Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K11968g49548726170.0
YDR036C (EHD3)50045214630.0
Scas_661.2652348614490.0
Kwal_56.2308747645511561e-155
KLLA0F18678g50445811481e-153
AGR024C47746210001e-131
Scas_526.2304168840.027
Sklu_1261.180378770.24
YOL034W (SMC5)109354740.53
YOR180C (DCI1)271183691.8
YOR270C (VPH1)84079702.0
Kwal_23.292083651674.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K11968g
         (487 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K11968g complement(1153196..1154683) similar to sp|P28817 S...  1012   0.0  
YDR036C (EHD3) [889] chr4 complement(523206..524708) Member of t...   568   0.0  
Scas_661.26                                                           562   0.0  
Kwal_56.23087                                                         449   e-155
KLLA0F18678g 1716890..1718404 similar to sp|P28817 Saccharomyces...   446   e-153
AGR024C [4334] [Homologous to ScYDR036C - SH] (759545..760978) [...   389   e-131
Scas_526.2                                                             37   0.027
Sklu_1261.1 YOR270C, Contig c1261 283-2694 reverse complement          34   0.24 
YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing ...    33   0.53 
YOR180C (DCI1) [4977] chr15 complement(674352..675167) Peroxisom...    31   1.8  
YOR270C (VPH1) [5056] chr15 complement(828049..830571) Vacuolar ...    32   2.0  
Kwal_23.2920                                                           30   4.0  

>CAGL0K11968g complement(1153196..1154683) similar to sp|P28817
           Saccharomyces cerevisiae YDR036c, hypothetical start
          Length = 495

 Score = 1012 bits (2617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/487 (100%), Positives = 487/487 (100%)

Query: 1   MLRAPAAGFPRLIQKTSYRAFSSTLAKMSESETPVLFSVQETARIVTLNRPKKLNALNEE 60
           MLRAPAAGFPRLIQKTSYRAFSSTLAKMSESETPVLFSVQETARIVTLNRPKKLNALNEE
Sbjct: 1   MLRAPAAGFPRLIQKTSYRAFSSTLAKMSESETPVLFSVQETARIVTLNRPKKLNALNEE 60

Query: 61  MCSSIFNTLTEYSKSDAANLILIKSNNSPRSLCAGGDVASVAQSNLDKNFESSINCFKSE 120
           MCSSIFNTLTEYSKSDAANLILIKSNNSPRSLCAGGDVASVAQSNLDKNFESSINCFKSE
Sbjct: 61  MCSSIFNTLTEYSKSDAANLILIKSNNSPRSLCAGGDVASVAQSNLDKNFESSINCFKSE 120

Query: 121 YSLNFQLATYQKPVVVFMDGITMGGGVGLSIHTPFRIATENTKWAMPETDIGFFPDVGTT 180
           YSLNFQLATYQKPVVVFMDGITMGGGVGLSIHTPFRIATENTKWAMPETDIGFFPDVGTT
Sbjct: 121 YSLNFQLATYQKPVVVFMDGITMGGGVGLSIHTPFRIATENTKWAMPETDIGFFPDVGTT 180

Query: 181 FALPRLITLANKNAQMALYLCLTGDVISGEDAYLLGLASHYIPHSNLEKLQTRLGELRPA 240
           FALPRLITLANKNAQMALYLCLTGDVISGEDAYLLGLASHYIPHSNLEKLQTRLGELRPA
Sbjct: 181 FALPRLITLANKNAQMALYLCLTGDVISGEDAYLLGLASHYIPHSNLEKLQTRLGELRPA 240

Query: 241 LDIKFFSDEFFDSVNLAIEEFTTPLPTNHKFKFSKDQLEVIEKCFDISSGESINAIFSKL 300
           LDIKFFSDEFFDSVNLAIEEFTTPLPTNHKFKFSKDQLEVIEKCFDISSGESINAIFSKL
Sbjct: 241 LDIKFFSDEFFDSVNLAIEEFTTPLPTNHKFKFSKDQLEVIEKCFDISSGESINAIFSKL 300

Query: 301 EAFEGTPEMMQFARDTKKKLESKSMTSMQVGIRLMQENSRDDIESALKRDLTTAVNMCVN 360
           EAFEGTPEMMQFARDTKKKLESKSMTSMQVGIRLMQENSRDDIESALKRDLTTAVNMCVN
Sbjct: 301 EAFEGTPEMMQFARDTKKKLESKSMTSMQVGIRLMQENSRDDIESALKRDLTTAVNMCVN 360

Query: 361 DSGIAEFSAATKHKLLDKQKVPYPWKQRTELTPQQVTSLIAPKPSLPVSLIRNNSNVTWS 420
           DSGIAEFSAATKHKLLDKQKVPYPWKQRTELTPQQVTSLIAPKPSLPVSLIRNNSNVTWS
Sbjct: 361 DSGIAEFSAATKHKLLDKQKVPYPWKQRTELTPQQVTSLIAPKPSLPVSLIRNNSNVTWS 420

Query: 421 QYPHSLKYQLPRDYEIEQQVEKLIKRGPIKKNDVVKYFTDFNPQTKAKLGVEQYCDLLFD 480
           QYPHSLKYQLPRDYEIEQQVEKLIKRGPIKKNDVVKYFTDFNPQTKAKLGVEQYCDLLFD
Sbjct: 421 QYPHSLKYQLPRDYEIEQQVEKLIKRGPIKKNDVVKYFTDFNPQTKAKLGVEQYCDLLFD 480

Query: 481 WKLSFDH 487
           WKLSFDH
Sbjct: 481 WKLSFDH 487

>YDR036C (EHD3) [889] chr4 complement(523206..524708) Member of the
           enoyl-coA hydratase/isomerase protein family [1503 bp,
           500 aa]
          Length = 500

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/452 (58%), Positives = 342/452 (75%), Gaps = 3/452 (0%)

Query: 34  PVLFSVQETARIVTLNRPKKLNALNEEMCSSIFNTLTEYSKSDAANLILIKSNNSPRSLC 93
           PVLF+VQ+TAR++TLNRPKKLNALN EM  S+F TL EY+KSD  NL+++KS+N PRS C
Sbjct: 38  PVLFTVQDTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFC 97

Query: 94  AGGDVASVAQSNLDKNFESSINCFKSEYSLNFQLATYQKPVVVFMDGITMGGGVGLSIHT 153
           AGGDVA+VA  N +K F  SI  F  EYSLNFQ+ATY KP+V FMDGITMGGGVGLSIHT
Sbjct: 98  AGGDVATVAIFNFNKEFAKSIKFFTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHT 157

Query: 154 PFRIATENTKWAMPETDIGFFPDVGTTFALPRLITLANKNAQMALYLCLTGDVISGEDAY 213
           PFRIATENTKWAMPE DIGFFPDVG+TFALPR++TLAN N+QMALYLCLTG+V++G DAY
Sbjct: 158 PFRIATENTKWAMPEMDIGFFPDVGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAY 217

Query: 214 LLGLASHYIPHSNLEKLQTRLGELRPALDIKFFSDEFFDSVNLAIEEFTTPLPTNHKFKF 273
           +LGLASHY+   NL+ LQ RLGE+ P  +    S  FF  VN +I+EF +PLP ++ FK+
Sbjct: 218 MLGLASHYVSSENLDALQKRLGEISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKY 277

Query: 274 SKDQLEVIEKCFDISSGESINAIFSKLEAFEGTPEMMQFARDTKKKLESKSMTSMQVGIR 333
           S ++L VIE CF++S   +I  I + L  +EG+ E   FA++ K KL +KS +S+Q+ +R
Sbjct: 278 SNEKLNVIEACFNLSKNGTIEDIMNNLRQYEGSAEGKAFAQEIKTKLLTKSPSSLQIALR 337

Query: 334 LMQENSRDDIESALKRDLTTAVNMCVNDSGIAEFSAATKHKLLDKQKVPYPWKQRTELTP 393
           L+QENSRD IESA+KRDL TA NMC+N   + EFS ATKHKL+DKQ+VPYPW ++ +L  
Sbjct: 338 LVQENSRDHIESAIKRDLYTAANMCMNQDSLVEFSEATKHKLIDKQRVPYPWTKKEQLFV 397

Query: 394 QQVTSLIAPKPSLPVSLIRNNSNVTWSQYPHSLKYQLPRDYEIEQQVEKLIKR---GPIK 450
            Q+TS+ +PKPSLP+SL+RN SNVTW+QYP+  KYQLP + EI   +EK         + 
Sbjct: 398 SQLTSITSPKPSLPMSLLRNTSNVTWTQYPYHSKYQLPTEQEIAAYIEKRTNDDTGAKVT 457

Query: 451 KNDVVKYFTDFNPQTKAKLGVEQYCDLLFDWK 482
           + +V+ +F +  P  + KLG++  C ++ + K
Sbjct: 458 EREVLNHFANVIPSRRGKLGIQSLCKIVCERK 489

>Scas_661.26
          Length = 523

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/486 (56%), Positives = 355/486 (73%), Gaps = 11/486 (2%)

Query: 11  RLIQKTSYRAFSSTLAKMSESETPVLFSVQETARIVTLNRPKKLNALNEEMCSSIFNTLT 70
           +L+ K   R+  S+   M E+  PVLFS+Q+TAR+VTLNRP KLNALN EMC S+F  L 
Sbjct: 29  KLLLKNFKRSLMSSSIVMKEA-APVLFSMQDTARVVTLNRPAKLNALNFEMCQSMFQILN 87

Query: 71  EYSKSDAANLILIKSNNSPRSLCAGGDVASVAQSNLDKNFESSINCFKSEYSLNFQLATY 130
           EYSKSDA NLI++KS++  RSLCAGGDVA+VA  NL+ N + +I  F++EYSLN Q+ATY
Sbjct: 88  EYSKSDATNLIIVKSSDKGRSLCAGGDVATVAVQNLNGNHKKAIEFFEAEYSLNLQMATY 147

Query: 131 QKPVVVFMDGITMGGGVGLSIHTPFRIATENTKWAMPETDIGFFPDVGTTFALPRLITLA 190
            KP+V +M+GITMGGGVGLS+HTPFRIATENTKWAMPE DIGFFPDVGTTFALPRL+T+A
Sbjct: 148 PKPIVTYMNGITMGGGVGLSVHTPFRIATENTKWAMPEMDIGFFPDVGTTFALPRLVTMA 207

Query: 191 NKNAQMALYLCLTGDVISGEDAYLLGLASHYIPHSNLEKLQTRLGELRPALDIKF----F 246
           N ++QMALYLCLTG+V++GEDAY+LGLASHY+   NL+ L+ RLGEL P   I       
Sbjct: 208 NNHSQMALYLCLTGEVLNGEDAYMLGLASHYVNSENLQSLEVRLGELTPTKHITADPAKS 267

Query: 247 SDEFFDSVNLAIEEFTTPLPTNHKFKFSKDQLEVIEKCFDISSGESINAIFSKLEAFEGT 306
           S  FFD VN  I EF+T LP ++KFKF+ DQL+VIE CFDI+   SI  I   L+ +  +
Sbjct: 268 SAIFFDMVNGTINEFSTNLPMDYKFKFTTDQLDVIESCFDITRHTSIEEILRSLDQYAKS 327

Query: 307 PEMMQFARDTKKKLESKSMTSMQVGIRLMQENSRDDIESALKRDLTTAVNMCVNDSGIAE 366
              + F  + K KL +KSMTSMQ+ +++++ENSRDDI SAL+RDL TA NMCVN+ G++E
Sbjct: 328 EAGISFCTEIKNKLATKSMTSMQIALKVLKENSRDDINSALRRDLFTASNMCVNEEGVSE 387

Query: 367 FSAATKHKLLDKQKVPYPWKQRTELTPQQVTSLIAPKPSLPVSLIRNNSNVTWSQYPHSL 426
           FS ATKHKL+DKQK PYPWK  + ++P  + ++++PK S PVSL  N SN+TW QYP+  
Sbjct: 388 FSEATKHKLVDKQKTPYPWKHNSVISPNLLRAMVSPKLSTPVSLWENFSNITWDQYPYHS 447

Query: 427 KYQLPRDYEIEQQVEKL------IKRGPIKKNDVVKYFTDFNPQTKAKLGVEQYCDLLFD 480
           KYQLP +  I+Q + ++           I KN+V+K+FT  N  TK K  V   C+++ +
Sbjct: 448 KYQLPSEQSIKQYLRRVSGHQDGATSAFITKNEVLKHFTRTNKLTKDKSDVALICNIICE 507

Query: 481 WKLSFD 486
            K + D
Sbjct: 508 RKCNMD 513

>Kwal_56.23087
          Length = 476

 Score =  449 bits (1156), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 227/455 (49%), Positives = 306/455 (67%), Gaps = 13/455 (2%)

Query: 35  VLFSVQETARIVTLNRPKKLNALNEEMCSSIFNTLTEYSKSDAANLILIKSNNSPRSLCA 94
           V F  +  +R+VTL RP+KLNAL+ +MC  I  TL EY+KSD  N+++IKS+N+PRSLCA
Sbjct: 19  VKFGSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSDVNNIVIIKSSNAPRSLCA 78

Query: 95  GGDVASVAQSNLDKNFESSINCFKSEYSLNFQLATYQKPVVVFMDGITMGGGVGLSIHTP 154
           GGDVA+VA  NL    +SS+  F+SEYSLN  LATY KPVVV MDGITMGGGVGL+ H P
Sbjct: 79  GGDVANVALQNLAGKLDSSLEFFQSEYSLNLLLATYNKPVVVLMDGITMGGGVGLATHVP 138

Query: 155 FRIATENTKWAMPETDIGFFPDVGTTFALPRLITLANKNAQMALYLCLTGDVISGEDAYL 214
           FRIATENT+W MPE DIGFFPDVGTTF+LP++ T+     Q+ALYLCLTGD++SG D Y+
Sbjct: 139 FRIATENTRWCMPEMDIGFFPDVGTTFSLPKITTVGGVKGQLALYLCLTGDLLSGVDVYM 198

Query: 215 LGLASHYIPHSNLEKLQTRLGELRPALDIKFFSDEFFDSVNLAIEEFTTPLPTNHKFKFS 274
            GLASHY+P  NLE LQ RLGEL P  +    S+E +     A+EEF+  +P ++ FK+S
Sbjct: 199 AGLASHYVPSHNLEDLQARLGEL-PVTN----SEEMWKITGDALEEFSVAIPEDYNFKYS 253

Query: 275 KDQLEVIEKCFDISSG-ESINAIFSKL-EAFEGTPEMMQFARDTKKKLESKSMTSMQVGI 332
             QL VIE CF   +G + I A   K+  +   +PE  +F+R T +KL SKS  S+QV I
Sbjct: 254 NAQLNVIETCFGPENGLKGIRAALEKIVNSSSASPEEKEFSRVTLQKLASKSPVSLQVAI 313

Query: 333 RLMQENSRDDIESALKRDLTTAVNMCVNDSGIAEFSAATKHKLLDKQKVPYPWKQRTELT 392
                NS+ DIESALK+DL TA NMC  +  ++EFS ATKHKL+DK K P+ W  +T LT
Sbjct: 314 EQFHRNSQSDIESALKQDLVTASNMC--EDTVSEFSQATKHKLVDKSKAPFQWT-KTALT 370

Query: 393 PQQVTSLIAPKPSLPVSLIRNNSNVTWSQYPHSLKYQLPRDYEIEQQVEKLIKRG---PI 449
            ++++ L++P+ +  VSL +   ++TW +YP+  ++ LP +  ++  +      G     
Sbjct: 371 VEELSRLVSPRAATSVSLQKFPDSLTWKKYPYHSQFMLPTEQNLKDYITGNDNSGRSLAA 430

Query: 450 KKNDVVKYFTDFNPQTKAKLGVEQYCDLLFDWKLS 484
              +V+KYF+ +NP +K K G+   CD +   K S
Sbjct: 431 NHAEVLKYFSQYNPSSKGKTGIRYLCDQICSRKCS 465

>KLLA0F18678g 1716890..1718404 similar to sp|P28817 Saccharomyces
           cerevisiae YDR036c singleton, start by similarity
          Length = 504

 Score =  446 bits (1148), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 230/458 (50%), Positives = 300/458 (65%), Gaps = 14/458 (3%)

Query: 35  VLFSVQETARIVTLNRPKKLNALNEEMCSSIFNTLTEYSKSDAANLILIKSNNSPRSLCA 94
           V F V  TAR+VTL+RPKKLNAL+ EMCS+I  TL EY+KS   N++++ S+ SPR+ C+
Sbjct: 33  VKFRVDSTARVVTLDRPKKLNALDVEMCSAILPTLQEYAKSTVNNVVILNSSASPRAFCS 92

Query: 95  GGDVASVAQSNLDKNFESSINCFKSEYSLNFQLATYQKPVVVFMDGITMGGGVGLSIHTP 154
           GGDVA VA+   + NF+ +   F  EYSLN  LAT  KPV+  MDGITMGGGVGLS H P
Sbjct: 93  GGDVAQVAKLVKEGNFDYAREFFTKEYSLNLALATLNKPVISIMDGITMGGGVGLSTHIP 152

Query: 155 FRIATENTKWAMPETDIGFFPDVGTTFALPRLITLANKNAQMALYLCLTGDVISGEDAYL 214
           FRIATENT+WAMPE DIGFFPDVG TF++P+L T+   N Q+A YLC+TGD+++G DAY+
Sbjct: 153 FRIATENTRWAMPEMDIGFFPDVGATFSIPKLTTVGGSNGQLAQYLCMTGDILNGADAYV 212

Query: 215 LGLASHYIPHSNLEKLQTRLGELR---PALDIKFFSDEFFDSVNLAIEEFTTPLPTNHKF 271
            G+ASHY+PH  +  LQ RL EL             DE FD VN AIEEF  PLP ++KF
Sbjct: 213 AGVASHYVPHDQISNLQARLAELHLTEATSQSTNRDDEIFDVVNHAIEEFNAPLPRDYKF 272

Query: 272 KFSKDQLEVIEKCFDISSGESINAIFSKL-EAFEG---TPEMMQFARDTKKKLESKSMTS 327
           K++ D+L VIE+CFDI  G S+  I+SKL E   G   +    +FA  TK+ L SKS  S
Sbjct: 273 KYTADELNVIEQCFDI--GNSLKQIYSKLDEVIAGKTVSQTAQEFAAKTKQMLASKSPVS 330

Query: 328 MQVGIRLMQENSRDDIESALKRDLTTAVNMCVNDSGIAEFSAATKHKLLDKQKVPYPWKQ 387
           +++   L Q NS  DI++AL +DL TA  M      + EF+ AT HKLL+K K PY WK 
Sbjct: 331 LEIAKELFQRNSFTDIQTALTQDLITATKMS-ESPDLCEFAEATSHKLLEKNKTPYQWKI 389

Query: 388 RTELTPQQVTSLIAPKPSLPVSLIRNNSNVTWSQYPHSLKYQLPRDYEIEQQVEKLIKRG 447
           + +L   Q++ LI+   S PVSLIR ++ VT+S+YPH  KYQLP +  +E+ +      G
Sbjct: 390 K-DLKLAQISVLISQNSSNPVSLIRPSNLVTFSEYPHHSKYQLPNETLVEKYITGADNHG 448

Query: 448 ---PIKKNDVVKYFTDFNPQTKAKLGVEQYCDLLFDWK 482
               + K + VK+F   NP TK+K GV+     + D K
Sbjct: 449 RQTAVTKKEAVKFFQQLNPATKSKTGVDYLVGFIIDRK 486

>AGR024C [4334] [Homologous to ScYDR036C - SH] (759545..760978)
           [1434 bp, 477 aa]
          Length = 477

 Score =  389 bits (1000), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 201/462 (43%), Positives = 290/462 (62%), Gaps = 20/462 (4%)

Query: 35  VLFSVQETARIVTLNRPKKLNALNEEMCSSIFNTLTEYSKSDAANLILIKSNNSPRSLCA 94
           V F    TAR+VTLNRP+KLNA+N E+C SI   + EY+KSD AN+I+  S  +PR+ CA
Sbjct: 19  VKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSDVANVIVFDSACAPRAFCA 78

Query: 95  GGDVASVAQSNLDKNFESSINCFKSEYSLNFQLATYQKPVVVFMDGITMGGGVGLSIHTP 154
           GGD+  +A++      E   + F+ EY++N+ LATY KPVV  MDGITMGGGVGL+IH P
Sbjct: 79  GGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVALMDGITMGGGVGLTIHVP 138

Query: 155 FRIATENTKWAMPETDIGFFPDVGTTFALPRLITLANKNAQMALYLCLTGDVISGEDAYL 214
           FR+ATENTKWAMPE DIG  PDVG +FALPR++TL  +  Q+  YLCLTG+V+ G D Y+
Sbjct: 139 FRVATENTKWAMPELDIGLHPDVGVSFALPRIMTLGGQEGQLGYYLCLTGEVLQGADVYM 198

Query: 215 LGLASHYIPHSNLEKLQTRLGELRPALDIKFFSDEFFDSVNLAIEEFTTPLPTNHKFKFS 274
            GLASHY+  +    L+ RLG     + I   +DE F + N  IEEF++PLP  ++FK++
Sbjct: 199 AGLASHYVESTQHGALKERLG----TVPITRKADETFANTNAVIEEFSSPLPDGYQFKYN 254

Query: 275 KDQLEVIEKCF--DISSGESINAIFSKLEAFEGTPE----MMQFARDTKKKLESKSMTSM 328
           K++L+VIE+ F  D+S  E    +   LEAF  +         FA+ T +KL +KS  S 
Sbjct: 255 KEELDVIERFFHYDVSYKE----LRKNLEAFASSNANSEVARNFAKATLEKLSTKSTVSA 310

Query: 329 QVGIRLMQENSRDDIESALKRDLTTAVNMCVNDSGIAEFSAATKHKLLDKQKVPYPWKQR 388
           ++     + NS+ DI+SA+K+DL T+ N+  N+  +AEF  A  HKL++K K PY WK  
Sbjct: 311 EITREQFRRNSQRDIQSAMKQDLITSTNLLRNNE-LAEFENAVIHKLVEKAKTPYEWKN- 368

Query: 389 TELTPQQVTSLIAPKPSLPVSLIRNNSNVTWSQYPHSLKYQLPRDYEIEQQVEKLIKRG- 447
           T  +   ++ L+A  P+ P+ L+     VT+  Y +  K+ LP +  ++  +    + G 
Sbjct: 369 TSPSVADISKLLAADPANPIDLLE-TFGVTFKNYRYHNKFTLPTEAAVQAYITGTDQSGR 427

Query: 448 --PIKKNDVVKYFTDFNPQTKAKLGVEQYCDLLFDWKLSFDH 487
              + + + VKYFT+FNP ++ K+G E   +L+ D K   D+
Sbjct: 428 SMAVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKCRMDN 469

>Scas_526.2
          Length = 304

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 79/168 (47%), Gaps = 8/168 (4%)

Query: 35  VLFSVQETARIVTLNRPKKLNALNEEMCSSIFNTLTEYSKSDAANLILIKSNNSPRSLCA 94
           V ++++    I+ LN P+ LN+L  +    I   L + +  D+  + +++S  S +   +
Sbjct: 36  VSYTIEGPIFIIKLNDPRHLNSLTFDDFVYIAMLLEKANSDDSIFITVLQS--SAKFFSS 93

Query: 95  GGDVASVAQSNLDKNFESSINCFKSEYS-----LNFQLATYQKPVVVFMDGITMGGGVGL 149
           GG   +V +S   ++   S+N      S     +     T++K +V  ++G  +G    +
Sbjct: 94  GGKFEAVLESKGKEDDIGSLNNLIGMISSPNVFVANAFRTHEKLLVCCLNGPAVGLSACI 153

Query: 150 SIHTPFRIATENTKWAM-PETDIGFFPDVGTTFALPRLITLANKNAQM 196
            +      A +++ + + P +++GF  +VG++  LP  + +   N  +
Sbjct: 154 VMLCDLVYARDDSVYLLFPFSNLGFVAEVGSSVTLPMKLGINKANEHL 201

>Sklu_1261.1 YOR270C, Contig c1261 283-2694 reverse complement
          Length = 803

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 217 LASHYIPHSNLEKLQTRLGELRPALDIKFFSDEFFDSVNLAIEEFTTPLPTNHKFKFSKD 276
           +A  +IP  +LE LQ +LGEL   L I         S+   +E   TP PT H+     +
Sbjct: 315 IAEGWIPKDDLESLQEQLGELTTTLGID------VPSIVNVLETNKTP-PTFHRVNKFTE 367

Query: 277 QLEVIEKCFDISSGESIN 294
             + I  C+ I++   +N
Sbjct: 368 AFQNICDCYGIATYREVN 385

>YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing an
           SMC domain N-terminal domain, which bind ATP in
           chromosome-associated proteins, has low similarity to S.
           pombe Spr18p, which is likely to be involved in the
           maintenance of chromosome structure [3282 bp, 1093 aa]
          Length = 1093

 Score = 33.1 bits (74), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 3/54 (5%)

Query: 388 RTELTPQQVTSLIAPKPSLPV---SLIRNNSNVTWSQYPHSLKYQLPRDYEIEQ 438
           R ELTP Q+  LI P+P+  +    +I  N  V   Q  +  K   P D  I+Q
Sbjct: 589 RRELTPAQIKKLITPRPNGKILFKRIIHGNRLVDIKQSAYGSKQVFPTDVSIKQ 642

>YOR180C (DCI1) [4977] chr15 complement(674352..675167) Peroxisomal
           dienoyl-CoA isomerase [816 bp, 271 aa]
          Length = 271

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 79/183 (43%), Gaps = 27/183 (14%)

Query: 45  IVTLNRPKKLNALNEEMCSSIFNTLTEYSKSDAANLILIKSNNSPRSLCAGGDVASVAQS 104
           I+ L  PK LN+L  E    ++  L  +  +D  +++     +S +   +GG  ++V + 
Sbjct: 15  IIKLIDPKHLNSLTFE--DFVYIALLLHKANDIDSVLFTVLQSSGKYFSSGGKFSAVNKL 72

Query: 105 NLDKNFESSI-------------NCFKSEYSLNFQLATYQKPVVVFMDGITMGGGVGLSI 151
           N D +  S +             N F +        A ++K +V  ++G  +G    L  
Sbjct: 73  N-DGDVTSEVEKVSKLVSAISSPNIFVAN-----AFAIHKKVLVCCLNGPAIGLSASLVA 126

Query: 152 HTPFRIATENTKWAM-PETDIGFFPDVGTTFALPRLITLANKNAQM-----ALYLCLTGD 205
                 +  ++ + + P +++GF  +VGT+  L + + + + N  M      L+  L G 
Sbjct: 127 LCDIVYSQNDSVFLLFPFSNLGFVAEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGT 186

Query: 206 VIS 208
           +I+
Sbjct: 187 IIT 189

>YOR270C (VPH1) [5056] chr15 complement(828049..830571) Vacuolar
           H(+)-ATPase (V-ATPase) 94 kDa subunit a isoform of
           membrane (V0) sector, essential for vacuolar
           acidification and vacuolar H(+)-ATPase (V-ATPase)
           activity, involved in vacuolar fusion [2523 bp, 840 aa]
          Length = 840

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 7/79 (8%)

Query: 217 LASHYIPHSNLEKLQTRLGELRPALDIKFFSDEFFDSVNLAIEEFTTPLPTNHKFKFSKD 276
           +A  +IP   L  LQ RLGE+   L I         S+   ++   TP PT H+      
Sbjct: 336 IAEGWIPRDELATLQARLGEMIARLGID------VPSIIQVLDTNHTP-PTFHRTNKFTA 388

Query: 277 QLEVIEKCFDISSGESINA 295
             + I  C+ I+    INA
Sbjct: 389 GFQSICDCYGIAQYREINA 407

>Kwal_23.2920
          Length = 836

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%)

Query: 312 FARDTKKKLESKSMTSMQVGIRLMQENSRDDIESALKRDLTTAVNMCVNDS 362
           F    KK  ESK   S   G     E++R D +SAL ++ T +     N+S
Sbjct: 501 FTFGAKKSTESKDTPSFSFGAPKQPEDARKDDKSALPKETTPSAAFSENES 551

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,989,548
Number of extensions: 712772
Number of successful extensions: 2302
Number of sequences better than 10.0: 30
Number of HSP's gapped: 2317
Number of HSP's successfully gapped: 30
Length of query: 487
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 381
Effective length of database: 12,926,601
Effective search space: 4925034981
Effective search space used: 4925034981
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)