 350

Query: 347 TTPFERTGQFAMLHSKFEFPPNSYSSKL----INLIIV--MLAENPSLRPNIYQVLYYLS 400
             PF    +F   H   E    S SSK+    +N +++  +L ++ +LR +I  ++  LS
Sbjct: 351 ELPFFGENEFETYHKIIEV---SLSSKINGNTLNDLVIKRLLEKDVTLRISIQDLVKVLS 407

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 91/200 (45%), Gaps = 26/200 (13%)

Query: 152 PACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLL 211
           P C K  L   ++       EV +  K    PN+++  D N S+  +Y         + +
Sbjct: 50  PTCKKMGLSDKDI-----TKEVVLQSKCSKHPNVLRLIDCNVSK--EY---------MWI 93

Query: 212 LMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLV 271
           ++E+     L D +   +     + ++ +  +   ++     ++   + HRDIK EN+L+
Sbjct: 94  ILEMADGGDLFDKIEPDVGV---DSDVAQFYFQQLVSAINYLHVECGVAHRDIKPENILL 150

Query: 272 DANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKS 331
           D N N KL DFG  S     F        +S D     +P Y +PE++   +     +++
Sbjct: 151 DKNGNLKLADFGLAS----QFRRKDGTLRVSMD--QRGSPPYMAPEVL-YSEEGYYADRT 203

Query: 332 DIWALGVFLYKLLFFTTPFE 351
           DIW++G+ L+ LL   TP+E
Sbjct: 204 DIWSIGILLFVLLTGQTPWE 223

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 96/206 (46%), Gaps = 30/206 (14%)

Query: 150 GSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEV 209
           G    +K++++  +     + +E+ VMK  Q   NIV + ++      D          +
Sbjct: 539 GDKVAIKQMILSKQPRKELIVNEILVMKDSQHK-NIVNFLEAYLKTEDD----------L 587

Query: 210 LLLMELCPNKSLLDYMNQRLATK-----LTEQEIFKIMYDITLAVAQMHYLPVPLIHRDI 264
            ++ME     SL D +   + +      +TE +I  I+ +    +  +H   +  IHRDI
Sbjct: 588 WVVMEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFLHDKHI--IHRDI 645

Query: 265 KIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKY 324
           K +NVL+D +   K+ DFG     F A  + +     S+   M  TP + +PE++   +Y
Sbjct: 646 KSDNVLLDTHGRVKITDFG-----FCAKLTDKR----SKRATMVGTPYWMAPEVVKQREY 696

Query: 325 IPINEKSDIWALGVFLYKLLFFTTPF 350
              +EK D+W+LG+   ++L    P+
Sbjct: 697 ---DEKVDVWSLGIMTIEMLEGEPPY 719

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/248 (22%), Positives = 107/248 (43%), Gaps = 26/248 (10%)

Query: 155 LKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLME 214
           L  V+    V L     EVE++     A  I    +  +  + +Y   + +   + + ME
Sbjct: 27  LNEVVAVKVVNLENSEEEVELL-----AQEIFFLAELKSPYVTNYIATVVEDVSMWIAME 81

Query: 215 LCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDAN 274
            C   S+ D +     + L E +   I  +I   ++ +H      IHRDIK  N+L+   
Sbjct: 82  YCGGGSVGDLLKYHYTSGLPEHKTRFITREILKGLSYLH--SQRKIHRDIKAANILLTDE 139

Query: 275 NNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMI--DLFKYIPINEKSD 332
              KL DFG +     +F          +D ++  TP + +PE++  D   Y   +E++D
Sbjct: 140 GKVKLSDFGVSGKLLSSF---------RRDTFV-GTPYWMAPEIVAHDSEGY---DERAD 186

Query: 333 IWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPP----NSYSSKLINLIIVMLAENPSL 388
           IW+LG+ + ++L  + P  +     ++ +  +  P      +S    + + + L +  ++
Sbjct: 187 IWSLGITVIEMLRGSPPLSKYDPMKVIANLPKRKPPKLHGDFSDDAKHFVALCLIKESAI 246

Query: 389 RPNIYQVL 396
           RP    +L
Sbjct: 247 RPTAADLL 254

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 80/150 (53%), Gaps = 22/150 (14%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++ LA+  +H     +I+RD+K EN+L+D N + KL DFG     F  +    D+     
Sbjct: 182 EVCLALEYLH--SKDIIYRDLKPENILLDKNGHIKLTDFG-----FAKYVP--DVTYT-- 230

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF---ERTGQFA-ML 359
              +  TP Y +PE++      P N+  D W+ G+ +Y++L   TPF      G +  +L
Sbjct: 231 ---LCGTPDYIAPEVVST---KPYNKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYENIL 284

Query: 360 HSKFEFPPNSYSSKLINLIIVMLAENPSLR 389
           +++ +FPP  +++K+ +L+  ++  + S R
Sbjct: 285 NAEVKFPP-FFNAKVRDLLSQLITRDLSKR 313

>Sklu_2086.4 , Contig c2086 6437-7168 reverse complement
          Length = 243

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 49/170 (28%), Positives = 79/170 (46%), Gaps = 22/170 (12%)

Query: 229 LATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTC 288
           L T +TE E   I   +   +  +H     ++HRDIK EN++VD     KL DFGS +  
Sbjct: 85  LKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVKLIDFGSAAY- 141

Query: 289 FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMI--DLFKYIPINEKSDIWALGVFLYKLLFF 346
                    +     D+++ T   Y +PE++  D ++  P     DIWA+GV LY ++F 
Sbjct: 142 ---------VKSGPFDVFVGTI-DYAAPEVLGGDPYEGKP----QDIWAIGVLLYTIIFK 187

Query: 347 TTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPSLRPNIYQV 395
             PF    +  +L        + + S + I LI  +L  +   RP I ++
Sbjct: 188 ENPFYNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPTIEEI 235

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 118/290 (40%), Gaps = 47/290 (16%)

Query: 105 GSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQ-DE 163
           G    EV+  L +G F Q+Y V          RK D      +K  S    K+V+V+ +E
Sbjct: 300 GPQDFEVLRLLGKGTFGQVYQV----------RKKDTKRIYAMKVLS----KKVIVKKNE 345

Query: 164 VGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLD 223
           +        + V    +  P IV               +     ++ L+ +      L  
Sbjct: 346 IAHTIGERNILVRTASKSCPFIV-----------GLKFSFQTPTDLYLVTDFLSGGELFW 394

Query: 224 YMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFG 283
           ++ +    + TE+     + ++ LA+  +H     +++RD+K EN+L+DAN N  LCDFG
Sbjct: 395 HLQKE--GRFTEERAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFG 450

Query: 284 STSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKL 343
            +       T          + +  TT +Y +PE+  L       +  D W+LGV ++++
Sbjct: 451 LSKADLKDRT----------NTFCGTT-EYLAPEL--LLDETGYTKMVDFWSLGVLIFEM 497

Query: 344 LFFTTPFERTGQFAMLH----SKFEFPPNSYSSKLINLIIVMLAENPSLR 389
               +PF       M       K +FP +  S +  + +  +L  NP  R
Sbjct: 498 CCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHR 547

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 124/280 (44%), Gaps = 58/280 (20%)

Query: 154 CLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLM 213
            LKR L  +E  L  +  E+ +++KL   PNIV++ D   SR + Y           ++ 
Sbjct: 87  LLKRALKGNE--LQMLYDELSILQKLD-HPNIVKFKDWFESREKFY-----------IVT 132

Query: 214 ELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVL-VD 272
           +L     L D + ++   K TE +  KI+  +  AV  MH   V  +HRD+K ENVL +D
Sbjct: 133 QLATGGELFDRILKK--GKFTETDAVKIVVQMLTAVEYMHSQNV--VHRDLKPENVLYLD 188

Query: 273 ANNNFKLC--DFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQ---YRSPEMIDLFKYIPI 327
            ++  +L   DFG                + S+   +H       Y +PE++    +   
Sbjct: 189 PSDESQLVISDFGIAKQ------------LSSESQLIHRAAGSMGYVAPEVLTTSGH--- 233

Query: 328 NEKSDIWALGVFLYKLLFFTTPF--ERTGQF----------AMLHSKFEFPPNSYSSKLI 375
            +  DIW+LGV  Y LL   +PF  E T  F             HS +    N+ S +  
Sbjct: 234 GKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYW---NNISKEAK 290

Query: 376 NLIIVMLAENPSLRPNIYQVL---YYLSEVTNR-EVPPTV 411
             I+  L   P+ RP   ++L   + +S+ +N  ++ PT+
Sbjct: 291 QFILRALTLTPARRPTAAELLTDRWIVSKQSNTADLLPTI 330

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 72/151 (47%), Gaps = 11/151 (7%)

Query: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268
           +  L+E  PN   L  M +  +  L+E         I   +  +H   +  IHRDIK EN
Sbjct: 256 LYFLLEYAPNGDFLSVMKKYGS--LSEDCTRYYSAQIIDGIKYLHSKGI--IHRDIKPEN 311

Query: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQ--DIAMLSQDLYMHTTPQYRSPEMI-DLFKYI 325
           +L+D +   K+ DFG+     P        +  +L++      T +Y SPE++ D +   
Sbjct: 312 ILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDSY--- 368

Query: 326 PINEKSDIWALGVFLYKLLFFTTPFERTGQF 356
            ++ + DIWA G  +++++    PF+ T ++
Sbjct: 369 -VDARCDIWAFGCMVFQMIAGKPPFKATNEY 398

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 95/213 (44%), Gaps = 44/213 (20%)

Query: 160 VQDEVGLNKMRSEVEVMKKL--QGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCP 217
           ++DE    K++ E+ +MKK   +    +++  D   SR            ++ L++E C 
Sbjct: 169 IEDE----KIKREIAIMKKCHHEHVVKLIEVLDDAKSR------------KIYLVLEYCS 212

Query: 218 NKSLLDYMNQRLATK------LTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLV 271
              +       + TK      L+ Q   +I   + L +  +H+  +  IHRDIK  N+L+
Sbjct: 213 KGEIKWCPGDVIETKARGPPLLSFQRTREIFRGVLLGLEYLHFQGI--IHRDIKPANLLL 270

Query: 272 DANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHT--TPQYRSPEM------IDLFK 323
             +   K+ DFG +     AF+S      L++     T  TP + +PE+      I  F 
Sbjct: 271 SEDGIVKISDFGVSL----AFSSDSSTDSLNELELAKTAGTPAFFAPEICLVEDTIKKFD 326

Query: 324 YIP------INEKSDIWALGVFLYKLLFFTTPF 350
             P      I+  +DIWA+G+ L+ LLF   PF
Sbjct: 327 LDPNSKEPIISFPTDIWAMGITLHCLLFGMLPF 359

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 96/201 (47%), Gaps = 29/201 (14%)

Query: 152 PACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLL 211
           P+C K+ + Q++V    +R EV++  +     N+++  D N          ++  F + +
Sbjct: 50  PSCEKQGMSQEDV----LR-EVKLHSRCSNFVNVLKVIDCN----------LSDPF-LWI 93

Query: 212 LMELCPNKSLLDYMNQRLATKLTEQEIFKIMY-DITLAVAQMHYLPVPLIHRDIKIENVL 270
            MEL     L D +   +     + E+ +  Y  +  A++ +H     + HRDIK EN+L
Sbjct: 94  AMELAEGGDLFDKIEPDIGV---DSEVAQFYYKQLIKAISYLHD-TCGVAHRDIKPENIL 149

Query: 271 VDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEK 330
           +D + N KL DFG  S     F        +S+D     +  Y +PE+I    Y    + 
Sbjct: 150 LDKDGNLKLADFGLASL----FKRKDGSKRISRD--QRGSLPYMAPEIIYCDGYYA--DM 201

Query: 331 SDIWALGVFLYKLLFFTTPFE 351
           +DIW++GV L+ LL   TP+E
Sbjct: 202 TDIWSIGVLLFVLLTGETPWE 222

>KLLA0B11946g complement(1048033..1049352) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, start by similarity
          Length = 439

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 75/181 (41%), Gaps = 22/181 (12%)

Query: 163 EVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLL 222
           E+ L +   E++ M   +G  NIV   D        YSG             L   + L+
Sbjct: 114 EILLKRAIRELKFMSYFKGHRNIVSLIDLEIVNEEPYSG-------------LYCYQELV 160

Query: 223 DYMNQRLA---TKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKL 279
           DY   R+       +E  I   +Y I   +  +H   V  IHRD+K  N+L       K+
Sbjct: 161 DYDLARVIHSNVLFSEFHIKHFLYQILCGMKYIHSADV--IHRDLKPGNILCSITGEIKI 218

Query: 280 CDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVF 339
           CDFG      P+FT    I+    +     T  YR+PE+I    +   ++  D+WA+G  
Sbjct: 219 CDFGLARGISPSFTVAGGISNHITNYV--ATRWYRAPELI--LSHKRYSKSVDMWAVGCI 274

Query: 340 L 340
           L
Sbjct: 275 L 275

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 124/303 (40%), Gaps = 47/303 (15%)

Query: 92  IEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGS 151
           I  ++ + K    G    EV+  L +G F Q+Y V          RK D      +K  S
Sbjct: 308 IHWEYTSTKKRQYGPQDFEVLRLLGKGTFGQVYQV----------RKKDTMRIYAMKVLS 357

Query: 152 PACLKRVLVQ-DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVL 210
               K+V+V+ +E+        + V    + +P IV               +     ++ 
Sbjct: 358 ----KKVIVKKNEIAHTIGERNILVRTASKSSPFIV-----------GLKFSFQTPTDLY 402

Query: 211 LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVL 270
           L+ +      L  ++ +    + TE      + ++ LA+  +H     +++RD+K EN+L
Sbjct: 403 LVTDFMSGGELFWHLQKE--GRFTEDRAKFYIAELVLALEYLH--DNDIVYRDLKPENIL 458

Query: 271 VDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEK 330
           +DAN N  LCDFG +       T          + +  TT +Y +PE+  L       + 
Sbjct: 459 LDANGNIALCDFGLSKADLKDRT----------NTFCGTT-EYLAPEL--LMDETGYTKM 505

Query: 331 SDIWALGVFLYKLLFFTTPFERTGQFAMLH----SKFEFPPNSYSSKLINLIIVMLAENP 386
            D W+LGV ++++    +PF  +    M       K +FP +  S +  + +  +L  NP
Sbjct: 506 VDFWSLGVLIFEMCCGWSPFFASDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNP 565

Query: 387 SLR 389
             R
Sbjct: 566 KHR 568

>KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces
           cerevisiae YAR018c KIN3 ser/thr protein kinase,
           hypothetical start
          Length = 394

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 119/292 (40%), Gaps = 77/292 (26%)

Query: 157 RVLVQDEVGLNKMR--------SEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208
           +V+V+ EV    M         SE  ++ +L+   NIV++F  +     D   N      
Sbjct: 34  KVMVRKEVRYGHMNAKERQQLISECAILSQLK-HDNIVEFFHWD----HDAKSNT----- 83

Query: 209 VLLLMELCPNKSLLD----YMNQRLATKLTEQEIFKIMYDITLAVAQMHY---------- 254
           + L ME C    L      Y +QR    + E+ +++IM  I +A+ + HY          
Sbjct: 84  LFLYMEYCSKGDLSQMIRYYKHQR--KYVPEEYVWRIMVQILMALFKCHYGRDLSKLQTI 141

Query: 255 ---LPVPL-------IHRDIKIENVLVDANNN---------------FKLCDFGSTSTCF 289
              +  PL       IHRD+K  N+ +   ++                KL DFG   +  
Sbjct: 142 YDAMEEPLKSKGYVVIHRDLKPGNIFLTGYDDEFNQNASDVDYSKVIIKLGDFGLAKS-L 200

Query: 290 PAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTP 349
            A   F    +         TP Y SPE++    Y P+   SDIW+LG  LY+L     P
Sbjct: 201 QASIEFATTYV--------GTPYYMSPEVLRDQPYSPL---SDIWSLGCILYELCSLHVP 249

Query: 350 FERTGQFAMLHSK-----FEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVL 396
           F+    +  L  K     FE  P+ YS  L ++I   +  + + RP+ + +L
Sbjct: 250 FQ-AKTYTELQGKVKAGYFEPLPHFYSKNLQDIITRCIQVDFTKRPSTWSLL 300

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 94/204 (46%), Gaps = 42/204 (20%)

Query: 166 LNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYM 225
           +N++  E+ ++K ++   NI+ ++ +       Y+ +I    E+++LME     SL   +
Sbjct: 232 INQLVRELSIVKNVKPHENIITFYGAY------YNQHINN--EIIILMEYSDCGSLDKIL 283

Query: 226 N--QRLA---------TKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDAN 274
           +  +R           T   E  I KI Y +   +  + Y    +IHRDIK  NVL+++ 
Sbjct: 284 SVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHL-YRQYKIIHRDIKPSNVLINSK 342

Query: 275 NNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIW 334
              KLCDFG +     +            D ++ T+  Y SPE I    Y   + K D+W
Sbjct: 343 GQIKLCDFGVSKKLINSIA----------DTFVGTST-YMSPERIQGNVY---SIKGDVW 388

Query: 335 ALGVFLYKLLFFTTPFERTGQFAM 358
           +LG+ + +L+        TG+F +
Sbjct: 389 SLGLMIIELV--------TGEFPL 404

>Kwal_33.13846
          Length = 375

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 21/132 (15%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++ LA+  +H     +I+RD+K ENVL+D N + K+ DFG     F  F    D+     
Sbjct: 171 EVCLALEYLH--AQDIIYRDLKPENVLLDKNGHVKITDFG-----FAKFVP--DVTYT-- 219

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFA----ML 359
              +  TP Y +PE++      P N+  D W+ G+ ++++L   TPF  +        +L
Sbjct: 220 ---LCGTPDYIAPEVVST---KPYNKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENIL 273

Query: 360 HSKFEFPPNSYS 371
           +++ +FPP  +S
Sbjct: 274 NAELQFPPFFHS 285

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 111/252 (44%), Gaps = 34/252 (13%)

Query: 148 KPGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGF 207
           K      +K V  QD+  L  + SE++++K L    NIV+Y            G I +  
Sbjct: 43  KTAQEVAIKEVNYQDDDELVDIMSEIDLLKNLNHI-NIVKY-----------HGFIQKQH 90

Query: 208 EVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267
            + +++E C   SL + +++     ++E E    +      +  +H   V  IHRDIK  
Sbjct: 91  NLYIILEYCAKGSLKNLISRN--RPMSEHEAKPYVRQTLNGLNYLHEQGV--IHRDIKAA 146

Query: 268 NVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPI 327
           N+L+D+ N  KL DFG +       T   + AM      +  +  + +PE+I        
Sbjct: 147 NILLDSENVVKLADFGVS-------TKVNNTAMT-----LAGSLNWMAPEIIG---NRGA 191

Query: 328 NEKSDIWALGVFLYKLLFFTTPFER---TGQFAMLHSKFEFPPNSYSSKLINLIIVMLAE 384
           +  SDIW+LG  + +LL    PF        +  + +   FPP+S SS   + +    A+
Sbjct: 192 STLSDIWSLGATVVELLTGNPPFHNLIDMNIYYAIENDSYFPPSSLSSGAKDFLQQCFAK 251

Query: 385 NPSLRPNIYQVL 396
           N   RP   Q+L
Sbjct: 252 NMYKRPTAVQLL 263

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 66/128 (51%), Gaps = 21/128 (16%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++ LA+  +H     +I+RD+K EN+L+D N + K+ DFG     F  +    D+     
Sbjct: 194 EVCLALEYLH--SKDIIYRDLKPENILLDKNGHIKITDFG-----FAKYVP--DVTYT-- 242

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFA----ML 359
              +  TP Y +PE++      P N+  D W+ GV +Y++L   TPF  +        +L
Sbjct: 243 ---LCGTPDYIAPEVVST---KPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENIL 296

Query: 360 HSKFEFPP 367
           +++ +FPP
Sbjct: 297 NAELKFPP 304

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 65/128 (50%), Gaps = 21/128 (16%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++ LA+  +H     +I+RD+K EN+L+D N + K+ DFG     F  +    D+     
Sbjct: 193 EVCLALEYLH--SKDIIYRDLKPENILLDKNGHIKITDFG-----FAKYVP--DVTYT-- 241

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQF----AML 359
              +  TP Y +PE++      P N+  D W+ G+ +Y++L   TPF  +        +L
Sbjct: 242 ---LCGTPDYIAPEVVST---KPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKIL 295

Query: 360 HSKFEFPP 367
           +++  FPP
Sbjct: 296 NAELRFPP 303

>Scas_720.94
          Length = 1683

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 89/224 (39%), Gaps = 36/224 (16%)

Query: 147  LKPGSPACLKRVLVQDEVGLNKM----RSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGN 202
            L  G    +K + +QD   + K+    + E+ V++ L   PNIVQY+     R +     
Sbjct: 1381 LDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEML-NHPNIVQYYGVEVHRDK----- 1434

Query: 203  ITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHR 262
                  V + ME C   S    M   L     E E+   +Y + L     +     ++HR
Sbjct: 1435 ------VNIFMEYCEGGS----MASLLEHGRIEDEMVTQVYTLELLEGLAYLHQAGVVHR 1484

Query: 263  DIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLY---------------- 306
            DIK EN+L+D N   K  DFG+        T   +I   S+D                  
Sbjct: 1485 DIKPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEGGANSVHD 1544

Query: 307  MHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
            M  TP Y +PE I  +K        DIW+ G  + +++    P+
Sbjct: 1545 MLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPW 1588

>Kwal_23.6458
          Length = 868

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 107/266 (40%), Gaps = 48/266 (18%)

Query: 100 KVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERK--NDESMNQPLKPGSPACLKR 157
           K V VG    E +  L +G   ++Y+VK  +    +  K  + E M +  K      +KR
Sbjct: 455 KEVIVGPQSFEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEMIKRKK------IKR 508

Query: 158 VLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCP 217
           +L + E+                  P IV  + S  S   DY         + L ME C 
Sbjct: 509 ILAEQEI------------LATSNHPFIVTLYHSFQSE--DY---------LYLCMEYCM 545

Query: 218 NKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNF 277
                  +  R    + E +      ++  A+  +H +    I+RD+K EN+L+  + + 
Sbjct: 546 GGEFFRALQTRKTKCIDEDDARFYSSEVVAAIEYLHLMG--FIYRDLKPENILLHKSGHI 603

Query: 278 KLCDFG----STSTCFP-----AFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYI 325
            L DF     +  T  P     A +S  D  + S     ++   T +Y +PE+I    + 
Sbjct: 604 MLSDFDLSVQAKDTKNPVVKGSAQSSLLDTKICSDGFRTNSFVGTEEYIAPEVIRGNGH- 662

Query: 326 PINEKSDIWALGVFLYKLLFFTTPFE 351
                 D W LG+ +Y++LF  TP++
Sbjct: 663 --TAAVDWWTLGILIYEMLFGFTPYK 686

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 82/194 (42%), Gaps = 44/194 (22%)

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLAT 231
           EV++  K+    NI + +D                F+  ++ME C    L + +   +  
Sbjct: 116 EVDIQTKIGKHKNITELYDF---------------FDSYIIMEYCSGGDLYEAIKDDMVP 160

Query: 232 KLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPA 291
           + T + +  I+  I  AV  +H   +   HRDIK EN+L+  N N KL D+G  +T    
Sbjct: 161 RKT-KNVTNIINQILDAVEYVHSRGI--YHRDIKPENILIAGNWNIKLTDWGLATT---- 213

Query: 292 FTSFQDIAMLSQDLYMHTTPQYRSPEMI----------DLFKYIPINEKSDIWALGVFLY 341
                D   + +++    + +Y +PE+           D +       K DIWA+G+ + 
Sbjct: 214 -----DKTSMERNV---GSERYMAPELFESNLDREERTDAYDC----AKVDIWAIGIVML 261

Query: 342 KLLFFTTPFERTGQ 355
            ++F   PF    Q
Sbjct: 262 NIVFHKNPFTVANQ 275

>Kwal_26.7355
          Length = 1446

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 108/258 (41%), Gaps = 38/258 (14%)

Query: 161  QDEVGLN---KMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCP 217
            QDE  L+    +RSEV  +K L    NIVQY            G   + +   L +E   
Sbjct: 1185 QDETTLSVLEALRSEVATLKDLDHT-NIVQYL-----------GFENKNYVYSLFLEYVA 1232

Query: 218  NKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNF 277
              S+   +  RL  K  E  I  +   +   ++ +H   +  +HRD+K +N+L+D +   
Sbjct: 1233 GGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLHSKKI--LHRDMKADNLLLDVDGIC 1288

Query: 278  KLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALG 337
            K+ DFG +      ++        + D+ M  T  + +PEM+D  +    + K DIW+LG
Sbjct: 1289 KISDFGISKKSNNIYS--------NSDMTMRGTVFWMAPEMVDTKQ--GYSAKVDIWSLG 1338

Query: 338  VFLYKLLFFTTPFERTGQFAMLHSKFEF---PPNSYSSKLI------NLIIVMLAENPSL 388
              + ++     P+      A +    +F   PP    ++ I        +      NP  
Sbjct: 1339 CVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKEFLDACFEINPEK 1398

Query: 389  RPNIYQVLYYLSEVTNRE 406
            RP   ++L +   + ++E
Sbjct: 1399 RPTADELLSHPFCIVDKE 1416

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 70/151 (46%), Gaps = 21/151 (13%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++  A+  +H L V  I+RD+K EN+L+D   +  LCDFG    C         + M  Q
Sbjct: 495 ELLCALETLHSLNV--IYRDLKPENILLDYQGHIALCDFG---LC--------KLNMKDQ 541

Query: 304 DL--YMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHS 361
           D       TP+Y +PE++    Y  +    D W LGV LY++L    P+       M   
Sbjct: 542 DKTNTFCGTPEYLAPELLLGQGYSKV---VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKK 598

Query: 362 KFEFP---PNSYSSKLINLIIVMLAENPSLR 389
             + P   P+ +  +  NL+I +L  +P  R
Sbjct: 599 ILQEPLRFPDGFDREAKNLLIELLCRDPKRR 629

>YDL028C (MPS1) [834] chr4 complement(400994..403288)
           Multi-functional serine/threonine/tyrosine protein
           kinase involved in mitotic checkpoint, spindle pole body
           duplication in meiosis and mitosis, and proper
           chromosome segregation in meiosis [2295 bp, 764 aa]
          Length = 764

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/324 (22%), Positives = 130/324 (40%), Gaps = 72/324 (22%)

Query: 101 VVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLV 160
           ++TV   + E +  L  GG +++Y VK              S N+         LKRV  
Sbjct: 432 IITVNDSQYEKIELLGRGGSSRVYKVK-------------GSGNRVY------ALKRVSF 472

Query: 161 Q--DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPN 218
              D+  ++  + E+E+++KL+    ++Q        L DY      G  +L L+  C +
Sbjct: 473 DAFDDSSIDGFKGEIELLEKLKDQKRVIQ--------LLDYE----MGDGLLYLIMECGD 520

Query: 219 KSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFK 278
             L   +NQR    L    +     ++ L +  +H     ++H D+K  N ++      K
Sbjct: 521 HDLSQILNQRSGMPLDFNFVRFYTKEMLLCIKVVH--DAGIVHSDLKPANFVL-VKGILK 577

Query: 279 LCDFGSTSTCFPAFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYI---------- 325
           + DFG  +   P  T          ++Y  T   TP Y +PE +    Y           
Sbjct: 578 IIDFG-IANAVPEHTV---------NIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGN 627

Query: 326 --PINEKSDIWALGVFLYKLLFFTTPFER-TGQFAML-----HSKFEFPPNSYSSK---- 373
              +   SD+W+ G  +Y++++   P+    GQ  +L       K  FP ++ +++    
Sbjct: 628 KWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPK 687

Query: 374 -LINLIIVMLAENPSLRPNIYQVL 396
             I L+   L  NP  R  + +VL
Sbjct: 688 SAIELMKACLYRNPDKRWTVDKVL 711

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 70/142 (49%), Gaps = 27/142 (19%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++ LA+  +H     +I+RD+K EN+L+D N + KL DFG     F  +    D+     
Sbjct: 251 EVCLALEYLH--SKGIIYRDLKPENILLDKNGHIKLTDFG-----FAKYVP--DVTYT-- 299

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFA----ML 359
              +  TP Y +PE++      P N+  D W+ GV +Y++L   TPF  +        +L
Sbjct: 300 ---LCGTPDYIAPEVVST---KPYNKSVDWWSFGVLIYEMLAGYTPFYDSNTIKTYENIL 353

Query: 360 HSKFEFPPNSYS------SKLI 375
           ++   FPP  +S      SKLI
Sbjct: 354 NAPVRFPPFFHSDAQDLISKLI 375

>KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces
           cerevisiae YDL028c MPS1 serine/threonine/tyrosine
           protein kinase, hypothetical start
          Length = 793

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 75/326 (23%), Positives = 129/326 (39%), Gaps = 73/326 (22%)

Query: 98  AGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKR 157
           A   +TV     E V  L +GG  ++Y VK  ++                       LKR
Sbjct: 461 AVPTITVNGTAYEKVELLGKGGSGKVYKVKSSDH-------------------KVYALKR 501

Query: 158 VLVQ--DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMEL 215
           V     DE  ++  + E+E++KKL+    +V        +L DY  ++ QG  VL L+  
Sbjct: 502 VSFDEFDESSIDGFKGEIELLKKLENKQRVV--------KLIDY--HMGQG--VLFLLME 549

Query: 216 CPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANN 275
           C    L   + QR       + +     ++   V  +H     ++H D+K  N  V    
Sbjct: 550 CGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVH--DADIVHSDLKPAN-FVFVKG 606

Query: 276 NFKLCDFGSTSTCFPAFTS--FQDIAMLSQDLYMHTTPQYRSPEMIDLFKYI-------- 325
             K+ DFG  +   P  T   ++D  +         TP Y +PE +    +         
Sbjct: 607 MLKIIDFG-IANAVPDHTVNIYRDNQI--------GTPNYMAPETLVAMNFTRNDGEQAK 657

Query: 326 -PINEKSDIWALGVFLYKLLFFTTPFERTGQF-------AMLHSKFEFP---PNSYSS-- 372
             + + SD+W+ G  LY++++   P+   G F       A+++   + P    +S+ +  
Sbjct: 658 WKVGKPSDVWSCGCILYQMVYGKPPY---GTFQGNNRLYAIMNPDVKIPYPEKDSFGTVI 714

Query: 373 --KLINLIIVMLAENPSLRPNIYQVL 396
              +I+ I   L  NP  R  I Q+L
Sbjct: 715 PRTVIDTIRSCLERNPISRVTIDQLL 740

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (50%), Gaps = 21/128 (16%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++ LA+  +H     +I+RD+K EN+L+D N + K+ DFG            +++  ++ 
Sbjct: 176 EVILALEYLH--AHNIIYRDLKPENILLDRNGHIKITDFGFA----------KEVQTVTW 223

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQF----AML 359
            L    TP Y +PE+I      P N+  D W+LGV +Y++L   TPF  T        +L
Sbjct: 224 TLC--GTPDYIAPEVITT---KPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKIL 278

Query: 360 HSKFEFPP 367
             K  +PP
Sbjct: 279 QGKVVYPP 286

>YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine protein
            kinase of unknown function [3306 bp, 1101 aa]
          Length = 1101

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 76/168 (45%), Gaps = 26/168 (15%)

Query: 233  LTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTC---- 288
            + E E   +   +  ++  +H     ++HRDIK ENV+VD++   KL DFGS +      
Sbjct: 947  MVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHGFVKLIDFGSAAYIKSGP 1004

Query: 289  FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTT 348
            F  F    D               Y +PE++    Y    +  DIWALGV LY +++   
Sbjct: 1005 FDVFVGTMD---------------YAAPEVLGGSSY--KGKPQDIWALGVLLYTIIYKEN 1047

Query: 349  PFERTGQFAMLHSKFEFPPNSY-SSKLINLIIVMLAENPSLRPNIYQV 395
            P+    +  +L  +  F  + + S + I+LI  +L      RP I ++
Sbjct: 1048 PYYNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDEI 1093

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 84/191 (43%), Gaps = 37/191 (19%)

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLAT 231
           EV++  K+    NI + +D                F+  ++ME C    L + +      
Sbjct: 107 EVDIQSKIGKHKNITELYDY---------------FDSYIIMEYCSGGDLYEAIKADTIP 151

Query: 232 KLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLV-DANNNFKLCDFGSTSTCFP 290
           + T Q +  I+  I  AV  +H     + HRDIK EN+L+ D+N   KL D+G  +T   
Sbjct: 152 RKTRQ-LTHIISQILDAVEFVH--SKGIYHRDIKPENILIADSNWTVKLTDWGLATT--- 205

Query: 291 AFTSFQDIAMLSQDLYMHTTPQYRSPEMIDL-FKYIPINE-----KSDIWALGVFLYKLL 344
                 D   + +++    + +Y +PE+ +    Y   NE     K DIWA+G+ L  ++
Sbjct: 206 ------DQTSMDRNV---GSERYMAPELFESNLDYDERNEPYECSKVDIWAIGIVLLNIV 256

Query: 345 FFTTPFERTGQ 355
           F   PF    Q
Sbjct: 257 FHKNPFSVANQ 267

>AFL143C [3052] [Homologous to ScYPL236C - SH] (164241..165326)
           [1086 bp, 361 aa]
          Length = 361

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 79/343 (23%), Positives = 125/343 (36%), Gaps = 80/343 (23%)

Query: 102 VTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQ 161
           +TV   R  V   L++ G   IY V+ ++     +R N              C+K V   
Sbjct: 24  ITVNGKRYLVTGLLSDKGLTMIYKVRSLQRE---QRGN-------------FCIKAV--- 64

Query: 162 DEVGLNKMRSEVEVMKKLQG-----APNIVQYFDSNASRLRDYSGNITQGFE-VLLLMEL 215
                 +     E M+++       +P I    DS    L        QG + V ++++ 
Sbjct: 65  -HCPFGRAEHVAEAMREIDNYQAFHSPYITSLLDSQIVPLE-------QGSKLVYMVLQY 116

Query: 216 CPNKSLLDYMNQRLA--TKLTEQEIFKIMYDITLAVAQMH------------------YL 255
            P  SL   ++  L     L E  +  +M ++  AV  +H                  +L
Sbjct: 117 FPTGSLQQLIDTTLVEGVPLPEPRVLALMVEVCRAVRAVHQPGDEGVESGSATQSEDTHL 176

Query: 256 PVPLIHRDIKIENVLVDANNNFKLCDF---------------GSTSTCFP---AFTSFQD 297
               +  D+ +E        +F LCD                   S C     A  +   
Sbjct: 177 LADALEMDV-LEASTSSPRRSFVLCDLRPSAVMLTPQGMPIISDLSACVRSGYALANATR 235

Query: 298 IAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQF- 356
           +A +   L  H +P Y +PE+  L     I   +DIW+LG   Y L++  +PFER  Q  
Sbjct: 236 LARMRAVLDTHGSPMYLAPELCALEPNACILPPADIWSLGCICYALMYGISPFEREEQLH 295

Query: 357 ------AMLHSKFEFPPN-SYSSKLINLIIVMLAENPSLRPNI 392
                 A     F FP N  YS +L++++   LA  P  RP I
Sbjct: 296 GTPLRQARASGLFSFPDNPVYSLQLLDIVRQCLAVKPDARPTI 338

>Kwal_27.12559
          Length = 414

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 77/184 (41%), Gaps = 28/184 (15%)

Query: 163 EVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLL 222
           E+ L +   E++ +   +G  NIV   D      + Y G             L   + L+
Sbjct: 107 EILLKRAIRELKFLNFFKGHKNIVSLVDLEIVSEKPYDG-------------LYCYQELV 153

Query: 223 DYMNQRL---ATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKL 279
           DY   R+     + +E  I   +Y I   +  +H   V  IHRD+K  N+L     N K+
Sbjct: 154 DYDLARVIHSTVQFSEFHIKHFLYQILCGLKYIHSADV--IHRDLKPGNILCSIGGNLKI 211

Query: 280 CDFGSTSTCFPAFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEKSDIWAL 336
           CDFG      P     Q     S ++++ +   T  YR+PE+I    +    +  DIWA+
Sbjct: 212 CDFGLARGIAP-----QYFEQKSDEIHITSYVATRWYRAPELI--LSHRRYTKAIDIWAV 264

Query: 337 GVFL 340
           G  L
Sbjct: 265 GCIL 268

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 109/261 (41%), Gaps = 45/261 (17%)

Query: 102 VTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERK--NDESMNQPLKPGSPACLKRVL 159
           +TV     E +  L +G   ++Y+++  +    F  K  N   M +  K      +KRVL
Sbjct: 317 ITVEPQSFEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNKHEMIKRKK------IKRVL 370

Query: 160 VQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNK 219
            + E+                  P IV  + S  ++  DY         + L ME C   
Sbjct: 371 TEQEI------------LATSDHPFIVTLYHSFQTK--DY---------LYLCMEYCMGG 407

Query: 220 SLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKL 279
                +  R +  + E++      ++  A+  +H L    I+RD+K EN+L+  + +  L
Sbjct: 408 EFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLLG--FIYRDLKPENILLHQSGHVML 465

Query: 280 CDFG----STSTCFPAF--TSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINEK 330
            DF     +T +  P    +++ D  + S     ++   T +Y +PE+I    +      
Sbjct: 466 SDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVIRGNGH---TAA 522

Query: 331 SDIWALGVFLYKLLFFTTPFE 351
            D W LG+ +Y++LF  TPF+
Sbjct: 523 VDWWTLGILIYEMLFGCTPFK 543

>Scas_544.6
          Length = 489

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 98/209 (46%), Gaps = 42/209 (20%)

Query: 162 DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMEL--CPNK 219
           +E+ +N++  E+ +MK ++   NI+ ++ +  +          Q  E+++LME   C + 
Sbjct: 194 NEIVVNQLIRELTIMKSIKPHKNIISFYAAFYTH--------HQNNEIVILMEYMDCGSL 245

Query: 220 SLLDYMNQRLATKLT----EQEIFK---IMYDITLAVAQ-MHYL--PVPLIHRDIKIENV 269
             +    +R   +      E+  F    I+  I+ AV   ++YL     +IHRDIK  NV
Sbjct: 246 DRIFSTYKRFVARGVLDPREKNWFNDSLILSRISYAVLNGLNYLYENYKIIHRDIKPSNV 305

Query: 270 LVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINE 329
           L+++    KLCDFG +     +            D ++ T+  Y SPE I    Y   + 
Sbjct: 306 LINSKGLVKLCDFGVSKKLINSIA----------DTFVGTS-TYMSPERIQGNVY---ST 351

Query: 330 KSDIWALGVFLYKLLFFTTPFERTGQFAM 358
           K D+W+LG+ + +L+        TGQF +
Sbjct: 352 KGDVWSLGLMIIELV--------TGQFPL 372

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 110/256 (42%), Gaps = 48/256 (18%)

Query: 159 LVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVL-------L 211
           L++ +   N  R EV++ +++    ++                NI +  EVL       +
Sbjct: 81  LIKRDSISNDYRKEVKIYREINALKHLSH-------------PNIVKLEEVLQNSRYIGI 127

Query: 212 LMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVP-LIHRDIKIENVL 270
           ++E         Y+ ++   +L E    ++   +   ++ +HY+    L+HRD+K+EN+L
Sbjct: 128 VLEYACGGEFYKYIQKK--RRLKEMNACRLFSQL---ISGVHYIHSKGLVHRDLKLENLL 182

Query: 271 VDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN-E 329
           +D N N  + DFG  +     F S  ++   S       +P Y +PE++      P    
Sbjct: 183 LDKNENLVITDFGFVN----EFCSRNELMKTSCG-----SPCYAAPELV--ISAEPYEAR 231

Query: 330 KSDIWALGVFLYKLLFFTTPFE------RTGQFAMLHSKFEFPPNSYSSKLI----NLII 379
           K+DIW+ GV LY +L    P++             L++     P  +   ++    +L+ 
Sbjct: 232 KADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRLYNYINSTPLKFPDYILPIPRDLLR 291

Query: 380 VMLAENPSLRPNIYQV 395
            ML  +P  R N+ Q+
Sbjct: 292 RMLVSDPKKRINLKQI 307

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 73/150 (48%), Gaps = 15/150 (10%)

Query: 203 ITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHR 262
           +T+G   LL+ME  P     D+ N  ++  +T+ E+      +   V  +H +   L HR
Sbjct: 376 LTEGDTYLLVMEYAP----YDFFNLVMSNLMTQDEVNCYFKQLCHGVNYLHSMG--LAHR 429

Query: 263 DIKIENVLVDANNNFKLCDFGSTSTC-FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDL 321
           D+K++N +V  +   KL DFGS     +P    ++D  + S  +    +  Y +PE++  
Sbjct: 430 DLKLDNCVVTKDGILKLIDFGSAVVFQYP----YEDTIVKSHGIV--GSDPYLAPELLKQ 483

Query: 322 FKYIPINEKSDIWALGVFLYKLLFFTTPFE 351
             Y P    +D+W++ +  Y ++    P++
Sbjct: 484 TSYDP--RVADVWSIAIIFYCMVLKRFPWK 511

>Kwal_26.8347
          Length = 592

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 76/152 (50%), Gaps = 17/152 (11%)

Query: 260 IHRDIKIENVLVD-ANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLY---MHT---TPQ 312
           +HRD+K  N+L+D A+ N  L DFGS S   P    F+D  ML  D Y   +H    TP 
Sbjct: 244 LHRDVKPSNILLDGASGNVLLSDFGS-SLLLPEKLPFEDPNML--DAYQEEVHKIVGTPA 300

Query: 313 YRSPEMIDLFKYIPINE--KSDIWALGVFLYKLLFFTTPFERTGQFAMLH--SKFEFPPN 368
           + +PE+ +    +P  +  K DIW+LGV  Y LL    PF    +F      +K E P  
Sbjct: 301 FTAPELCNFEAGVPKLDGFKLDIWSLGVTAYCLLENKLPFWGENEFHTFQKIAKDELPKT 360

Query: 369 SYSSKLINLIIVMLAE-NPSLRPNIYQVLYYL 399
              + L +L+   L E +PS R  I +++  L
Sbjct: 361 --GNWLHDLVTTKLLEKDPSKRIGIKELVEIL 390

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 118/290 (40%), Gaps = 47/290 (16%)

Query: 105 GSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQ-DE 163
           G    EV+  L +G F Q+Y VK          K D      +K  S    K+V+V+ +E
Sbjct: 336 GPQDFEVLRLLGKGTFGQVYQVK----------KKDTKRIYAMKVLS----KKVIVKKNE 381

Query: 164 VGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLD 223
           +        + V    + +P IV               +     ++ L+ +      L  
Sbjct: 382 IAHTIGERNILVTTSSKASPFIV-----------GLKFSFQTPTDLYLVTDYMSGGELFW 430

Query: 224 YMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFG 283
           ++ +    + TE      + ++ LA+  +H     +++RD+K EN+L+DAN N  LCDFG
Sbjct: 431 HLQRE--GRFTEDRAKFYIAELVLALEHLH--DNDIVYRDLKPENILLDANGNIALCDFG 486

Query: 284 STSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKL 343
            +       T          + +  TT +Y +PE+  L       +  D W+LGV ++++
Sbjct: 487 LSKADLKDRT----------NTFCGTT-EYLAPEL--LLDESGYTKMVDFWSLGVLIFEM 533

Query: 344 LFFTTPFERTGQFAMLH----SKFEFPPNSYSSKLINLIIVMLAENPSLR 389
               +PF       M       K +FP +  S +  + +  +L  NP  R
Sbjct: 534 CCGWSPFYAEDNQKMYQKIAFGKVKFPRDILSPEGRSFVKGLLNRNPKHR 583

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 112/248 (45%), Gaps = 40/248 (16%)

Query: 111 VVSYLAEGGFAQIYVVKFVE---YTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLN 167
           +V    +G    +Y+ + ++   Y +E E + ++        G+   +K++++  +    
Sbjct: 590 MVEKAGQGASGSVYLAERLQLPPYKDELEAEKNQL-------GNKVAIKQMILSKQPRKE 642

Query: 168 KMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQ 227
            + +E+ VMK  +   NIV + ++      D          + ++ME     SL D +  
Sbjct: 643 LIVNEILVMKDSKHN-NIVNFLEAYLKTEDD----------LWVVMEYMEGGSLTDIIEN 691

Query: 228 RLA-----TKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDF 282
                   + LTE +I  I+ +    +  +H   +  IHRDIK +NVL+D     K+ DF
Sbjct: 692 SPTGSSGQSPLTEPQIAYIVRETCQGLKFLHDKHI--IHRDIKSDNVLLDTRGRVKITDF 749

Query: 283 GSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYK 342
           G     F A  + +     S+   M  TP + +PE++   +Y   +EK D+W+LG+   +
Sbjct: 750 G-----FCAKLTDKR----SKRATMVGTPYWMAPEVVKQREY---DEKVDVWSLGIMTIE 797

Query: 343 LLFFTTPF 350
           +L    P+
Sbjct: 798 MLESEPPY 805

>AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH]
            complement(196774..201870) [5097 bp, 1698 aa]
          Length = 1698

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 96/202 (47%), Gaps = 23/202 (11%)

Query: 209  VLLLMELCPNKSLLDYM-NQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267
            + + ME C N++L D + N+ L+ +    E +++   I  A++ +H     +IHRD+K  
Sbjct: 823  LFIQMEYCENRTLYDLIHNENLSQQ--RDEYWRLFRQILEALSYIH--SQGIIHRDLKPM 878

Query: 268  NVLVDANNNFKLCDFGSTSTCFP---------AFTSFQDIAMLSQDLYMHTTPQYRSPEM 318
            N+ +D + N K+ DFG                AF S      L+  +    T  Y + E+
Sbjct: 879  NIFIDESRNIKIGDFGLAKNVHKSADILRIEGAFGSNVSADDLTSAI---GTALYVASEV 935

Query: 319  IDLFKYIPINEKSDIWALGVFLYKLLF-FTTPFERTGQFAMLH-SKFEFPPNSYSSKL-- 374
              L      NEK D+++LG+  +++++ F T  ER      L  S  E P N  SSK   
Sbjct: 936  --LTGNGNYNEKIDMYSLGIIFFEMVYHFDTLMERATDLRKLRSSAVELPANFDSSKRNE 993

Query: 375  INLIIVMLAENPSLRPNIYQVL 396
              +I ++L  +P+ RP   ++L
Sbjct: 994  KKIIRLLLDHDPAKRPTAAKLL 1015

>KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1229

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 105/254 (41%), Gaps = 47/254 (18%)

Query: 156  KRVLVQDEV---GLNKMRSEVEVMKKLQGAPN-----IVQYF-DSNASRLRDYSGNITQG 206
            +R+LV   V    L  + SE+++M  L   P+     I+ +F D +   L       T  
Sbjct: 1003 ERILVDTWVRDRTLGTIPSEIQIMVTLNRKPHENILRILDFFEDDDYYYLETEMHGETGS 1062

Query: 207  FEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKI 266
             ++  L+EL               T +TE E   +   +   +  +H     ++HRDIK 
Sbjct: 1063 IDLFDLIEL--------------KTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKD 1106

Query: 267  ENVLVDANNNFKLCDFGSTSTC----FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLF 322
            ENV+VD     KL DFGS +      F  F                 T  Y +PE++   
Sbjct: 1107 ENVIVDNKGFVKLIDFGSAAYVKSGPFDVFVG---------------TIDYAAPEVLGGE 1151

Query: 323  KYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVML 382
             Y    +  DIWA+GV LY +++   PF    +      + +   +  S++ + LI  +L
Sbjct: 1152 PY--EGKPQDIWAIGVLLYTIIYKENPFYNIDEILDGDLRIQ-STHEVSAECVALIRKIL 1208

Query: 383  AENPSLRPNIYQVL 396
              + S RP I  ++
Sbjct: 1209 NRSVSKRPTIDDIM 1222

>Scas_634.5
          Length = 790

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 121/268 (45%), Gaps = 44/268 (16%)

Query: 84  IPP-VAQPQIEEKFPAGKVVT-VGSHRVEV---VSYLAEGGFAQIYVVKFVEYTNEFERK 138
           IPP +  P ++ ++    + T   SH  E    V  +  G F+ +Y V F     ++  K
Sbjct: 414 IPPLINSPVLKRRYINATISTNPDSHLFEKFNNVHMIGSGQFSSVYQVTFAPTNKKYAVK 473

Query: 139 NDESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRD 198
                   +K      L R+L + ++ L+++R+       L+G   ++ +  S       
Sbjct: 474 -------AVKANKYNSLNRILQEIKI-LDEIRTS---QLDLEGKEYVIDFISS-----WK 517

Query: 199 YSGNITQGFEVLLLMELCPNKSLLDYMNQRLA---TKLTEQEIFKIMYDITLAVAQMHYL 255
           Y G+        ++ E   N +L  ++ +++    T+L +  I+KI+ +++LA+  +H  
Sbjct: 518 YQGSF------YIMSEYYDNGNLDSFLQEQIISKNTRLEDWRIWKIIVELSLALRFIHQ- 570

Query: 256 PVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRS 315
              ++H D+K  N+L+    N KL DFG  +           + +  QD       +Y +
Sbjct: 571 TCHVVHLDLKPTNILITFEGNLKLADFGMAA----------HLPLRDQDFENEGDREYIA 620

Query: 316 PEMIDLFKYIPINEKSDIWALGVFLYKL 343
           PE+I    Y   + K+DI++LG+ + ++
Sbjct: 621 PEIISECIY---DFKADIFSLGLMIVEI 645

>KLLA0C10802g complement(926916..931934) similar to sp|P15442
           Saccharomyces cerevisiae YDR283c GCN2 ser/thr protein
           kinase, start by similarity
          Length = 1672

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 96/202 (47%), Gaps = 23/202 (11%)

Query: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268
           + + ME C N++L D ++   +    ++E +++   I  A++ +H     +IHRD+K  N
Sbjct: 796 LFIQMEYCENRTLYDLIHTE-SLNNQKEEYWRLFRQILEALSYIH--SQGIIHRDLKPMN 852

Query: 269 VLVDANNNFKLCDFGSTSTC--------FPAFTSFQDIAMLSQDLYMHT-TPQYRSPEMI 319
           + +D + N K+ DFG               +FTS    A  S DL     T  Y + E+I
Sbjct: 853 IFIDESRNIKIGDFGLAKNVQISQDTLRRDSFTS----AGSSGDLTSAIGTALYVASEII 908

Query: 320 DLFKYIPINEKSDIWALGVFLYKLLF-FTTPFERTGQFAMLHS-KFEFPPNSYSSKLIN- 376
               +   NEK D+++LG+  +++++ F T  ER      L +   EFP +    KL   
Sbjct: 909 T--SHGNYNEKVDMYSLGIIFFEMIYPFDTGMERVNVIKKLRNIDVEFPSDFDDKKLHTE 966

Query: 377 --LIIVMLAENPSLRPNIYQVL 396
             +I ++L  +P  RP    +L
Sbjct: 967 KKIIKLLLDHDPVRRPTASALL 988

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 91/209 (43%), Gaps = 40/209 (19%)

Query: 166 LNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYM 225
           ++ ++ E+ ++K+L    NIV Y+           G+  +G  + + +E  P  S+   +
Sbjct: 512 IDALQHEMNILKELH-HENIVTYY-----------GSSQEGGNLNIFLEYVPGGSVSSML 559

Query: 226 N------QRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKL 279
           N      + L    T Q        I + +A +H   +  IHRDIK  N+L+D     K+
Sbjct: 560 NNYGPFDEPLVKNFTRQ--------ILIGLAYLHKRNI--IHRDIKGANILIDIKGGVKI 609

Query: 280 CDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVF 339
            DFG +    P        A L   +Y      + +PE++   K +   EK+DIW++G  
Sbjct: 610 TDFGISKKLSPLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCV 660

Query: 340 LYKLLFFTTPFERTGQFAMLHSKFEFPPN 368
           + ++     PF     F+ + + F+   N
Sbjct: 661 IVEMFTGKHPFP---DFSQMQAIFKIGTN 686

>CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1336

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 73/167 (43%), Gaps = 26/167 (15%)

Query: 231  TKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTC-- 288
            T +TE E   +   +   V  +H     ++HRDIK EN++VD+    K+ DFGS +    
Sbjct: 1180 TNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGFVKIIDFGSAAYVKS 1237

Query: 289  --FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFF 346
              F  F                 T  Y +PE++    Y    +  DIWA+G+ LY ++F 
Sbjct: 1238 GPFDVFVG---------------TIDYAAPEVLGGSPY--EGKPQDIWAIGILLYTIVFK 1280

Query: 347  TTPFERTGQFAMLHSKFEFPPNSY-SSKLINLIIVMLAENPSLRPNI 392
              PF    +  +L  + +F  +   S +   LI  +L  N   RP I
Sbjct: 1281 ENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTI 1325

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 130/305 (42%), Gaps = 49/305 (16%)

Query: 102 VTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQ 161
             VG    E +  L +G   ++Y+V+        E+K+D      +  G    +KR  ++
Sbjct: 454 AVVGPQSFEKIRLLGQGDVGKVYLVR--------EKKSDRLYALKIF-GKAEMIKRKKIK 504

Query: 162 DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSL 221
                 ++ +E E++      P IV  + S  +   DY         + L ME C     
Sbjct: 505 ------RILAEQEILA-TSNHPFIVTLYHSFQTE--DY---------LYLCMEYCMGGEF 546

Query: 222 LDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCD 281
              +  R    ++E +      ++T A+  +H +    I+RD+K EN+L+  + +  L D
Sbjct: 547 FRALQTRKTKCISEDDARFYASEVTAALEYLHLMG--FIYRDLKPENILLHQSGHVMLSD 604

Query: 282 FG----STSTCFP-----AFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPINE 329
           F     +  T  P     A +S  D  + S     ++   T +Y +PE+I    +     
Sbjct: 605 FDLSVQAKGTRNPQVKGNAQSSLVDTKVCSDGFRTNSFVGTEEYIAPEVIRGNGH---TA 661

Query: 330 KSDIWALGVFLYKLLFFTTPF--ERTGQ-FA-MLHSKFEFPPNSYSSKLI-NLIIVMLAE 384
             D W LG+  Y++LF  TPF  + T Q F+ +L +   FP N+  S+   +LI  +L +
Sbjct: 662 SVDWWTLGILTYEMLFGFTPFKGDNTNQTFSNILKNDVYFPNNNDISRTCKDLIKKLLVK 721

Query: 385 NPSLR 389
             S R
Sbjct: 722 KESKR 726

>CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces
           cerevisiae YGR040w KSS1, start by similarity
          Length = 398

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 87/187 (46%), Gaps = 20/187 (10%)

Query: 163 EVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLL 222
           +V L +   E++++       NI+  F+         S N  + + V  LME   ++ L 
Sbjct: 72  KVALIRTIREIKILSHFNNHENIITIFEKIKPM---QSINFKEIYLVQELMETDLSRILA 128

Query: 223 DYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDF 282
                  +  LT   I   +Y I  A+  +H   V  IHRD+K  N+L+++N + K+CDF
Sbjct: 129 S------SNTLTVDHIQYFLYQILRALKAIHSAKV--IHRDLKPSNILLNSNCDLKICDF 180

Query: 283 GSTSTCFP----AFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGV 338
           G   T  P    +  +  ++  L++ +    T  YR+PE+  +  +   +   DIW+ G 
Sbjct: 181 GLARTYDPDDDASTMNGNNVGFLTEYV---ATRWYRAPEI--MLNFQDYSTAIDIWSCGC 235

Query: 339 FLYKLLF 345
            L ++LF
Sbjct: 236 VLAEMLF 242

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 64/127 (50%), Gaps = 21/127 (16%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++ LA+  +H     +I+RD+K EN+L+D N + K+ DFG     F  +    D+     
Sbjct: 258 EVCLALEYLH--SKEIIYRDLKPENILLDKNGHIKITDFG-----FAKYVP--DVTYT-- 306

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFA----ML 359
              +  TP Y +PE++      P N+  D W+ G+ +Y++L   TPF           +L
Sbjct: 307 ---LCGTPDYIAPEVVST---KPYNKSVDWWSFGILIYEMLAGYTPFYDANTMKTYEHIL 360

Query: 360 HSKFEFP 366
           +S+ +FP
Sbjct: 361 NSELKFP 367

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 57/113 (50%), Gaps = 12/113 (10%)

Query: 232 KLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPA 291
           +L E    ++   +   V  MH+    L HRD+K+EN+L+D + N  + DFG  +     
Sbjct: 154 RLKEPAACRLFAQLISGVHYMHHKG--LAHRDLKLENLLLDEHENLIITDFGFVN----E 207

Query: 292 FTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLL 344
           F+S  D+   S       +P Y +PE++   K      K+D+W+ GV LY +L
Sbjct: 208 FSSRNDLMKTSCG-----SPCYAAPELVVTTKAYEA-RKADVWSCGVILYAML 254

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 118/290 (40%), Gaps = 47/290 (16%)

Query: 105 GSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQ-DE 163
           G    EV+  L +G F Q+Y VK          K D      +K  S    K+V+V+ +E
Sbjct: 408 GPQDFEVLRLLGKGTFGQVYQVK----------KKDTQRIYAMKVLS----KKVIVKKNE 453

Query: 164 VGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLD 223
           +        + V    + +P IV               +     ++ L+ +      L  
Sbjct: 454 IAHTIGERNILVTTASKSSPFIV-----------GLKFSFQTPTDLYLVTDYMSGGELFW 502

Query: 224 YMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFG 283
           ++ +    + +E      + ++ LA+  +H     +++RD+K EN+L+DAN N  LCDFG
Sbjct: 503 HLQKE--GRFSEDRAKFYIAELVLALEHLH--DNDIVYRDLKPENILLDANGNIALCDFG 558

Query: 284 STSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKL 343
            +       T          + +  TT +Y +PE+  L       +  D W+LGV ++++
Sbjct: 559 LSKADLKDRT----------NTFCGTT-EYLAPEL--LLDETGYTKMVDFWSLGVLIFEM 605

Query: 344 LFFTTPFERTGQFAMLH----SKFEFPPNSYSSKLINLIIVMLAENPSLR 389
               +PF       M       K +FP +  S +  + +  +L  NP  R
Sbjct: 606 CCGWSPFFAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHR 655

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 88/192 (45%), Gaps = 28/192 (14%)

Query: 159  LVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPN 218
            LV+D V    ++SEV  +K L    NIVQY  S      +  GNI       L +E    
Sbjct: 1193 LVKDMV--EALKSEVATLKDLDHL-NIVQYLGS------EIRGNIYS-----LFLEYVAG 1238

Query: 219  KSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFK 278
             S+   +  RL  +  E+ I  +   +   +  +H   +  +HRD+K +N+L+D +   K
Sbjct: 1239 GSVGSLI--RLYGRFDEKLIRHLNTQVLSGLKYLHSKGI--LHRDMKADNLLLDEDGICK 1294

Query: 279  LCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGV 338
            + DFG +      ++        + D+ M  T  + +PEM+D  +    + K DIW+LG 
Sbjct: 1295 ISDFGISKKSKNIYS--------NSDMTMRGTVFWMAPEMVDTKQ--GYSAKVDIWSLGC 1344

Query: 339  FLYKLLFFTTPF 350
             + ++     P+
Sbjct: 1345 VVLEMFAGKRPW 1356

>Kwal_55.20326
          Length = 750

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 92/205 (44%), Gaps = 28/205 (13%)

Query: 166 LNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYM 225
           ++ ++ E+ ++K+LQ   NIV Y+           G+  +G  + + +E  P  S+   +
Sbjct: 531 VDALQHEMGLLKELQ-HENIVTYY-----------GSSQEGGNLNIFLEYVPGGSVSSML 578

Query: 226 NQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGST 285
           N        E  I      I + ++ +H   +  IHRDIK  N+L+D     K+ DFG +
Sbjct: 579 NSY--GPFEEPLIRNFTRQILIGLSYLHRKDI--IHRDIKGANILIDIKGCVKITDFGIS 634

Query: 286 STCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLF 345
               P        A L   +Y      + +PE++   K +   +K+DIW++G  + ++  
Sbjct: 635 KKLSPLNQQQNKRASLQGSVY------WMAPEVV---KQVVTTKKADIWSVGCVIIEMFT 685

Query: 346 FTTPFERTGQFAMLHSKFEFPPNSY 370
              PF     F+ + + F+   N++
Sbjct: 686 GKHPFP---DFSQMQAIFKIGTNTF 707

>YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine protein
            kinase involved in the regulation of carbohydrate
            storage, has similarity to human PIM-1 oncogene [4071 bp,
            1356 aa]
          Length = 1356

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 98/245 (40%), Gaps = 37/245 (15%)

Query: 156  KRVLVQDEV---GLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLL 212
            +R+LV   V    L  + SE+++M  L   P+       N  RL D+  +    +    +
Sbjct: 1130 ERILVDTWVRDRKLGTIPSEIQIMATLNKKPH------ENILRLLDFFEDDDYYYIETPV 1183

Query: 213  MELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVD 272
                    L D +     T +TE E   I   +   +  +H     ++HRDIK ENV+VD
Sbjct: 1184 HGETGCIDLFDLI--EFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVD 1239

Query: 273  ANNNFKLCDFGSTSTC----FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328
            +    K+ DFGS +      F  F                 T  Y +PE++    Y    
Sbjct: 1240 SKGFVKIIDFGSAAYVKSGPFDVFVG---------------TIDYAAPEVLGGNPY--EG 1282

Query: 329  EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEF-PPNSYSSKLINLIIVMLAENPS 387
            +  DIWA+G+ LY ++F   PF    +  +L    +F      S   I LI  +L     
Sbjct: 1283 QPQDIWAIGILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVP 1340

Query: 388  LRPNI 392
             RP I
Sbjct: 1341 KRPTI 1345

>KLLA0C16577g complement(1451181..1452695) some similarities with
           sp|P06784 Saccharomyces cerevisiae YDL159w STE7
           ser/thr/tyr protein kinase of MAP kinase kinase family,
           hypothetical start
          Length = 504

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 92/194 (47%), Gaps = 36/194 (18%)

Query: 163 EVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLL 222
           EV  N++  E+ +MK +    NIV ++ +       Y+ + T   E+++LME     SL 
Sbjct: 203 EVLKNQLVRELTIMKNVSAHDNIVGFYGAF------YNPSTTN--EIVILMEYMDCGSLD 254

Query: 223 DYM----------NQRLATKLT---EQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENV 269
             +          N  ++ K +   E  + +I + +   +  + Y    +IHRDIK  N+
Sbjct: 255 KILSVYRSDCHRKNVSISCKTSWFNEMPLSRISFCVLNGLIYL-YDCYKIIHRDIKPSNI 313

Query: 270 LVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINE 329
           L+++  + K+CDFG ++T   +            D ++ T+  Y SPE I   +Y     
Sbjct: 314 LINSKGDVKICDFGVSTTLINSLA----------DTFVGTS-TYMSPERIQGGRY---TT 359

Query: 330 KSDIWALGVFLYKL 343
           K D+W+LG+ + +L
Sbjct: 360 KGDVWSLGLMIIEL 373

>Scas_602.11
          Length = 1186

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 118/301 (39%), Gaps = 83/301 (27%)

Query: 167 NKMRSEVEVMKKL--QGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDY 224
           ++++ E+ +MKKL  +    +++  D   SR            ++ L++E C    +   
Sbjct: 226 DRIKREIAIMKKLHHKHVVKLIEVLDDLKSR------------KIYLVLEYCAQGEIKWC 273

Query: 225 MNQRLATK------LTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFK 278
               L T+      L+ Q   +I+  + L +  +HY  +  IHRDIK  N+LVD     K
Sbjct: 274 PKDCLETEAKGPPLLSFQSAREIIRGVILGLEYLHYQGI--IHRDIKPANLLVDEEGTVK 331

Query: 279 LCDFGSTSTCFPAFTSFQDIAML----------SQDLYMHT------------------- 309
           + DFG +     +  S  + + +          S    M+T                   
Sbjct: 332 ISDFGVSLASRSSGNSTANSSSVLGGTPRNLSRSSTESMNTTNNNDDESIDEVELAKTAG 391

Query: 310 TPQYRSPEMI--------------DLFKYIPINEKSDIWALGVFLYKLLFFTTPF----- 350
           TP + +PE+               ++FK   I+   DIWALG+  Y LLF   PF     
Sbjct: 392 TPAFFAPEICLGEEAFDKFSLRKNEMFKGSCISFMIDIWALGITFYCLLFGMLPFISDFE 451

Query: 351 -----ERTGQFAMLHSKFEFPPNSYSSKLI--------NLIIVMLAENPSLRPNIYQVLY 397
                +  G+     S  E   N  S+           N++  +L +NPS R +I ++ Y
Sbjct: 452 LELFEKIVGEPLTFPSYEELQANRVSNVCSIEEYEAAKNVLQRLLEKNPSKRCSILELKY 511

Query: 398 Y 398
           +
Sbjct: 512 H 512

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 93/215 (43%), Gaps = 32/215 (14%)

Query: 147  LKPGSPACLKRVLVQDEVGLNK----MRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGN 202
            L  G    +K + +QD   + +    ++ E+ VM+ L   PNIVQY+     R +     
Sbjct: 1279 LDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEIL-NHPNIVQYYGVEVHRDK----- 1332

Query: 203  ITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITL--AVAQMHYLPVPLI 260
                  V + ME C   SL   +         E E+   +Y + L   +A +H   V  +
Sbjct: 1333 ------VNIFMEFCEGSSLASLLEH----GRIEDEMVTQVYTLQLLEGLACLHQSGV--V 1380

Query: 261  HRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLY-----MHTTPQYRS 315
            HRDIK EN+L+D N   K  DFG+      A    + I++ + +       M  TP Y +
Sbjct: 1381 HRDIKPENILLDRNGVIKYVDFGAAK--LIAKNGSKRISLDANNKSTGGKDMIGTPMYMA 1438

Query: 316  PEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
            PE +    +       DIW+LG  + +++    P+
Sbjct: 1439 PETVTGQGHGKFG-SDDIWSLGCVVLEMVTGRRPW 1472

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 63/128 (49%), Gaps = 21/128 (16%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++TLA+  +H     +I+RD+K EN+L+D N + K+ DFG        F    D    + 
Sbjct: 142 EVTLALEYLH--AHNIIYRDLKPENILLDRNGHIKITDFG--------FAKEVDTVTWT- 190

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQF----AML 359
              +  TP Y +PE+I      P N+  D W+LG+ ++++L   TPF           +L
Sbjct: 191 ---LCGTPDYIAPEVITT---KPYNKSIDWWSLGILIFEMLAGYTPFYDVTPIKTYEKIL 244

Query: 360 HSKFEFPP 367
             K  FPP
Sbjct: 245 AGKVVFPP 252

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 133/306 (43%), Gaps = 51/306 (16%)

Query: 102 VTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGS-PACLKRVLV 160
           + VG    E +  L +G   ++Y+V+  + TN             LK  S P  +KR  +
Sbjct: 372 ILVGPQSFEKIRLLGQGDVGRVYLVR-EKQTNRL---------YALKIFSKPEMIKRKKI 421

Query: 161 QDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKS 220
           +      ++ +E E++      P IV  + S   +  DY         + L ME C    
Sbjct: 422 K------RILTEQEILA-TSNHPFIVTLYHS--FQTEDY---------LYLCMEYCMGGE 463

Query: 221 LLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLC 280
               +  R    ++E +      ++T A+  +H +    I+RD+K EN+L+  + +  L 
Sbjct: 464 FFRALQTRKTKCISEDDARFYSSEVTAALEYLHLMG--FIYRDLKPENILLHQSGHIMLS 521

Query: 281 DFG----STSTCFP-----AFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYIPIN 328
           DF     +  T  P     A  S  D  + S     ++   T +Y +PE+I    +    
Sbjct: 522 DFDLSVQAKDTKNPQVKGNASHSLVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAA- 580

Query: 329 EKSDIWALGVFLYKLLFFTTPF--ERTGQ-FA-MLHSKFEFPPNSYSSKLI-NLIIVMLA 383
              D W LG+ +Y++LF  TPF  + T Q F+ +L ++   P N+ +S+   +LI  +L 
Sbjct: 581 --VDWWTLGILIYEMLFGFTPFKGDNTNQTFSNILKNEVVIPNNNETSRACKDLIRKLLI 638

Query: 384 ENPSLR 389
           +N + R
Sbjct: 639 KNENKR 644

>Scas_643.20
          Length = 1082

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 104/253 (41%), Gaps = 47/253 (18%)

Query: 156  KRVLVQDEV---GLNKMRSEVEVMKKLQGAP--NIVQYFDSNASRLRDYSGNITQG---- 206
            +R+LV   V    L  + SE+++M  L   P  NIV   D        Y      G    
Sbjct: 856  ERILVDTWVRDRKLGTIPSEIQIMATLNKKPHKNIVALLDFFEDEEYYYMETPAHGETGS 915

Query: 207  FEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKI 266
             ++  L+EL  N            T+  E+ IFK    +   +  +H     ++HRDIK 
Sbjct: 916  IDLFDLIELKKN-----------MTEYEEKLIFK---QVVSGLKHLH--DQGIVHRDIKD 959

Query: 267  ENVLVDANNNFKLCDFGSTSTC----FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLF 322
            ENV+VD+  + KL D+GS +      F  F                 T  Y +PE++   
Sbjct: 960  ENVIVDSKGHVKLIDYGSAAYTKSGPFDVFVG---------------TIDYAAPEVLGGS 1004

Query: 323  KYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVML 382
             Y    +  DIWA+G+ LY ++F   PF    +      +F    N+ S   I LI  +L
Sbjct: 1005 VY--DGKPQDIWAIGILLYTIIFKENPFYNIDEIMDGELRFNDAGNT-SEACIKLIKKIL 1061

Query: 383  AENPSLRPNIYQV 395
              +   RP + ++
Sbjct: 1062 NRSIVDRPCVDEI 1074

>Kwal_56.24059
          Length = 353

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 73/150 (48%), Gaps = 22/150 (14%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++ LA+  +H     +I+RD+K EN+L+D N + K+ DFG        F    D    + 
Sbjct: 149 EVILALEYLH--SHDIIYRDLKPENILLDRNGHIKITDFG--------FAKEVDTVTWT- 197

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQF----AML 359
              +  TP Y +PE+I      P N+  D W+LG+ ++++L   TPF           +L
Sbjct: 198 ---LCGTPDYIAPEVI---ATKPYNKSVDWWSLGILIFEMLAGYTPFYDATPMKTYEKIL 251

Query: 360 HSKFEFPPNSYSSKLINLIIVMLAENPSLR 389
             K  +PP  +   +++L+  ++  + + R
Sbjct: 252 QGKVAYPP-FFHPDVVDLLCKLITSDLTRR 280

>Kwal_47.16761
          Length = 744

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 122/306 (39%), Gaps = 53/306 (17%)

Query: 92  IEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGS 151
           ++  F A      G    EV+  L +G F Q+Y V          RK D      +K  S
Sbjct: 317 VKWDFKATMKQHYGPQDFEVLRLLGKGTFGQVYQV----------RKKDTKRIYAMKVLS 366

Query: 152 PACLKRVLVQ-DEVGLNKMRSEVEVMKKLQGAPNIVQY---FDSNASRLRDYSGNITQGF 207
               K+V+V+ +E+        + V    +  P IV     F + A              
Sbjct: 367 ----KKVIVKKNEIAHTIGERNILVRTASKSCPFIVGLKFSFQTPA-------------- 408

Query: 208 EVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267
           ++ L+ +      L  ++ +    +  E      + ++ LA+  +H     +++RD+K E
Sbjct: 409 DLYLVTDFMSGGELFWHLQKE--GRFAEDRARFYIAELVLALEYLH--ENDIVYRDLKPE 464

Query: 268 NVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPI 327
           N+L+DAN N  LCDFG +       T          + +  TT +Y +PE+  L      
Sbjct: 465 NILLDANGNIALCDFGLSKADLKDRT----------NTFCGTT-EYLAPEL--LLDESGY 511

Query: 328 NEKSDIWALGVFLYKLLFFTTPFERTGQFAMLH----SKFEFPPNSYSSKLINLIIVMLA 383
            +  D W+LGV ++++    +PF       M       K +FP +  S +  + +  +L 
Sbjct: 512 TKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLN 571

Query: 384 ENPSLR 389
            NP  R
Sbjct: 572 RNPRHR 577

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 76/360 (21%), Positives = 143/360 (39%), Gaps = 89/360 (24%)

Query: 98  AGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKR 157
            G+ V + + R  V   +  G FA +Y     + +         + N  +K  S     R
Sbjct: 7   GGRPVAIVAERYVVEKEIGRGSFAVVYKGHLADSS---------AGNVAIKAVS-----R 52

Query: 158 VLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCP 217
             ++++  L  +  E+ ++KK++  P+IV   +   +           G +  L+ME C 
Sbjct: 53  SKLRNKKLLENLEIEIAILKKIKH-PHIVGLLECERT-----------GTDFYLMMEYCA 100

Query: 218 NKSLLDYMNQR--------LATKLTEQ------------EIFKIMYDITLAVAQMHYLPV 257
              L  ++ +R        L   L E+             +  + Y   L+ A       
Sbjct: 101 LGDLTFFIKKRRSLMDKHPLVRTLFEKYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSK 160

Query: 258 PLIHRDIKIENVL-----VDANN----------------NFKLCDFGSTSTCFPAFTSFQ 296
            L+HRDIK +N+L     VD N+                  K+ DFG        F  F 
Sbjct: 161 NLVHRDIKPQNLLLSTPLVDYNDPAEFHARGFVGIYNLPILKIADFG--------FARFL 212

Query: 297 DIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQF 356
               L++ L    +P Y +PE+++  KY   N K+D+W++G  LY++     PF+ +   
Sbjct: 213 PNTSLAETLC--GSPLYMAPEILNYQKY---NAKADLWSVGTVLYEMCCGKPPFKASNHL 267

Query: 357 AMLHS------KFEFPPN-SYSSKLINLIIVMLAENPSLRPNIYQVLYYLSEVTNREVPP 409
            +           +FP + +  S +++LI  +L   P+ R    +  ++ + + N ++ P
Sbjct: 268 ELFQKIKKANDVIQFPKHAALESAMVDLICGLLTFEPAKRMGFTE--FFSNGLVNEDLSP 325

>CAGL0D01694g complement(176981..178279) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, hypothetical start
          Length = 432

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 102/241 (42%), Gaps = 39/241 (16%)

Query: 106 SHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVG 165
           S + E++  L +G +  +   K     ++ + ++ E     +K  +    +++L++  + 
Sbjct: 66  SGKYEIIQVLGKGSYGVVCSAK-----HKLDNEDQEQFTVAIKKITNIFYRKILLKRAI- 119

Query: 166 LNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYM 225
                 E++ M   +G  +IV   D    + + Y G             L   + L+DY 
Sbjct: 120 -----REIKFMNYFKGHKHIVNLIDIEIVQDKPYDG-------------LYCYQELIDYD 161

Query: 226 NQRL---ATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDF 282
             R+   + +L+E  I   +Y I   V  +H     +IHRD+K  N+L   N   K+CDF
Sbjct: 162 LARVIHSSVQLSEFHIQHFIYQILCGVKYIH--SADVIHRDLKPGNILCTVNGCLKICDF 219

Query: 283 GSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKS---DIWALGVF 339
           G        F +    +  ++      T  YR+PE+I     +  NE +   D+W++G  
Sbjct: 220 GLARGVAKQFVNKN--SKPNEITNYVATRWYRAPELI-----LSNNEYTKSVDMWSVGCI 272

Query: 340 L 340
           L
Sbjct: 273 L 273

>Kwal_33.14167
          Length = 838

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 101/265 (38%), Gaps = 58/265 (21%)

Query: 101 VVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLV 160
           VV V     E +  L  GG +++Y VK       +                   LKRV  
Sbjct: 507 VVYVNGTEYEKLELLGRGGTSKVYKVKNANNNKVY------------------ALKRVSF 548

Query: 161 Q--DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPN 218
              D+  ++  + E+E++KKL+  P +V+  D            +  G  VL ++  C +
Sbjct: 549 DEFDDSSIDGFKGEIELLKKLETQPRVVKLIDH----------EMDHG--VLYVVMECGD 596

Query: 219 KSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFK 278
             L   +  R    L  + +     ++   V  +H     ++H D+K  N  V      K
Sbjct: 597 HDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVH--DAGIVHSDLKPAN-FVFVKGILK 653

Query: 279 LCDFGSTSTCFPAFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYI---------- 325
           + DFG  +   P  T          ++Y  T   TP Y +PE +    Y           
Sbjct: 654 IIDFG-IANAVPEHTV---------NIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRW 703

Query: 326 PINEKSDIWALGVFLYKLLFFTTPF 350
            + + SDIW+ G  +Y++++   P+
Sbjct: 704 KVGKPSDIWSCGCIIYQMIYGRPPY 728

>Kwal_33.13681
          Length = 715

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 106/235 (45%), Gaps = 39/235 (16%)

Query: 112 VSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRS 171
           VS +  G F+ +Y V F       E+ N +   + +KP       R+L + ++ L+K+  
Sbjct: 380 VSSIGSGQFSTVYQVTF-------EQTNTKYAVKSMKPNKYNTSARILQEIDI-LSKIS- 430

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLA- 230
             E     +G   ++ +  S             QGF   ++ E C N  L  ++ +++  
Sbjct: 431 --ETTLDEEGKEYVLNFISSWK----------YQGF-FYVMTEYCENGDLDTFLKKQIIS 477

Query: 231 --TKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTC 288
             T+L +  I+KI+ +++LA+  +H     + H D+K  NVL+    N KL DFG  +  
Sbjct: 478 KNTRLEDWRIWKIIVELSLALRFVHD-SCQIAHLDLKPANVLITFEGNLKLADFGMAAKL 536

Query: 289 FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKL 343
               T  ++              +Y +PE+I    Y   + ++DI++LG+ + ++
Sbjct: 537 PVGHTGIEN----------EGDREYIAPEIISECVY---DFRADIFSLGLMIVEI 578

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 103/247 (41%), Gaps = 41/247 (16%)

Query: 156  KRVLVQDEV---GLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLL 212
            +R+LV   V    L  + SE+++M  L   P+       N  RL D+  +    +    +
Sbjct: 1033 ERILVDTWVRDRKLGTIPSEIQIMATLNKKPH------ENIMRLLDFFEDDEYYYIESPM 1086

Query: 213  MELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVD 272
                 +  L D +   L T +TE E   +   +   +  +H     ++HRDIK ENV+VD
Sbjct: 1087 HGETGSIDLFDLI--ELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVD 1142

Query: 273  ANNNFKLCDFGSTSTC----FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMI--DLFKYIP 326
                 K+ DFGS +      F  F                 T  Y +PE++  D ++  P
Sbjct: 1143 NRGRVKIIDFGSAAYVKRGPFDVFVG---------------TIDYAAPEVLGGDPYEGKP 1187

Query: 327  INEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAEN 385
                 D+WA+GV LY +++   PF    +  +L       P    S + + LI  +L  +
Sbjct: 1188 ----QDVWAVGVLLYTIIYKENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRS 1241

Query: 386  PSLRPNI 392
             + RP +
Sbjct: 1242 VNRRPTV 1248

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 57/107 (53%), Gaps = 17/107 (15%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++TLA+  +H   +  I+RD+K EN+L+D N + K+ DFG                +++ 
Sbjct: 168 EVTLALEYLHSHNI--IYRDLKPENILLDRNGHIKITDFGFAK------------EVITV 213

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
              +  TP Y +PE+I      P N+  D W+LG+ ++++L   TPF
Sbjct: 214 TWTLCGTPDYIAPEVITT---KPYNKSVDWWSLGILIFEMLAGYTPF 257

>Scas_689.25*
          Length = 409

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 57/107 (53%), Gaps = 17/107 (15%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++ LA+  +H L +  I+RD+K EN+L+D N + K+ DFG     F  +    D+     
Sbjct: 205 EVCLALDYLHSLDI--IYRDLKPENLLLDRNGHIKVTDFG-----FAKYVP--DVTYT-- 253

Query: 304 DLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPF 350
              +  TP Y +PE+I      P N+  D W+ G+ +Y++L   TPF
Sbjct: 254 ---LCGTPDYIAPEVISA---KPYNKSVDWWSFGILIYEMLSGHTPF 294

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 87/185 (47%), Gaps = 35/185 (18%)

Query: 209 VLLLMELCPNKSLLDYMNQRL---ATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIK 265
           + + ME    +SL D + + L     ++ E+ + KI   +   ++ +H   +  IHRDIK
Sbjct: 310 IYIAMEYMGGRSL-DAIYKHLLKHGGRVGEKVLGKIAESVLRGLSYLHQRKI--IHRDIK 366

Query: 266 IENVLVDANNNFKLCDFGSTSTCFPAF-TSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKY 324
            +N+L++     KLCDFG +     +  T+F              T  Y +PE I   + 
Sbjct: 367 PQNILLNEAGQVKLCDFGVSGEAVNSLATTFTG------------TSYYMAPERI---QG 411

Query: 325 IPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAE 384
            P +  SD+W+LG+ L ++     PF+ +G+FA        PP       I L++++L  
Sbjct: 412 QPYSVTSDVWSLGLTLLEVAQAHFPFD-SGKFAA-----NMPP-------IELLMLILTF 458

Query: 385 NPSLR 389
            P L+
Sbjct: 459 TPQLK 463

>Scas_633.29
          Length = 789

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 74/327 (22%), Positives = 127/327 (38%), Gaps = 69/327 (21%)

Query: 95  KFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPAC 154
           K      +TV     E +  L  GG +++Y VK              S N+         
Sbjct: 286 KLAKRNTITVNDTEYEKIELLGRGGSSRVYKVK-------------NSQNKVF------A 326

Query: 155 LKRVLVQ--DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLL 212
           LKRV     D+  ++  + E+E+++KL     +V+ FD         SG       VL L
Sbjct: 327 LKRVSFDEFDDSSVDGFKGEIELLEKLSNESRVVKLFDYQMD-----SG-------VLFL 374

Query: 213 MELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVD 272
           +  C +  L   ++QR    L    +     ++   +  +H     ++H D+K  N  V 
Sbjct: 375 IMECGDHDLSQILSQRSDMPLDMDFVRYHAREVVRCIKIVH--DAGIVHSDLKPAN-FVF 431

Query: 273 ANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHT---TPQYRSPEMIDLFKYI---- 325
                K+ DFG  +   P  T          ++Y      TP Y +PE +    Y     
Sbjct: 432 VKGILKIIDFG-IANAIPDHTV---------NIYRENQIGTPNYMAPEALVAMNYTNEND 481

Query: 326 -----PINEKSDIWALGVFLYKLLFFTTPFER-TGQFAML-----HSKFEFPPNSYSSK- 373
                 + + SDIW+ G  +Y++++   P+    GQ  +L       K  F   + +++ 
Sbjct: 482 GGNKWKVGKPSDIWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNES 541

Query: 374 ----LINLIIVMLAENPSLRPNIYQVL 396
               LI+L+   L  +P  R ++ QVL
Sbjct: 542 IPRSLIDLMKGCLTRDPEKRWSVDQVL 568

>Scas_584.11
          Length = 1074

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 84/191 (43%), Gaps = 37/191 (19%)

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLAT 231
           EV+++ K+    NIV         L DY       F+  ++ME C    L + +   L  
Sbjct: 108 EVDILTKVGKHKNIVS--------LVDY-------FDSYIIMEYCSGGDLYEAIKDDLVP 152

Query: 232 KLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDA-NNNFKLCDFGSTSTCFP 290
           K T + I  I   I  A+  +H     + HRDIK EN+L+   +   KL D+G  +T   
Sbjct: 153 KKT-KTITHIFSQIMDAIEFVH--GKSIYHRDIKPENILITGIDWTIKLTDWGLATTHET 209

Query: 291 AFTSFQDIAMLSQDLYMHTTPQYRSPEM------IDLFKYIPINEKSDIWALGVFLYKLL 344
           +F    D ++ S+        +Y +PE+      I+  K     +K D+WA+G+    ++
Sbjct: 210 SF----DRSVGSE--------RYMAPELFESNLDIEERKEAYKCDKVDLWAMGIVFLNIV 257

Query: 345 FFTTPFERTGQ 355
           F   PF    Q
Sbjct: 258 FQKNPFSVANQ 268

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 98/227 (43%), Gaps = 40/227 (17%)

Query: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208
           P S A +K++    + G     +++ ++K+L    NIV Y+           G+  +G  
Sbjct: 464 PSSNAVVKKLTDPPQDGGRASSTKMNLLKELH-HENIVTYY-----------GSSQEGGN 511

Query: 209 VLLLMELCPNKSLLDYMN------QRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHR 262
           + + +E  P  S+   +N      + L    T Q +  + Y        +H   +  IHR
Sbjct: 512 LNIFLEYVPGGSVSSMLNSYGPFEEPLVKNFTRQTLVGLTY--------LHRKNI--IHR 561

Query: 263 DIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLF 322
           DIK  N+L+D   + K+ DFG +    P        A L   +Y      + +PE++   
Sbjct: 562 DIKGANLLIDIKGSVKITDFGISKKLSPLNKKQNKRASLQGSVY------WMAPEVV--- 612

Query: 323 KYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNS 369
           K +   EK+DIW++G  + ++     PF     F+ + + F+   N+
Sbjct: 613 KQVVTTEKADIWSVGCVVVEMFTGKHPFP---DFSQMQAIFKIGTNT 656

>AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH]
           complement(1109175..1111499) [2325 bp, 774 aa]
          Length = 774

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 86/204 (42%), Gaps = 36/204 (17%)

Query: 168 KMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE--VLLLMELCPN-----KS 220
           +   E  + KKL G  NI++ F      L     + T G +     +M+ C        +
Sbjct: 282 RCMKEYLIAKKLDGHINIIKTF-----YLMKVPSSATNGVKRSWAFVMQQCVQDMYYYTT 336

Query: 221 LLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLC 280
           L  + N+ L      +E +     I   V QMH L +   HRDIK+ENVL       KL 
Sbjct: 337 LTGWHNKPL------EEKWCCFKQIARGVRQMHNLGI--AHRDIKLENVLATDYGALKLT 388

Query: 281 DFGSTSTCFPAFTSFQDIAMLSQDLY-MHTTPQYRSPEMIDLF----KYIPINEKS---- 331
           DFG ++    A  S  D +     L     +P +  PE++ L     K  P+ E      
Sbjct: 389 DFGVSTY---AIESPDDPSSPRIKLKGFCGSPPHVPPEVMILSSEKRKKTPVPENKLEYD 445

Query: 332 ----DIWALGVFLYKLLFFTTPFE 351
               D+WALG+ ++ L+  T PF+
Sbjct: 446 PFSMDMWALGIVMWSLIIPTPPFQ 469

>CAGL0F03311g complement(327599..330736) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 1045

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 90/207 (43%), Gaps = 39/207 (18%)

Query: 157 RVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELC 216
           R  + + + L  M  EV++  K+    NIVQ +D                F+  ++ME C
Sbjct: 112 RSRLSNNICLEAMY-EVDIQTKIGFHENIVQLYDF---------------FDSYIIMEYC 155

Query: 217 PNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDA--N 274
               L + +   L  K T +EI  I+  I  A+  +H   +   HRDIK EN+L+ +  +
Sbjct: 156 SGGDLYEAIKDDLVPKKT-KEITHILTQILDAIEFVHNKQI--YHRDIKPENILITSLID 212

Query: 275 NNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEM------IDLFKYIPIN 328
              KL D+G  +T   ++    D  + S+        +Y  PE+      ID  K     
Sbjct: 213 WKIKLTDWGLATTDEKSY----DRNVGSE--------RYMPPELFESNLDIDERKEPYDC 260

Query: 329 EKSDIWALGVFLYKLLFFTTPFERTGQ 355
            K D+W++G+    ++F+  PF    Q
Sbjct: 261 SKVDLWSIGIVFLNVVFYKNPFRIADQ 287

>KLLA0B07579g 659591..661759 weakly similar to sp|P32944
           Saccharomyces cerevisiae YJL187c SWE1 ser/tyr
           dual-specifity protein kinase, start by similarity
          Length = 722

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 107/237 (45%), Gaps = 42/237 (17%)

Query: 112 VSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRS 171
           VS + +G F+ +Y V F E   ++  K+       ++P       R+L   E+    M S
Sbjct: 399 VSIMGKGQFSTVYQVTFPETGLKYAIKS-------VRPTKHNFTNRIL--QEIN---MLS 446

Query: 172 EVE--VMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRL 229
            ++  V    +G   IV++  S + +   Y           ++ E C N +L  ++ + +
Sbjct: 447 TIQDSVTNDTEGKEYIVEFISSWSHKGSFY-----------IMTEFCENGNLDAFIQEHV 495

Query: 230 ATK---LTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTS 286
             K   L +  I+KI+ +I LA+  +H     ++H D+K  NVL+    N KL DFG  +
Sbjct: 496 IAKQQRLEDWRIWKIIVEICLALRFIHD-SCSIVHLDLKPANVLITFEGNLKLADFGMAT 554

Query: 287 TCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKL 343
                  SF++              +Y +PE+I    Y   + ++DI++LG+ + ++
Sbjct: 555 KLPIEDKSFEN----------EGDREYIAPEIIRDGIY---DFRADIFSLGLMMIEI 598

>Sklu_1995.2 YLR362W, Contig c1995 1578-3767
          Length = 729

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 90/204 (44%), Gaps = 28/204 (13%)

Query: 166 LNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYM 225
           ++ ++ E+ ++K+L    NIV Y+           G+  +G  + + +E  P  S+   +
Sbjct: 510 IDALQHEMNLLKELH-HENIVTYY-----------GSSQEGGNLNIFLEYVPGGSVSSML 557

Query: 226 NQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGST 285
           N        E  I      I + +A +H   +  IHRDIK  NVL+D     K+ DFG +
Sbjct: 558 NNY--GPFEEPLIKNFTRQILIGLAYLHRKNI--IHRDIKGANVLIDIKGCVKITDFGIS 613

Query: 286 STCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLF 345
               P        A L   +Y      + +PE++   K +   EK+DIW++G  + ++  
Sbjct: 614 KKLSPLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCLVVEMFT 664

Query: 346 FTTPFERTGQFAMLHSKFEFPPNS 369
              PF     F+ + + F+   N+
Sbjct: 665 GKHPFP---DFSQMQAIFKIGTNT 685

>Scas_685.24
          Length = 515

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 94/207 (45%), Gaps = 21/207 (10%)

Query: 198 DYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPV 257
           +Y   + +   + ++ME C   S  D +       L E+++  I  +I   +  +H    
Sbjct: 82  NYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQYLH--EQ 139

Query: 258 PLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPE 317
             IHRDIK  N+L+    + KL DFG          S Q  + L +   +  TP + +PE
Sbjct: 140 KKIHRDIKAANILLTEEGHVKLGDFG---------VSGQLKSTLRRGTIV-GTPYWMAPE 189

Query: 318 MI--DLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLH--SKFEFP--PNSYS 371
           +   ++  Y   +EK DIW+LG+ +++LL    P  +     +L   S+   P    +YS
Sbjct: 190 VASQNIEGY---DEKIDIWSLGITVFELLKGVPPLVKLDPIRVLANLSRKSAPRLQGAYS 246

Query: 372 SKLINLIIVMLAENPSLRPNIYQVLYY 398
               + + + L +NP+ RP    +L +
Sbjct: 247 DAAKSFVALCLIKNPNERPAAVDLLKF 273

>AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH]
           (348350..350533) [2184 bp, 727 aa]
          Length = 727

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 107/235 (45%), Gaps = 39/235 (16%)

Query: 112 VSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRS 171
           V+ L  G F+ +Y V F E + ++  K+       + P       R++ + ++ L+++  
Sbjct: 395 VTLLGRGQFSTVYQVTFPETSAKYAVKS-------MAPKKHYSRSRIIQEIQL-LSEISQ 446

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLAT 231
           E       +G   +VQ+  S      +Y G          + ELC N +L  ++ ++L  
Sbjct: 447 ET---SDAEGREYVVQFISS-----WEYQGT------YYAMTELCENGNLDQFLQEQLVA 492

Query: 232 K---LTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTC 288
           +   L +  I+KI+ ++ L +  +H     ++H D+K  N+++    N KL DFG  +  
Sbjct: 493 RSKRLEDWRIWKIIVEVCLGLRFLHET-CSIVHLDLKPANIMITFEGNLKLGDFGMATKL 551

Query: 289 FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKL 343
                +F++              +Y +PE+I    Y   + ++DI++LG+ + ++
Sbjct: 552 PLTDKAFEN----------EGDREYIAPEIISDGIY---DFRADIFSLGLMIVEI 593

>Sklu_2066.2 YJL128C, Contig c2066 5081-7000
          Length = 639

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 107/260 (41%), Gaps = 41/260 (15%)

Query: 162 DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSL 221
           DE    ++  E+EV+ K Q +P+IV +          Y     +G  V + ME     SL
Sbjct: 368 DESKFTQILMELEVLHKCQ-SPHIVDF----------YGAFFIEG-AVYMCMEYMDGGSL 415

Query: 222 LDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVD-ANNNFKLC 280
               +Q     + E ++  I   +   + ++  +   +IHRD+K  N+L   A    KLC
Sbjct: 416 DKCYDQDCIGGIDEPQLAYITEAVICGLKELKDVHN-IIHRDVKPTNILCSAAQGTIKLC 474

Query: 281 DFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMI-----DLFKYIPINEKSDIWA 335
           DFG +     A  +  +I   S          Y +PE I     D   Y     +SDIW+
Sbjct: 475 DFGVSGNLV-ASMAKTNIGCQS----------YMAPERIKSLNPDKSTY---TVQSDIWS 520

Query: 336 LGVFLYKLLFFTTPF---ERTGQFAMLHSKFEFPP-----NSYSSKLINLIIVMLAENPS 387
           LG+ + ++     P+        F+ L +  + PP       +S+   + + + L + P 
Sbjct: 521 LGLSILEMALGAYPYPPETYDNIFSQLSAIVDGPPPKLPQAKFSADAQDFVSMCLQKVPE 580

Query: 388 LRPNIYQVLYYLSEVTNREV 407
            RPN   +L +      REV
Sbjct: 581 RRPNYAALLEHRWLKKYREV 600

>Kwal_27.10004
          Length = 735

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 71/157 (45%), Gaps = 16/157 (10%)

Query: 203 ITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHR 262
           +T+G+    +ME C    L   +++    K   +E ++    +   +  +H   V  +HR
Sbjct: 355 MTRGW--AFVMEYCTEGDLFSLISKPNWKKRPLKEKYEYWRQVVEGIKFIHSQGV--VHR 410

Query: 263 DIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLF 322
           DIK ENVL+      K+ DFG +               L  D Y+  +P Y +PE++  F
Sbjct: 411 DIKPENVLISKEGIAKMTDFGISDWGNEDPDDLTSPVRLF-DTYV-GSPPYSAPEVV-AF 467

Query: 323 K--------YIPINE-KSDIWALGVFLYKLLFFTTPF 350
           K          P +  K D WALGV L+ L++  TPF
Sbjct: 468 KDEDSTYQDRKPYDAYKMDCWALGVLLFTLVYQCTPF 504

>Kwal_27.9763
          Length = 868

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 95/205 (46%), Gaps = 37/205 (18%)

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLAT 231
           E++++K L+   NIV+Y            G I +  ++ +L+E C   SL D + +    
Sbjct: 68  EIDLLKNLKHE-NIVKY-----------HGFIQKSHQLFILLEYCSQGSLRDLIKR---G 112

Query: 232 KLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPA 291
            + EQ+    +      +  +H   V  IHRDIK  N+L+DA N  KL DFG +      
Sbjct: 113 PVEEQQCKTYIRQTLHGLKYLHDQGV--IHRDIKAANLLLDAQNVVKLADFGVS------ 164

Query: 292 FTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFE 351
            T   ++AM         +P + +PE++        +  SDIW+LG  + ++L    PF 
Sbjct: 165 -TRVNNLAMTYAG-----SPNWMAPEVM---MGQGASTVSDIWSLGATVVEILTGNPPFH 215

Query: 352 ----RTGQFAMLHSKFEFPPNSYSS 372
                   +A++H  +  PP++ SS
Sbjct: 216 NLVNEAACYAIVHDVY-IPPSTLSS 239

>CAGL0K01617g complement(142479..144803) similar to sp|P54199
           Saccharomyces cerevisiae YDL028c Serine/threonine
           protein kinase, start by similarity
          Length = 774

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 75/340 (22%), Positives = 131/340 (38%), Gaps = 73/340 (21%)

Query: 87  VAQPQIEEKFPAGK-VVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQ 145
           + +P    + P+ K VV+V     E V  L  GG + +Y V+ ++               
Sbjct: 424 IVEPPTSTRPPSRKNVVSVNGTEYERVELLGRGGSSNVYKVRGLK--------------- 468

Query: 146 PLKPGSPACLKRVLVQ--DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNI 203
                    LK+V     DE  +   + E+ ++K+LQ    +VQ +D             
Sbjct: 469 ----NRVYALKKVSFDEFDESSVEGFKGEISLLKQLQNQNRVVQLYD------------F 512

Query: 204 TQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRD 263
             G  VL L+  C +  L   ++QR       + I     ++   V  +H     ++H D
Sbjct: 513 EMGSGVLYLLMECGDYDLSQVLHQRANQPFDMEFIRYHAREMVTCVKVVH--DAGIVHSD 570

Query: 264 IKIENVLVDANNNFKLCDFGSTSTCFPAFTS--FQDIAMLSQDLYMHTTPQYRSPEMIDL 321
           +K  N  V      K+ DFG  +   P  T   ++D+ +         TP Y +PE +  
Sbjct: 571 LKPAN-FVFVKGILKIIDFG-IANAVPDHTVNIYRDMQI--------GTPNYMAPEALVA 620

Query: 322 FKYIP--------------INEKSDIWALGVFLYKLLFFTTPFER-TGQFAML-----HS 361
             Y                I + +DIW+ G  +Y++++   P+ +  GQ  +L     + 
Sbjct: 621 NNYTADNDGKYDQKTNKWKIGKPADIWSCGCIIYQMIYGKPPYAKYQGQERLLSIMDPNV 680

Query: 362 KFEF----PPNSYSSKL-INLIIVMLAENPSLRPNIYQVL 396
           K E+    P  +    L + L+   L  NP  R +  Q+L
Sbjct: 681 KIEYKEVLPDKTVIPSLALELMQYCLMRNPEERWSALQIL 720

>YOL016C (CMK2) [4800] chr15 complement(294777..296120)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type II [1344 bp, 447 aa]
          Length = 447

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 109/263 (41%), Gaps = 58/263 (22%)

Query: 155 LKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLME 214
           LK+ L  + V L  +  E+ +++KL   PNIV + D   S+ + Y           ++ +
Sbjct: 79  LKKALQGNNVQLQMLYEELSILQKLS-HPNIVSFKDWFESKDKFY-----------IVTQ 126

Query: 215 LCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVL-VDA 273
           L     L D +  R   K TE +  +I+  I  AV  MH   V  +HRD+K ENVL VD 
Sbjct: 127 LATGGELFDRILSR--GKFTEVDAVEIIVQILGAVEYMHSKNV--VHRDLKPENVLYVDK 182

Query: 274 NNN--FKLCDFG-------STSTCFPAFTSFQDIA--MLSQDLYMHTTPQYRSPEMIDLF 322
           + N    + DFG            + A  S   +A  +L+QD   H  P           
Sbjct: 183 SENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYVAPEVLTQD--GHGKP----------- 229

Query: 323 KYIPINEKSDIWALGVFLYKLLFFTTPF--ERTGQFAMLHSKFEFPP-------NSYSSK 373
                    DIW++GV  Y LL   +PF  E    F    +   +P        ++ S  
Sbjct: 230 --------CDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISID 281

Query: 374 LINLIIVMLAENPSLRPNIYQVL 396
           +   I+  L  NP+ RP   ++L
Sbjct: 282 VKRFILKALRLNPADRPTATELL 304

>CAGL0H01199g 110610..115556 highly similar to sp|P15442
           Saccharomyces cerevisiae YDR283c GCN2 ser/thr protein
           kinase, start by similarity
          Length = 1648

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 93/198 (46%), Gaps = 15/198 (7%)

Query: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268
           + + ME C N++L D ++     K    E +++   I  A++ +H     +IHRD+K  N
Sbjct: 774 LFIQMEYCENRTLYDLIHNEGLNK-ERDEYWRLFRQILEALSYIH--SQGIIHRDLKPMN 830

Query: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLS----QDLYMHT-TPQYRSPEMIDLFK 323
           + +D + N K+ DFG       +  + +  + +S     DL     T  Y + E+  L  
Sbjct: 831 IFIDESRNVKIGDFGLAKNVHKSLDALKLDSQMSTGSVDDLTSAIGTALYVATEV--LTG 888

Query: 324 YIPINEKSDIWALGVFLYKLLF-FTTPFERTGQFAMLHSKFEFPPNSYSSKLI----NLI 378
               NEK D+++LG+  +++++ F+T  ER      L S     PN + +  +     +I
Sbjct: 889 KGNYNEKIDMYSLGIIFFEMIYPFSTGMERVNILKDLRSSNVKFPNDFDNNRMKTEKKII 948

Query: 379 IVMLAENPSLRPNIYQVL 396
            +++  +P  RP    +L
Sbjct: 949 TLLVDHDPQKRPGAKTLL 966

>Scas_673.20*
          Length = 758

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 92/192 (47%), Gaps = 29/192 (15%)

Query: 153 ACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLL 212
             +K++ ++ +  L  + +E+ V+K+ Q  PNI+ +   N+  L D          + ++
Sbjct: 507 VAIKQIDLKIQPRLQMIWTEMLVLKEYQ-HPNIINFI--NSYLLHD---------TLWIV 554

Query: 213 MELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVD 272
           ME     SL D ++    T   E+++  I  +    +  +H   +  +HRDIK +N+L+ 
Sbjct: 555 MEYMDGGSLADIVSFFTPT---EEQMATICRETLFGLNFLHSRGI--VHRDIKSDNILLS 609

Query: 273 ANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSD 332
            N + K+ DFG       + T         +   M  TP + +PE+I   +Y P   K D
Sbjct: 610 MNGDIKITDFGFCGQLTESNT---------KRTTMVGTPYWMAPEVIASKEYGP---KVD 657

Query: 333 IWALGVFLYKLL 344
           +W+LG+ + +++
Sbjct: 658 VWSLGIMIIEMI 669

>KLLA0F01507g 144356..145774 some similarities with sp|P47042
           Saccharomyces cerevisiae YJL057c IKS1 singleton,
           hypothetical start
          Length = 472

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 87/204 (42%), Gaps = 34/204 (16%)

Query: 219 KSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLV------D 272
           K LL++   R+   LT ++I  I  DI   + Q+H L +  IHRD+K  N L+       
Sbjct: 199 KKLLNHKKSRIG--LTTRQIVSIANDIATGLKQLHSLRI--IHRDLKPSNCLLLEEFDRS 254

Query: 273 ANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSD 332
             + F  C  G        F   Q    L        T ++ +PE   L K    + KSD
Sbjct: 255 DTDKFPKCVIGD-------FGESQLYGQLRDATGSTGTVEFVAPE---LTKGAQFSFKSD 304

Query: 333 IWALGVFLYKLLFFTTPFERTGQFAMLH--SKFEFPPNSYSS------------KLINLI 378
           I+A G+ LY ++    PF      A+ H  ++  F P + S              L NL+
Sbjct: 305 IYAFGMILYFVIMGQLPFNSKDMSAIKHEINELSFSPEAMSKLHDSLDLAPIDPSLYNLV 364

Query: 379 IVMLAENPSLRPNIYQVLYYLSEV 402
             ML   PSLRP+  Q+ Y L+ +
Sbjct: 365 CEMLNHTPSLRPDSSQIEYQLNII 388

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 102/229 (44%), Gaps = 41/229 (17%)

Query: 188 YFDSNASRLRDYSGNITQGFEVL-------LLMELCPNKSLLDYMNQRLATKLTEQEIFK 240
           Y + NA +L  +  NI +  EVL       ++++         Y+ ++   +L E    +
Sbjct: 96  YRELNALKLLSHP-NIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKK--RRLKEPPACR 152

Query: 241 IMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAM 300
           +   +   V  +HY    L HRD+K+EN+L+D + N  + DFG           F    +
Sbjct: 153 LFAQLISGVHYIHY--KGLAHRDLKLENLLLDEHENLIITDFG-------FVNEFHKNDL 203

Query: 301 LSQDLYMHTTPQYRSPEMIDLFKYIPIN-EKSDIWALGVFLYKLLFFTTPFE-------- 351
           +        +P Y +PE++   K  P + +K+D+W+ GV LY +L    P++        
Sbjct: 204 MRTSC---GSPCYAAPELVVSSK--PYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEG 258

Query: 352 ----RTGQFAMLHSKFEFPPNSYSSKLI-NLIIVMLAENPSLRPNIYQV 395
               +  Q+ + H+  +FP   Y   +  +L+  +L  NP +R  +  +
Sbjct: 259 EDIAKLYQY-ITHTSLKFP--EYIKPIPRDLLKRILVSNPEVRLTVADI 304

>Kwal_47.18307
          Length = 621

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 85/191 (44%), Gaps = 21/191 (10%)

Query: 211 LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVL 270
            ++E      LL  + QRL  +LTE     I   +   V  MH   V  IHRD+K ENVL
Sbjct: 89  FVLEYVSGGELLALI-QRLG-RLTEDLSRHITAQLVDTVDYMHSKGV--IHRDLKPENVL 144

Query: 271 VDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEK 330
           +       + DFG  + C  A   F++    +  +    T +Y SPE   L  +      
Sbjct: 145 LSQEGRVVITDFG--AACTAADRKFENTKRTASFV---GTAEYVSPE---LLLHSQCGFS 196

Query: 331 SDIWALGVFLYKLLFFTTPFERTGQF------AMLHSKFEFPPNSYSSKLINLIIVMLAE 384
           SDIWALG  +Y+L     PF    +         L  K+ F   S S ++++++  +L  
Sbjct: 197 SDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLF---SNSPQVVSIVQSILVT 253

Query: 385 NPSLRPNIYQV 395
           +P  RP+  Q+
Sbjct: 254 DPLKRPSAAQL 264

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 85/191 (44%), Gaps = 24/191 (12%)

Query: 205 QGFEVLLLMELCPNKSLLDYMNQRLAT-KLTEQEIFKIMYDITLAVAQMHYLPVPLIHRD 263
           Q  E L L+  C N   L Y  QR     L+    +    ++  A+  +H + V  I+RD
Sbjct: 438 QSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAA--ELLCALDTLHKMDV--IYRD 493

Query: 264 IKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDL--YMHTTPQYRSPEMIDL 321
           +K EN+L+D   +  LCDFG    C         + M  +D       TP+Y +PE++  
Sbjct: 494 LKPENILLDYQGHIALCDFG---LC--------KLNMKDEDKTDTFCGTPEYLAPELLLG 542

Query: 322 FKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFP---PNSYSSKLINLI 378
             Y   ++  D W LGV LY++L    P+       M     + P   P+ +     +L+
Sbjct: 543 QGY---SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLL 599

Query: 379 IVMLAENPSLR 389
           I +L+ +P  R
Sbjct: 600 IGLLSRDPQRR 610

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 70/151 (46%), Gaps = 21/151 (13%)

Query: 244 DITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQ 303
           ++  A+  +H L V  ++RD+K EN+L+D   +  LCDFG    C         + M   
Sbjct: 453 ELLCALDNLHKLDV--VYRDLKPENILLDYQGHIALCDFG---LC--------KLNMKDD 499

Query: 304 DL--YMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHS 361
           D       TP+Y +PE++    Y    +  D W LGV LY++L    P+       M   
Sbjct: 500 DKTDTFCGTPEYLAPELLLGLGY---TKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKK 556

Query: 362 KFEFP---PNSYSSKLINLIIVMLAENPSLR 389
             + P   P+ +     +L+I +L+ +P+ R
Sbjct: 557 ILQEPLVFPDGFDRDAKDLLIGLLSRDPTRR 587

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 72/148 (48%), Gaps = 19/148 (12%)

Query: 208 EVLLLMELCPNKSLLDYM-----NQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHR 262
           ++ ++ME     SL D +     N    + L+E +I  I+ +    +  +H   +  IHR
Sbjct: 654 DLWVVMEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLHDKNI--IHR 711

Query: 263 DIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLF 322
           DIK +NVL+D     K+ DFG     F A  + Q     S+   M  TP + +PE++   
Sbjct: 712 DIKSDNVLLDTKARVKITDFG-----FCAKLTDQR----SKRATMVGTPYWMAPEVVKQK 762

Query: 323 KYIPINEKSDIWALGVFLYKLLFFTTPF 350
           +Y   + K D+W+LG+   ++L    P+
Sbjct: 763 EY---DAKVDVWSLGIMAIEMLEGEPPY 787

>KLLA0F26983g 2489326..2490729 some similarities with sp|P32801
           Saccharomyces cerevisiae YKL048c ELM1 ser/thr-specific
           protein kinase, hypothetical start
          Length = 467

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 128/272 (47%), Gaps = 37/272 (13%)

Query: 163 EVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMEL-CPNKSL 221
           E+ ++K+R E  V  KL   PN++Q  +   S    YS  I     + +L EL    +S 
Sbjct: 134 EMNVSKIRWECFVTSKL-NHPNVIQLLECLDS---PYSDQIWLIQPLAVLGELQWSRESK 189

Query: 222 LDYMNQ-----RLATKLTEQEIFKIMYDITLAVAQMHYLP-VPLIHRDIKIENVLVD-AN 274
            D + Q     R      E+   K++ DI+     + YL    +IHRD+K +N+L+D   
Sbjct: 190 FDLIEQWKSFYRGQLDSVEEFAVKVLGDIS---NGLQYLQGQGIIHRDLKPQNILLDPVY 246

Query: 275 NNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLY------MHTTPQYRSPEMIDLFK--YIP 326
           ++ ++ DFG  S   P+   F+D  +  QDL+      +  TP + +PE+ +  +     
Sbjct: 247 HSLRISDFG-CSLIVPSKLPFKDGRL--QDLFEKELNKIVGTPLFTAPELCNFAEGSAHA 303

Query: 327 INE---KSDIWALGVFLYKLLFFTTPFERTGQFAM--LHSKFEFPPNSYSSK----LINL 377
            NE   K D+W+LG+ +Y +L+   PF    +F    L    +  P+ ++S      I+ 
Sbjct: 304 SNEQPFKIDVWSLGITVYAILYNVLPFWGETEFDTYNLICHRQLKPDVHNSSNIYGWIHE 363

Query: 378 IIV--MLAENPSLRPNIYQVLYYLSEVTNREV 407
            +V  ML++N + RP    +L  L   +  E+
Sbjct: 364 YVVNRMLSKNTASRPTTSNILRTLESHSKSEL 395

>Scas_700.34
          Length = 864

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 12/94 (12%)

Query: 259 LIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEM 318
           L+HRD+K+EN+L+D + N  + DFG  S     F S  ++   S       +P Y +PE+
Sbjct: 178 LVHRDLKLENLLLDKHENLIITDFGFVS----EFYSHGELMKTSCG-----SPCYAAPEL 228

Query: 319 IDLFKYIPIN-EKSDIWALGVFLYKLLFFTTPFE 351
           +   K  P   +K+DIW+ GV LY +L    P++
Sbjct: 229 VVSTK--PYEAKKADIWSCGVILYAMLAGYLPWD 260

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 73/168 (43%), Gaps = 26/168 (15%)

Query: 233  LTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTC---- 288
            +TE E   I   I   +  +H     ++HRDIK ENV+VD+    KL DFGS +      
Sbjct: 1052 MTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVKLIDFGSAAYVKSGP 1109

Query: 289  FPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTT 348
            F  F                 T  Y +PE++    Y    +  DIWA+G+ LY L++   
Sbjct: 1110 FDVFVG---------------TIDYAAPEVLGGNPY--EGKSQDIWAIGILLYTLIYKEN 1152

Query: 349  PFERTGQFAMLHSKFEFPPNS-YSSKLINLIIVMLAENPSLRPNIYQV 395
            PF    +  +L  +  F  ++  S +   LI  +L      RP I ++
Sbjct: 1153 PFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEI 1198

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 102/226 (45%), Gaps = 37/226 (16%)

Query: 152 PACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLL 211
           P  +K++  +DE  LN+   E++++K L+   NIV+Y            G I +  E+ +
Sbjct: 35  PCAIKQIEFEDESELNEHMLEIDLLKNLRH-QNIVEY-----------RGFIQKAHELYI 82

Query: 212 LMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLV 271
           ++E C   SL D +       L E +    +      +  +H   V  IHRDIK  N+L+
Sbjct: 83  ILEYCARGSLRDILKH---GPLLEDDTVNYVTQTLYGLQYLHEQGV--IHRDIKAANLLL 137

Query: 272 DANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKS 331
                 KL DFG +       T    +AM         +P + +PE++        +  S
Sbjct: 138 TEEGIVKLADFGVS-------TRINRMAMTYAG-----SPNWMAPEVM---TGQGASTVS 182

Query: 332 DIWALGVFLYKLLFFTTPFE----RTGQFAMLHSKFEFPPNSYSSK 373
           DIW+LG  + +LL    PF      +  +A+++ ++  PP + S++
Sbjct: 183 DIWSLGATVVELLTGNPPFHNLVNESACYAIVNEEY-IPPLTLSAE 227

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 113/256 (44%), Gaps = 44/256 (17%)

Query: 155 LKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLME 214
           LK+ L  ++V L  +  E+ +++KL   PNIV++ D   S+ + Y           ++ +
Sbjct: 78  LKKALKGNDVQLQMLYDELMILQKLN-HPNIVKFKDWFESKEKFY-----------IVTQ 125

Query: 215 LCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVL-VDA 273
           L     L D + Q+   K TE +  KI+  I  AV  +H   +  +HRD+K EN+L +D 
Sbjct: 126 LATGGELFDRILQK--GKFTEVDAVKIVVQILKAVEYLHSRNI--VHRDLKPENLLYLDK 181

Query: 274 NNNFKLC--DFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKS 331
           ++N +L   DFG               A          +  Y +PE++    +    +  
Sbjct: 182 SDNSQLVLGDFGIAKELKNDGDLIHKAA---------GSMGYVAPEVLTSNGH---GKPC 229

Query: 332 DIWALGVFLYKLLFFTTPF-----------ERTGQFAMLHSKFEFPPNSYSSKLINLIIV 380
           DIW++GV  Y LL   +PF             +GQ+ +   K  +   S  +KL   I+ 
Sbjct: 230 DIWSIGVITYTLLCGYSPFIAESVDGFLEECTSGQYPVTFHKPYWNNISKEAKL--FILR 287

Query: 381 MLAENPSLRPNIYQVL 396
           +L  +P  RP    +L
Sbjct: 288 VLTISPKKRPTATDLL 303

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 106/232 (45%), Gaps = 51/232 (21%)

Query: 149 PGSPACLKRVLVQDE---VGLNKMRSEVEVMKKLQGAPNIVQYFDS-NASRLRDYSGNIT 204
           P S    K+ +V ++   +   ++  E+ +M+ +    NIV+++ + N S     S +I 
Sbjct: 125 PSSRVIAKKTIVIEQNNAIVKQQIYRELTIMRSVAEHRNIVEFYGAHNLS-----SDSIN 179

Query: 205 QGFEVLLLMELCPNKSLLDYMN------QR---LATKLT--EQEIF-------KIMYDIT 246
              +V++LME   N   LD +       QR   LA   +   QE F       +I Y + 
Sbjct: 180 GSNDVVILMEYM-NCGSLDTITRTYKSLQRRGILAANRSYPVQEWFSKPVIISRIAYSVL 238

Query: 247 LAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLY 306
             ++ + Y    +IHRDIK  NVL+++    KLCDFG +     +            D +
Sbjct: 239 NGLSYL-YENYKIIHRDIKPSNVLINSKGRIKLCDFGVSRKLNNSIA----------DTF 287

Query: 307 MHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAM 358
           + T+  Y SPE I   KY     K D+W+LG+ L +LL        TG+F +
Sbjct: 288 VGTST-YMSPERIQGNKY---TTKGDVWSLGLMLIELL--------TGEFPL 327

>Scas_640.14*
          Length = 728

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 92/209 (44%), Gaps = 38/209 (18%)

Query: 202 NITQGFEVL-------LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHY 254
           NI +  EVL       +++E         Y+ ++   +L E    ++   +   V+ MH 
Sbjct: 107 NIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRK--RRLKEATACRLFAQLISGVSYMHS 164

Query: 255 LPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYR 314
             +  +HRD+K+EN+L+D + N  + DFG  +  +       D  ++        +P Y 
Sbjct: 165 KGI--VHRDLKLENLLLDKHENLIITDFGFVNEFYA------DNELMKTSC---GSPCYA 213

Query: 315 SPEMI---DLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQ-------FAMLH---- 360
           +PE++   + +K      K+DIW+ G+ LY +L    P++   Q         + H    
Sbjct: 214 APELVITTEPYKA----RKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYHYITK 269

Query: 361 SKFEFPPNSYSSKLINLIIVMLAENPSLR 389
           +  +FP   Y++ L   +  +L  NP  R
Sbjct: 270 TPLKFPRIHYTTFLGICLRHILVSNPVRR 298

>Kwal_56.24584
          Length = 435

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 90/198 (45%), Gaps = 42/198 (21%)

Query: 172 EVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLA- 230
           E+ +M+ ++   NIV +F +       Y+ + +   E+++LME     SL   M+   A 
Sbjct: 147 ELSIMQNVKPHDNIVGFFGAF------YTASTSN--EIVILMEYMDCSSLDKIMSTYKAF 198

Query: 231 ----------TKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLC 280
                     T   E  + KI Y +   ++ + Y    +IHRDIK  NVL+++    K+C
Sbjct: 199 VARDMQSLTETWFPEFVLAKISYAVLNGLSYL-YRNYKIIHRDIKPSNVLINSKGFVKIC 257

Query: 281 DFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFL 340
           DFG +     +            D ++ T+  Y SPE I    Y   + K D+W+LG+ +
Sbjct: 258 DFGVSKKLINSIA----------DTFVGTST-YMSPERIQGSVY---STKGDVWSLGLMI 303

Query: 341 YKLLFFTTPFERTGQFAM 358
            +L+        TG+F +
Sbjct: 304 IELV--------TGEFPL 313

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 100/236 (42%), Gaps = 32/236 (13%)

Query: 169 MRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQR 228
           +  EV +  +  G  ++V+  D N SR  +Y         + + MEL     L D +   
Sbjct: 62  LTREVVLQTRCAGHRHVVRVLDCNVSR--EY---------LWIAMELADGGDLFDKIEPD 110

Query: 229 LATKLTEQEIFKIMYD-ITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTST 287
           +     + E+ +  Y  +  A+  +H     + HRDIK EN+L+D   N K+ DFG  + 
Sbjct: 111 VGV---DSEVARFYYQQLVRALTHLHE-ACGVAHRDIKPENMLLDRAGNLKVADFGLATR 166

Query: 288 CFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFT 347
               F        L++D     T  Y +PE++    Y    + +DIW+ GV ++ LL   
Sbjct: 167 ----FRRRDGTRRLARD--RRGTLPYLAPEVVGERAYHA--DTADIWSAGVLVFVLLTGE 218

Query: 348 TPFER----TGQFAMLHSK----FEFPPNSYSSKLINLIIVMLAENPSLRPNIYQV 395
           TP+       G F    +      + P        +NL+  ML + P+ R  + Q+
Sbjct: 219 TPWSEPSVDDGMFRAFVADGGNLSDGPWGKIGLVELNLLRKMLQQRPAARATLAQL 274

>Scas_720.103
          Length = 804

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/313 (23%), Positives = 125/313 (39%), Gaps = 59/313 (18%)

Query: 102 VTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERK--NDESMNQPLKPGSPACLKRVL 159
           + V     E +  L +G   ++++VK  +    +  K  N + M +  K      +KRV+
Sbjct: 398 IKVNPQSFEKIKLLGQGDVGKVFLVKEKKTNGLYAMKIYNKKDMIKREK------IKRVI 451

Query: 160 VQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNK 219
            + E+                  P IV  + S   +  DY         + L ME C   
Sbjct: 452 TEQEI------------LATSNHPFIVTLYHS--FQTEDY---------LYLCMEYCMGG 488

Query: 220 SLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKL 279
                +  R +  + E +      ++  A+  +H L    I+RD+K EN+L+  + +  L
Sbjct: 489 EFFRALQTRDSKCICEDDARFYASEVLAALEYLHLLG--FIYRDLKPENILLHKSGHIML 546

Query: 280 CDFG----STSTCFPAFTSFQDIAMLSQDLYMHT--------------TPQYRSPEMIDL 321
            DF     +  +  P F     +   + +L + T              T +Y +PE+I  
Sbjct: 547 SDFDLSVHAKDSKNPIFMKDGILPTTNSNLIVDTKICSEGFRTNSFVGTEEYIAPEVIRG 606

Query: 322 FKYIPINEKSDIWALGVFLYKLLFFTTPFE---RTGQFAMLHSK-FEFP-PNSYSSKLIN 376
             +       D W LG+ ++++LF  TPF+       FA + SK FEFP  N  +    N
Sbjct: 607 NGHTV---AVDWWTLGILIFEMLFGKTPFKGDTTNETFANILSKDFEFPNSNDITRNCKN 663

Query: 377 LIIVMLAENPSLR 389
           LI  +L +N + R
Sbjct: 664 LIKKLLTKNETKR 676

>Sklu_1722.2 YJL187C, Contig c1722 1158-3587 reverse complement
          Length = 809

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 106/236 (44%), Gaps = 41/236 (17%)

Query: 112 VSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRS 171
           VS +  G F+Q+Y V F      +  K+       ++P      KR+L + E     + S
Sbjct: 477 VSPIGTGQFSQVYQVTFGPANTRYAVKS-------IQPKKYNSRKRILQEIE-----LLS 524

Query: 172 EV-EVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLA 230
           E+ E     +G   +V Y  S   +   Y           ++ E C N SL  ++ +++ 
Sbjct: 525 EISETTLDQEGKEYVVAYISSWKHQGAYY-----------VMTEYCENGSLDGFLREQVI 573

Query: 231 ---TKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTST 287
              T+L +  ++KI+ +++LA+  +H     ++H D+K  NVL+      KL DFG  + 
Sbjct: 574 AKNTRLEDWRVWKIIVELSLALRFIHD-SCRVVHLDLKPANVLITFEGTLKLADFGMAAK 632

Query: 288 CFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKL 343
              +   F++              +Y +PE+I    Y   + ++DI++LG+ + ++
Sbjct: 633 LPISEEGFEN----------EGDREYIAPEIIADGVY---DFRADIFSLGLMIVEI 675

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/274 (21%), Positives = 115/274 (41%), Gaps = 44/274 (16%)

Query: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148
           +PQ  +     K VT G + +     L EG F ++ +        + +     + N+P+ 
Sbjct: 30  RPQDHQGPKHRKHVTFGPYVIGAT--LGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMT 87

Query: 149 PGSPA-----CLKR-VLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGN 202
              P       +KR  + +D     K+  E+  +K L   PNIV+  +            
Sbjct: 88  FKVPKQVAIKLIKRDFITKDPSKETKIYREINALKHL-SHPNIVKLEE------------ 134

Query: 203 ITQGFEVL-LLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIH 261
           + Q  + + +++E         ++ ++   +L E    ++   +  AV  +H     L+H
Sbjct: 135 VLQNSKYIGIVLEYAAGGEFYKFIQRK--RRLKENHACRLFSQLISAVHYIH--SKGLVH 190

Query: 262 RDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHT---TPQYRSPEM 318
           RD+K+EN+L+D   N  + DFG  +              L Q+  M T   +P Y +PE+
Sbjct: 191 RDLKLENLLLDNEENLIITDFGFVN------------EFLRQNGMMKTSCGSPCYAAPEL 238

Query: 319 IDLFKYIPIN-EKSDIWALGVFLYKLLFFTTPFE 351
           +      P +  K+D W+ G+ L+ +L    P++
Sbjct: 239 V--VSNRPYDARKADTWSCGIILFAMLAGYLPWD 270

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 98/229 (42%), Gaps = 47/229 (20%)

Query: 150  GSPACLKRVLV-----QDEVGLN---KMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSG 201
            G    +K+V V     QDE  ++    ++SEV  +K L    NIVQY             
Sbjct: 1061 GEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLNHV-NIVQYL------------ 1107

Query: 202  NITQGFE-----VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLP 256
                GFE       L +E     S+   +  R+  +  +Q I  +   +   +A +H   
Sbjct: 1108 ----GFEEKNGIYSLFLEYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVLEGLAYLHSKG 1161

Query: 257  VPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSP 316
            +  +HRD+K +N+L+D +   K+ DFG +      ++        + D+ M  T  + +P
Sbjct: 1162 I--LHRDMKADNLLLDNDGVCKISDFGISRKSNNIYS--------NSDMTMRGTVFWMAP 1211

Query: 317  EMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEF 365
            EM+D       + K DIW+LG  + ++     P+     F ++ + F+ 
Sbjct: 1212 EMVDTAHG--YSAKVDIWSLGCVVLEMFAGKRPW---SNFEVVAAMFQI 1255

>Scas_477.5
          Length = 703

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 92/205 (44%), Gaps = 31/205 (15%)

Query: 166 LNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYM 225
           ++ ++ E+ ++K+L    NIV Y+           G+  +G  + + +E  P  S+   +
Sbjct: 485 VDALQHEMNLLKELH-HENIVTYY-----------GSSQEGPNLNIFLEYVPGGSVSSML 532

Query: 226 NQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGST 285
           N        E  I   +  + + VA +H   +  IHRDIK  N+L+D     K+ DFG +
Sbjct: 533 NNY--GPFEESLIVNFIRQVLIGVAYLHNKNI--IHRDIKGANILIDTKGCVKITDFGIS 588

Query: 286 STCFPAFTSFQDI-AMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLL 344
               P   S QD  A L   +Y      + +PE++   K     EK+DIW+ G  + ++ 
Sbjct: 589 KKLSPL--SKQDKRASLQGSVY------WMAPEVV---KQTATTEKADIWSTGCVVIEMF 637

Query: 345 FFTTPFERTGQFAMLHSKFEFPPNS 369
               PF     F+ + + F+   N+
Sbjct: 638 TGKHPFP---DFSQMQTIFKIGTNT 659

>Scas_678.24
          Length = 1610

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 93/202 (46%), Gaps = 23/202 (11%)

Query: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQ--EIFKIMYDITLAVAQMHYLPVPLIHRDIKI 266
           + + ME C N++L D ++      L+ Q  E +++   I  A++ +H     +IHRD+K 
Sbjct: 736 LFIQMEYCENRTLYDLIHTE---NLSNQRDEYWRLFRQILEALSYIH--SQGIIHRDLKP 790

Query: 267 ENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIP 326
            N+ +D + N K+ DFG       +     DI  L     + +T    S     L+    
Sbjct: 791 MNIFIDESRNVKIGDFGLAKNVHRSL----DILKLDSQSVVGSTENLTSAIGTALYVATE 846

Query: 327 I-------NEKSDIWALGVFLYKLLF-FTTPFERTGQFAMLH-SKFEFPPNSYSSKL--- 374
           +       NEK D+++LG+  +++++ F T  ER      L  +  +FP +   +K    
Sbjct: 847 VLNGKGNYNEKIDMYSLGIIFFEMIYPFGTGMERVNSLKDLRLASIKFPTDFDENKQRVE 906

Query: 375 INLIIVMLAENPSLRPNIYQVL 396
             +I ++L  +P+ RP    +L
Sbjct: 907 KKIIKLLLDHDPTKRPGARTLL 928

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 90/202 (44%), Gaps = 44/202 (21%)

Query: 155 LKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLME 214
           +K+VL QD+   N+   E+E+MK LQ           N   L+ Y   I +  +V L + 
Sbjct: 65  IKKVL-QDKRFKNR---ELEIMKMLQ---------HRNIIDLKYYFYEIDEREDVFLNL- 110

Query: 215 LCPNKSLLDYMNQRLATKLTE----------QEIFKIMYDITLAVAQMHYLPVPLIHRDI 264
                 +LDYM Q L  +L             EI   MY +  A+  +H+    + HRDI
Sbjct: 111 ------ILDYMPQSLYQRLRHFVHQRTPMPRLEIKIYMYQLFKALNYLHH-TANVCHRDI 163

Query: 265 KIENVLVDANN-NFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFK 323
           K +N+LVD N+   +LCDFGS     P   +   I           +  YR+PE+I  F 
Sbjct: 164 KPQNLLVDPNSWCLRLCDFGSAKQLKPTEPNVSYIC----------SRYYRAPELI--FG 211

Query: 324 YIPINEKSDIWALGVFLYKLLF 345
                 + DIW+ G  + +LL 
Sbjct: 212 ATNYTNQIDIWSSGCVMAELLL 233

>ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH]
           (1263082..1265541) [2460 bp, 819 aa]
          Length = 819

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 77/346 (22%), Positives = 132/346 (38%), Gaps = 78/346 (22%)

Query: 85  PPVAQ-PQIEEKFPAGK--VVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDE 141
           PP A+ P    + P  K  V+TV     E V  L  GG +++Y V+              
Sbjct: 465 PPSAEVPANVHQLPQRKRQVITVNGSEYEKVELLGRGGSSKVYKVR-------------N 511

Query: 142 SMNQPLKPGSPACLKRVLVQ--DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDY 199
           S N+         LKRV     D+   +  + E+E++KKL+    +V+  D         
Sbjct: 512 SSNRIY------ALKRVSFDEFDDASADGFKGEIELLKKLENQTRVVKLIDHE------- 558

Query: 200 SGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPL 259
              +  G  VL ++  C +  L   + QR +  L  + +     ++   V  +H     +
Sbjct: 559 ---MNHG--VLYVVMECGDHDLSQVLAQRSSMPLDIEFVRYHAQEMLKCVKVVH--DAGI 611

Query: 260 IHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHT---TPQYRSP 316
           +H D+K  N  V      K+ DFG  +   P  T          ++Y  T   TP Y +P
Sbjct: 612 VHSDLKPAN-FVFVKGILKIIDFG-IANAVPDHTV---------NIYRDTQIGTPNYMAP 660

Query: 317 EMIDLFKYI---------------PINEKSDIWALGVFLYKLLFFTTPFER-TGQFAML- 359
           E +    Y                 + + SDIW+ G  +Y++++   P+    GQ  +L 
Sbjct: 661 EALVAMNYTQDSDQIQQEMHHNRWKVGKPSDIWSCGCIMYQMIYGKPPYGSFQGQNRLLA 720

Query: 360 ----HSKFEFPPNSYSSKLI-----NLIIVMLAENPSLRPNIYQVL 396
                 K  +P  + +   +     + I   L  NP  R  + ++L
Sbjct: 721 IMNPEVKIVYPEKTPTGDFVPRTALDTIKACLERNPERRWTVDELL 766

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 87/190 (45%), Gaps = 22/190 (11%)

Query: 166 LNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNIT--QGFEVLLLMELCPNKSL-L 222
           +N M ++ E  K++       + F S+   +  Y G  T  Q   + + ME    KSL  
Sbjct: 245 INTMNTDPEYQKQIFRELQFNKSFKSDY--IVQYYGMFTDEQSSSIYIAMEYMGGKSLEA 302

Query: 223 DYMNQ-RLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCD 281
            Y N  +   +++E+ I KI   +   ++ +H   V  IHRDIK +N+L++     KLCD
Sbjct: 303 TYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKV--IHRDIKPQNILLNEKGEIKLCD 360

Query: 282 FGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLY 341
           FG +             A+ S  +    T  Y +PE I   +  P +   D+W+LG+ L 
Sbjct: 361 FGVSGE-----------AVNSLAMTFTGTSFYMAPERI---QGQPYSVTCDVWSLGLTLL 406

Query: 342 KLLFFTTPFE 351
           ++     PFE
Sbjct: 407 EVAGGRFPFE 416

>Kwal_33.14081
          Length = 580

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 111/272 (40%), Gaps = 43/272 (15%)

Query: 154 CLKRVLVQ-DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLL 212
            +K V ++ DE    ++  E+EV+ K Q +P IV +          Y     +G  V + 
Sbjct: 301 AMKEVRLELDESKFTQILMELEVLHKCQ-SPYIVDF----------YGAFFIEG-AVYMC 348

Query: 213 MELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVD 272
           ME     SL    +  +   + E E+  I   I   + ++  +   +IHRD+K  NVL  
Sbjct: 349 MEYMDGGSLDKSYDSDVLGGIDEPELAYIANAIIQGLKELKDVH-NIIHRDVKPTNVLCS 407

Query: 273 A-NNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFK--YIPINE 329
           A     KLCDFG +     +     +I   S          Y +PE I  F         
Sbjct: 408 AAQGTVKLCDFGVSGNLVASLAK-TNIGCQS----------YMAPERIKSFNPDKATYTV 456

Query: 330 KSDIWALGVFLYKLLFFTTPFERT---GQFAMLHSKFEFPP-----NSYSSKLINLIIVM 381
           +SDIW+LG+ + ++   T P+        F+ L +  + PP       +S    + + + 
Sbjct: 457 QSDIWSLGLSILEMAIGTYPYPVETFDNIFSQLSAIVDSPPPQLPKGRFSPMAQDFVNMC 516

Query: 382 LAENPSLRPNIYQVL-------YYLSEVTNRE 406
           L + P  R N   +L       ++LSEV   E
Sbjct: 517 LQKIPERRRNYAALLEHPWLKTHHLSEVNMSE 548

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 118/294 (40%), Gaps = 64/294 (21%)

Query: 157 RVLVQDEVGLNKMRS--------EVEVMKKLQGAPNIVQYFD-SNASRLRDYSGNITQGF 207
           +++V+ E+    M S        E  ++  L+   NIV++++  +AS     S +   G 
Sbjct: 51  KLMVRKEIKYGHMNSKERQQLIAECTILAGLR-HENIVEFYNWDHASSRTGNSVDYGNGE 109

Query: 208 EVLLLMELCPNKSLLDYMNQRLATK--LTEQEIFKIMYDITLAVAQMHY---LP------ 256
            + L ME C    L   +      +  + E++I++I   + LA+ + H    LP      
Sbjct: 110 VLYLYMEYCSCGDLSQMIKHYKGMRKYVPERDIWRIAVQLLLALYKCHTSCDLPQLDTIY 169

Query: 257 ---------------VPLIHRDIKIENVLVDANN------------NFKLCDFGSTSTCF 289
                            +IHRD+K  N+ +  +               KL DFG   +  
Sbjct: 170 DKISKSAIESEAGKVTSVIHRDLKPGNIFLTGDGVGGRGSVDYSKVEVKLGDFGLAKSLQ 229

Query: 290 PAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTP 349
            A   F    +         TP Y SPE++    Y P+   SDIW+LG  +Y+L     P
Sbjct: 230 SAI-EFATTYV--------GTPYYMSPEVLMDQPYSPL---SDIWSLGCVIYELCALRVP 277

Query: 350 FERTG----QFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVLYYL 399
           F        Q  +  +  +  P+ YS +L  L+I  +  N  LRP+ + +L  L
Sbjct: 278 FPARNFMELQRMIQRADVQPLPDYYSKELQQLVISCINPNEKLRPSAFDLLQCL 331

>Kwal_33.14192
          Length = 577

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 68/149 (45%), Gaps = 13/149 (8%)

Query: 203 ITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHR 262
           + +G   L++ME CP     D+ N  ++  +++ EI      I   V  +H +   L HR
Sbjct: 289 LQEGTNFLVVMEYCP----YDFFNLVMSDLMSKNEISCYFKQICNGVDYLHRMG--LAHR 342

Query: 263 DIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLF 322
           D+K++N +V      KL DFGS       F    +  +L     + + P Y +PE++   
Sbjct: 343 DLKLDNCVVTKQGILKLIDFGSAV----VFQYPYEKEILRAKGIVGSDP-YLAPELLSHP 397

Query: 323 KYIPINEKSDIWALGVFLYKLLFFTTPFE 351
            Y P     D+W++ +  Y +     P++
Sbjct: 398 SYDP--RPVDVWSIAIMFYCITLKRFPWK 424

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 31,502,515
Number of extensions: 1430887
Number of successful extensions: 5369
Number of sequences better than 10.0: 702
Number of HSP's gapped: 5025
Number of HSP's successfully gapped: 735
Length of query: 976
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 865
Effective length of database: 12,753,511
Effective search space: 11031787015
Effective search space used: 11031787015
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)