Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K11638g59258331430.0
Scas_721.1288516897225e-85
YKL121W8526366692e-77
YMR102C8346506649e-77
Kwal_26.76557436236038e-69
CAGL0K03377g9785986074e-68
Sklu_2430.99666745784e-64
Scas_717.689084915606e-62
ABL024W7346304782e-51
KLLA0B12804g8523973226e-31
AER263C51373988e-04
ADL322C501107940.003
Scas_720.9551569940.003
YBR103W (SIF2)535162920.004
Kwal_26.7736507101920.005
KLLA0F10263g682100910.006
CAGL0C03608g643110900.008
YCR072C51569900.008
KLLA0C08547g51590890.010
Sklu_2173.251572880.013
CAGL0E00561g836100890.014
Kwal_23.6429750178880.014
CAGL0B03575g419103880.014
CAGL0J03476g51758870.017
KLLA0B01958g89085870.018
ADL082C569121870.022
AER114W63384870.022
YCR084C (TUP1)713111860.025
CAGL0G04345g71178850.039
AFL009C41368840.042
Sklu_1926.5509109840.044
AGL234W629111840.045
Kwal_23.632451458830.050
KLLA0F07403g34789830.051
YGL004C (RPN14)417168820.072
CAGL0H08932g90284820.075
Scas_660.8510189810.092
CAGL0M05335g80677810.096
AEL314W71573810.11
AFL118W83285810.12
Scas_680.1134792790.14
AEL246C815119800.15
Kwal_47.17555417108790.17
Scas_630.6621225790.18
CAGL0G09845g50075790.19
KLLA0F21406g70573790.19
CAGL0J06512g545156780.20
Kwal_47.17465800143780.23
Scas_719.5262865780.23
Scas_658.1442104780.24
YLR429W (CRN1)65167770.28
AAL009C30361760.28
CAGL0A00561g41270760.33
KLLA0D04840g30361750.42
Scas_719.30940148760.42
YEL056W (HAT2)401144750.47
CAGL0J04818g65463750.47
YIL046W (MET30)64058750.49
Scas_659.947581750.52
CAGL0A02772g441104750.53
Kwal_23.535147467750.56
Scas_718.6*546128750.56
YLL011W (SOF1)48990740.62
Sklu_2442.230361730.63
KLLA0D06787g436135740.63
CAGL0D05588g47776740.65
Sklu_2364.241174740.68
YNL006W (LST8)30361730.72
YGL137W (SEC27)88985740.73
KLLA0E12287g326111730.73
Scas_629.12671112740.73
Sklu_2160.376056740.80
Sklu_675.130876730.82
AAL157C47975730.91
CAGL0E02805g840173730.93
CAGL0L00781g67358730.99
CAGL0J10340g33894720.99
Kwal_33.1513647375721.0
Kwal_23.576962791721.1
YKR036C (CAF4)659103721.2
KLLA0F27511g62366711.4
CAGL0L06952g34783701.6
Kwal_27.984047195711.6
Kwal_27.1205375574711.7
Scas_624.11120570712.0
KLLA0D16390g93699702.0
KLLA0E11143g49398702.1
CAGL0K09768g48492702.1
CAGL0H03729g30361692.2
ACR162C86056692.6
KLLA0D02530g70767692.6
Scas_720.4575547692.7
Kwal_34.1581834983683.4
Scas_695.1532759674.0
Kwal_27.1266772176674.3
KLLA0D07546g64789674.3
KLLA0F15598g47875674.4
YAR003W (SWD1)426129674.4
Kwal_56.2416372947674.4
Scas_704.4060880675.2
Scas_603.558998675.3
Kwal_56.2392093727675.4
Scas_589.13131188675.6
YGR200C (ELP2)788228675.6
KLLA0E07073g452145648.8
Kwal_33.1351539848649.6
KLLA0A08866g42381649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K11638g
         (583 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...  1215   0.0  
Scas_721.128                                                          282   5e-85
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...   262   2e-77
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...   260   9e-77
Kwal_26.7655                                                          236   8e-69
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...   238   4e-68
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                         227   4e-64
Scas_717.68                                                           220   6e-62
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...   188   2e-51
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...   128   6e-31
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    42   8e-04
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    41   0.003
Scas_720.95                                                            41   0.003
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    40   0.004
Kwal_26.7736                                                           40   0.005
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    40   0.006
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    39   0.008
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    39   0.008
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    39   0.010
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            39   0.013
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    39   0.014
Kwal_23.6429                                                           39   0.014
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    39   0.014
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    38   0.017
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    38   0.018
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    38   0.022
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    38   0.022
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    38   0.025
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    37   0.039
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    37   0.042
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         37   0.044
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    37   0.045
Kwal_23.6324                                                           37   0.050
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    37   0.051
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    36   0.072
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    36   0.075
Scas_660.8                                                             36   0.092
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    36   0.096
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    36   0.11 
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    36   0.12 
Scas_680.11                                                            35   0.14 
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    35   0.15 
Kwal_47.17555                                                          35   0.17 
Scas_630.6                                                             35   0.18 
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    35   0.19 
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    35   0.19 
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    35   0.20 
Kwal_47.17465                                                          35   0.23 
Scas_719.52                                                            35   0.23 
Scas_658.1                                                             35   0.24 
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    34   0.28 
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    34   0.28 
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    34   0.33 
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    33   0.42 
Scas_719.30                                                            34   0.42 
YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransfer...    33   0.47 
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    33   0.47 
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    33   0.49 
Scas_659.9                                                             33   0.52 
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    33   0.53 
Kwal_23.5351                                                           33   0.56 
Scas_718.6*                                                            33   0.56 
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    33   0.62 
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            33   0.63 
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    33   0.63 
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    33   0.65 
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         33   0.68 
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    33   0.72 
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    33   0.73 
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    33   0.73 
Scas_629.12                                                            33   0.73 
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         33   0.80 
Sklu_675.1 YMR146C, Contig c675 761-1687                               33   0.82 
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    33   0.91 
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    33   0.93 
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    33   0.99 
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    32   0.99 
Kwal_33.15136                                                          32   1.0  
Kwal_23.5769                                                           32   1.1  
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    32   1.2  
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    32   1.4  
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    32   1.6  
Kwal_27.9840                                                           32   1.6  
Kwal_27.12053                                                          32   1.7  
Scas_624.11                                                            32   2.0  
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    32   2.0  
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    32   2.1  
CAGL0K09768g 954713..956167 similar to sp|P27929 Saccharomyces c...    32   2.1  
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    31   2.2  
ACR162C [1209] [Homologous to ScYPL126W (NAN1) - SH] (637642..64...    31   2.6  
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    31   2.6  
Scas_720.45                                                            31   2.7  
Kwal_34.15818                                                          31   3.4  
Scas_695.15                                                            30   4.0  
Kwal_27.12667                                                          30   4.3  
KLLA0D07546g complement(647984..649927) some similarities with s...    30   4.3  
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    30   4.4  
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    30   4.4  
Kwal_56.24163                                                          30   4.4  
Scas_704.40                                                            30   5.2  
Scas_603.5                                                             30   5.3  
Kwal_56.23920                                                          30   5.4  
Scas_589.13                                                            30   5.6  
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    30   5.6  
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    29   8.8  
Kwal_33.13515                                                          29   9.6  
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    29   9.8  

>CAGL0K11638g complement(1123343..1125121) weakly similar to
           sp|Q03177 Saccharomyces cerevisiae YMR102c, hypothetical
           start
          Length = 592

 Score = 1215 bits (3143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/583 (100%), Positives = 583/583 (100%)

Query: 1   MIEEDTESVRSGTYSADLQPLDFDARSRVQINDVTNFDHDQFEKYLVRPDYVKLLKKQAD 60
           MIEEDTESVRSGTYSADLQPLDFDARSRVQINDVTNFDHDQFEKYLVRPDYVKLLKKQAD
Sbjct: 1   MIEEDTESVRSGTYSADLQPLDFDARSRVQINDVTNFDHDQFEKYLVRPDYVKLLKKQAD 60

Query: 61  CDILPFKRLFLAQELQLGGSSVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGISD 120
           CDILPFKRLFLAQELQLGGSSVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGISD
Sbjct: 61  CDILPFKRLFLAQELQLGGSSVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGISD 120

Query: 121 AECEETGKRKIQYAPIFNELDIVSLNSDEKVHREVLDLSWSVNHFLLVSSVDSYVTLWTP 180
           AECEETGKRKIQYAPIFNELDIVSLNSDEKVHREVLDLSWSVNHFLLVSSVDSYVTLWTP
Sbjct: 121 AECEETGKRKIQYAPIFNELDIVSLNSDEKVHREVLDLSWSVNHFLLVSSVDSYVTLWTP 180

Query: 181 FDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINV 240
           FDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINV
Sbjct: 181 FDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINV 240

Query: 241 VTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKFHIINGRSIDGNLRNGADKIKITGIEW 300
           VTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKFHIINGRSIDGNLRNGADKIKITGIEW
Sbjct: 241 VTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKFHIINGRSIDGNLRNGADKIKITGIEW 300

Query: 301 IVTDNRLDEIQEDNEYSTARIVVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLC 360
           IVTDNRLDEIQEDNEYSTARIVVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLC
Sbjct: 301 IVTDNRLDEIQEDNEYSTARIVVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLC 360

Query: 361 IWDDKPFIYCSSEDQWFYVWRLNYQDLMLTRATNEILYASTTHRRRRTERILGHTKEVTS 420
           IWDDKPFIYCSSEDQWFYVWRLNYQDLMLTRATNEILYASTTHRRRRTERILGHTKEVTS
Sbjct: 361 IWDDKPFIYCSSEDQWFYVWRLNYQDLMLTRATNEILYASTTHRRRRTERILGHTKEVTS 420

Query: 421 SVLDMFFSTYAAADVEMGSNDKGMRHGQQQSMTFSHESTVTQTMPIGQPTGSTTKSTIEE 480
           SVLDMFFSTYAAADVEMGSNDKGMRHGQQQSMTFSHESTVTQTMPIGQPTGSTTKSTIEE
Sbjct: 421 SVLDMFFSTYAAADVEMGSNDKGMRHGQQQSMTFSHESTVTQTMPIGQPTGSTTKSTIEE 480

Query: 481 QREENYILRHSHTFSFHAHDHPITTVNIAPIGTIAAVTQSNDFIYEFTCRCYSNNVELRD 540
           QREENYILRHSHTFSFHAHDHPITTVNIAPIGTIAAVTQSNDFIYEFTCRCYSNNVELRD
Sbjct: 481 QREENYILRHSHTFSFHAHDHPITTVNIAPIGTIAAVTQSNDFIYEFTCRCYSNNVELRD 540

Query: 541 VEMDSCDIIGPIVVTTDSVGKLRVFRTDLSDIARETLINVLHS 583
           VEMDSCDIIGPIVVTTDSVGKLRVFRTDLSDIARETLINVLHS
Sbjct: 541 VEMDSCDIIGPIVVTTDSVGKLRVFRTDLSDIARETLINVLHS 583

>Scas_721.128
          Length = 851

 Score =  282 bits (722), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 207/689 (30%), Positives = 311/689 (45%), Gaps = 174/689 (25%)

Query: 14  YSADLQPLDFD--------------------------ARSRVQ-INDVT-NF---DHDQF 42
           YSADLQPL F                            R+R+Q I D + NF   D +QF
Sbjct: 57  YSADLQPLKFKMTRTPDLEEVPSHVKTASADVDSFYKVRNRLQKIADPSWNFSSIDQEQF 116

Query: 43  EKYLVRPDYVKLLKKQADCDILPFKRLFLAQELQL---------------GGSSVTVSRF 87
           E YL  P+Y+K+ KK  D +   FKRLFLAQEL +                  ++   +F
Sbjct: 117 EIYLKEPEYIKVFKKHEDLE--EFKRLFLAQELNVTTTKENDPTAQNTDASNKAIWTLKF 174

Query: 88  SKDGTLFCVGCKDGSLMVLKVLQTKSEKLGISDAECE---------------ETGKRKIQ 132
           S DG     G KDG +M+ KV+ +  E+  +  AE                 ET +  + 
Sbjct: 175 SHDGKYMATGSKDGCVMLWKVISSPVERWELDRAEESNLVAMAKSIRIKQNLETNEAHLN 234

Query: 133 ----------------YAPIF--NELDIVSLNSDEKVHREVLDLSWSVNHFLLVSSVDSY 174
                           YAPIF  N + I   +S      ++LDL WS N+FLL +S+D  
Sbjct: 235 APSRPPTDTNLESLNLYAPIFHPNPVRIYKEHS-----HDILDLDWSKNNFLLTASMDKL 289

Query: 175 VTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNC 234
           V+LW P D    +  F HPD VTS +F   DDRFF+SGCLDH  R WS+ +N+V Y F+C
Sbjct: 290 VSLWHP-DRETSLKSFPHPDFVTSVRFHPKDDRFFVSGCLDHKCRMWSILENKVVYEFDC 348

Query: 235 EEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKFHIINGRSIDGNLRNGAD--- 291
           ++ I  +++SPG+  FT++GTF GYI + ST  LK +  FH+++ + + GN  N +    
Sbjct: 349 QDLITAISISPGVGEFTIIGTFNGYITILSTFELKPLYTFHVLD-KHMQGNSGNDSSFKN 407

Query: 292 ----------KIKITGIEWIVTDNRLDEIQEDNEYSTARIVVTSGDERIRVFKLTEGGYH 341
                       ++TG++  +          + E    +++V+S D RIR+F L +    
Sbjct: 408 LLGQNLKNHHGPRVTGLQLFL----------EKETDDLKLLVSSTDSRIRIFDLEKNKLI 457

Query: 342 NLELKGFHCEQFRHRAQLCIWDDKPFIYCSSEDQWFYVWRLNYQDLMLTRATNEILYAST 401
            +  KGF     +H AQL  W D+P +  SS+D WFY W++N  +   T+  + I     
Sbjct: 458 EV-FKGFRSGLSQHNAQLSNWGDQPIVINSSKDHWFYAWKINTSNPKTTQNFSSI----- 511

Query: 402 THRRRRTERILGHTKEVTSSVLDMFFSTYAAADVEMGSNDKGMRHGQQQSMTFSHESTVT 461
                R ER+          + D+         +   S  K   H   ++ T    ST  
Sbjct: 512 -----RQERL-----STGGGLNDL---------LNKSSEKKETTHELSRTSTAGDSSTRH 552

Query: 462 QTMPIGQPTGSTTKSTIEEQREENYILRHSHTFSFHAHDHPITTVNIAPIGTIAAVTQSN 521
             +P          S        ++++++SH  +FHAH  P++T  IAP  T   ++ SN
Sbjct: 553 HFLP----------SLSRLLPHSSHVVKNSHYVAFHAHHAPVSTATIAPQETAKTLSLSN 602

Query: 522 DFIYEFTCRCYSN----------------------NVELRDVEM------DSCDIIGPIV 553
           DFI E T +   +                      N   + +        D+ + IGPI+
Sbjct: 603 DFICELTLQVMEDIRKTTTGSSDSSNGRSSVDKKKNASEKSLPTVTSGIPDAVNAIGPIL 662

Query: 554 VTTDSVGKLRVFRTDLSDIARETLINVLH 582
           VTTD+ G +RVFR D+S+  R  ++  L 
Sbjct: 663 VTTDTRGTIRVFRVDMSNATRSRVLKKLQ 691

>YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has moderate similarity to
           uncharacterized S. cerevisiae Ymr102p [2559 bp, 852 aa]
          Length = 852

 Score =  262 bits (669), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 187/636 (29%), Positives = 290/636 (45%), Gaps = 142/636 (22%)

Query: 37  FDHDQFEKYLVRPDYVKLLKKQADCDILPFKRLFLAQEL--------------------Q 76
           FD   FE YL  P Y+K+ KK+   +   F R+FLAQEL                    +
Sbjct: 113 FDRKYFENYLEEPTYIKIFKKKEGLE--QFDRMFLAQELKIPDVYKSTTYQGEPAVANSE 170

Query: 77  LGGSSVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGISDAECEETGKR----KIQ 132
           L  +S+    FS DG    +GCKDGSL + KV+ +  ++  +  +E   +  R    KIQ
Sbjct: 171 LFKNSICCCTFSHDGKYMVIGCKDGSLHLWKVINSPVKRSEMGRSEKSVSASRANSLKIQ 230

Query: 133 ---------------------------------YAPIFNELDIVSLNSDEKVHREVLDLS 159
                                            YAP+F   D+  +  +  +  ++LD +
Sbjct: 231 RHLASISSHNGSISSNDLKPSDQFEGPSKQLHLYAPVFYS-DVFRVFMEHAL--DILDAN 287

Query: 160 WSVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVR 219
           WS N FL+ +S+D    LW P +    +  F HPD VTSA F   DDRF I+GCLDH  R
Sbjct: 288 WSKNGFLITASMDKTAKLWHP-ERKYSLKTFVHPDFVTSAIFFPNDDRFIITGCLDHRCR 346

Query: 220 FWSVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKFHIING 279
            WS+ DN V Y+F+C++ I  +T+SP    +T++GTF GYIYV  T GLK +  FH ++ 
Sbjct: 347 LWSILDNEVSYAFDCKDLITSLTLSPPGGEYTIIGTFNGYIYVLLTHGLKFVSSFH-VSD 405

Query: 280 RSIDGNLRNG----------ADKIKITGIEWIVTDNRLDEIQEDNEYSTARIVVTSGDER 329
           +S  G  +N               +ITG++   +  ++D+          R++VT+ D +
Sbjct: 406 KSTQGTTKNSFHPSSEYGKVQHGPRITGLQCFFS--KVDK--------NLRLIVTTNDSK 455

Query: 330 IRVFKLTEGGYHNLEL-KGFHCEQFRHRAQLCIWDDKPFIYCSSEDQWFYVWRLNYQDLM 388
           I++F L E     LEL KGF     RHR Q  +  ++P ++  S+D WFY W++  Q   
Sbjct: 456 IQIFDLNEK--KPLELFKGFQSGSSRHRGQFLMMKNEPVVFTGSDDHWFYTWKM--QSFN 511

Query: 389 LTRATNEILYASTTHRRRRTERILGHTKEVTSSVLDMFFSTYAAADVEMGSNDKGMRHGQ 448
           L+   N     +  HR++R                 M             +ND+ +    
Sbjct: 512 LSAEMN----CTAPHRKKRLSG-------------SMSLKGLLRIVSNKSTNDECLTETS 554

Query: 449 QQSMTFSHESTVTQTMPIGQPTGSTTKSTIEEQREENYILRHSHTFSFHAHDHPITTVNI 508
            QS   SH  T            +++K+ ++ Q   +  ++++H  SFHAH+ P+T  +I
Sbjct: 555 NQSS--SHTFT------------NSSKNVLQTQTVGSQAIKNNHYISFHAHNSPVTCASI 600

Query: 509 APIGTIAAVTQSNDFIYEFTCRCYSNNVELRDVEMDSCD--------------------- 547
           AP   I  ++ SND I+E T + +    +      ++CD                     
Sbjct: 601 APDVAIKNLSLSNDLIFELTSQYFKEMGQNYSESKETCDNKPNHPVTETGGFSSNLSNVV 660

Query: 548 -IIGPIVVTTDSVGKLRVFRTDLSDIARETLINVLH 582
             +G I++TTDS G +RVFRTD+    R+ +I   H
Sbjct: 661 NNVGTILITTDSQGLIRVFRTDILPEIRKKIIEKFH 696

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score =  260 bits (664), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 189/650 (29%), Positives = 298/650 (45%), Gaps = 159/650 (24%)

Query: 27  SRVQINDVTNF---DHDQFEKYLVRPDYVKLLKKQADCDILPFKRLFLAQELQL-GGSSV 82
           S +++N+   F   D +QFE YL  P Y+K+LK++ +  +  F+RLFLAQEL    G +V
Sbjct: 105 SNLRVNEFYPFNSIDTEQFENYLREPKYIKMLKRRKN--LKQFRRLFLAQELMAYEGETV 162

Query: 83  TVS--------------RFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGI-SDAECEETG 127
           T +              +FS+DG     G KDG + + KV+ +  E+  + S AE  +  
Sbjct: 163 TSTSKSSEPTSKAIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEA 222

Query: 128 KRKIQ----------------------------------YAPIFNELDIVSLNSDEKVH- 152
           + K                                    YAP+F+   +       K H 
Sbjct: 223 RAKSMRIKQQVSSLNNPKEKQFLDSATEKYEEKEKLLNLYAPVFHPTPLRLY----KEHV 278

Query: 153 REVLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISG 212
           ++VLD++WS N+F+L +S+D  V LW P D    +  F HPD VT  +F   DDRFFISG
Sbjct: 279 QDVLDINWSKNNFILSASMDKTVKLWHP-DRKNSLKTFIHPDFVTCVEFHPTDDRFFISG 337

Query: 213 CLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLID 272
           CLDH  R WS+ D+ V + ++C++ I  VT+SP    +T++GTF GY+++  T GL  + 
Sbjct: 338 CLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVS 397

Query: 273 KFHIINGRS-----------IDGNLRNGADKIKITGIEWIVTDNRLDEIQEDNEYSTARI 321
            FH+ + ++            D  +R+G    ++TG++   +       Q DN +   R+
Sbjct: 398 SFHVADRQTQEQNAHVMVTETDSKIRHGP---RVTGLQAFRS-------QLDNSF---RL 444

Query: 322 VVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLCIWDDKPFIYCSSEDQWFYVWR 381
           VVTS D RIR+F L +     + LKGFH    +H+AQL IW  +P +  SS+D W Y WR
Sbjct: 445 VVTSNDSRIRIFDLEQRKLLEV-LKGFHSGSSQHKAQLSIWHGQPIVVNSSDDHWVYGWR 503

Query: 382 LNYQDLMLTRATNEILYASTTHRRRRTERILGHTKEVTSSVLDMFFSTYAAADVEMGSND 441
           L   D    R  ++          +R  + L       S  L   FS   +      + +
Sbjct: 504 LKSSD----RENDQ-------DEPKRKPKGLAR-----SGSLRSIFSKSMSRSSSQNNEE 547

Query: 442 KGMRHGQQQSMTFSHESTVTQTMPIGQPTGSTTKSTIEEQREENYILRHSHTFSFHAHDH 501
           K   H +           +T  +P+                  ++ ++++   SFHAH+ 
Sbjct: 548 KPHHHLK-----------LTNLLPL-------------PHHSNDHYIKNTDYISFHAHNA 583

Query: 502 PITTVNIAPIGTIAAVTQSNDFIYEFTCRCYSNNVE------------LRDVEM------ 543
           P+T V+IAP  T   ++ SND I E +   +  +              + DVE       
Sbjct: 584 PVTCVSIAPPETSKTLSLSNDVICELSLEFFQTSDSFDVLSRSNDDGIMSDVESSLGYNS 643

Query: 544 ---------------DSCDIIGPIVVTTDSVGKLRVFRTDLSDIARETLI 578
                          D  D IG I+++TD+VG +RVFR D+  + R+ ++
Sbjct: 644 KPGSISNASATSAIPDVVDAIGTILISTDNVGTIRVFRADMPSVIRKRVL 693

>Kwal_26.7655
          Length = 743

 Score =  236 bits (603), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 184/623 (29%), Positives = 279/623 (44%), Gaps = 140/623 (22%)

Query: 37  FDHDQFEKYLVRPDYVKLLKKQADCDILPFKRLFLAQELQLGGS---------------- 80
            + +QF +YL  P Y+K+  +Q    +  F+RLFLAQEL+L  S                
Sbjct: 116 INREQFHQYLKEPKYLKVFNRQPR--VKQFRRLFLAQELRLHASDLTSSSSTTLSTLSEN 173

Query: 81  ---SVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGISDAECEETGKRKIQ----- 132
              +V  ++FS+DG     G KD +L V KV+ +  E+  +S A  +   KR        
Sbjct: 174 SDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPS 233

Query: 133 ----------------------YAPIFNELDIVSLNSDEKVHRE----VLDLSWSVNHFL 166
                                 YAP+F+ L         ++++E    +LDL WS N F+
Sbjct: 234 PTVGRSVKEEPEQPIGPASMDLYAPVFHPLPF-------RIYQEHTQDILDLDWSKNGFI 286

Query: 167 LVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDN 226
           L +S+D    LW   D  + +  F HPD VT AKF   DDRFFISGCLDH +R WS+ DN
Sbjct: 287 LTTSMDKTARLWH-CDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDN 345

Query: 227 RVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKFHIINGRSIDGNL 286
            V + + C + I  +  SP    +T  GTF G+I +  T GL+++  FH++     +G  
Sbjct: 346 SVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVL--EKPNGTT 403

Query: 287 RNGADK-IKITGIEWIVTDNRLDEIQEDNEYSTARIVVTSGDERIRVFKLTEGGYHNLE- 344
           +   +   KITGIE+  +         DN+    RI+VTS D RIR+F++   G   LE 
Sbjct: 404 KKVPESGPKITGIEFFKS-------APDNDL---RIMVTSNDSRIRIFRIK--GQSLLEV 451

Query: 345 LKGFHCEQFRHRAQLCIWDDKP-FIYCSSEDQWFYVWRLNYQDLMLTRATNEILYASTTH 403
           LKGF     +  A L +   K  F+   SE+QW Y WR+     +   + ++    + TH
Sbjct: 452 LKGFENTHSQISAHLILPPSKKIFVLAPSENQWVYCWRVESSAGV---SNSDDSQNNGTH 508

Query: 404 RRRRTERILGHTKEVTSSVLDMFFSTYAAADVEMGSNDKGMRHGQQQSMTFSHESTVTQT 463
           RR     +L  +                   + +GS+    R   Q+    SH  ++   
Sbjct: 509 RRGSIRGLLQRS-------------------LSIGSSQSPER---QEYKNGSHSHSLHLP 546

Query: 464 MPIGQPTGSTTKSTIEEQREENYILRHSHTFSFHAHDHPITTVNIAPIGTIAAVTQSNDF 523
            P  +  G            + YI ++ H  +FHAH   +TT  +AP+ T   +  S+DF
Sbjct: 547 SPTAKSKG------------DQYI-KNQHYIAFHAHRCTVTTTAVAPVNTNKTLALSDDF 593

Query: 524 IYEFTCRC-------------------YSNNVELRDVEM------DSCDIIGPIVVTTDS 558
           I E T                      +S     +D ++         D IG IVV+TD+
Sbjct: 594 ICELTMALSETDEDVAFLKQQRRKSLIHSKKGSQKDRDLMERRFPSMIDAIGTIVVSTDN 653

Query: 559 VGKLRVFRTDLSDIARETLINVL 581
            G +RVFR+D+S   R+ ++  L
Sbjct: 654 SGIIRVFRSDISTNVRKKVLKCL 676

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score =  238 bits (607), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 173/598 (28%), Positives = 269/598 (44%), Gaps = 138/598 (23%)

Query: 61  CDILPFKRLFLAQELQLGGSSVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLG--- 117
           C +LP        E      ++  ++FS DG     G +DG L + KVL T  E+ G   
Sbjct: 289 CPVLPTSGHL---EPAKNTKAIWSTKFSIDGKYMATGSRDGVLRLWKVLSTPVERWGLDS 345

Query: 118 -ISDAECEETGKRKIQ----------------------------------YAPIFNELDI 142
            I  A        ++Q                                  YAP+F    +
Sbjct: 346 SIDSAHLTSAKSLRLQQNQHGSSHGGPLGSPAMRRDTFDNIDAKENSSNLYAPVFQPTPV 405

Query: 143 VSLNSDEKVHREVLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFI 202
            +    E +H +VLD+ WS N+FL+ +S+D    LW P    R +  F HPD VT  KF 
Sbjct: 406 RTYK--EHLH-DVLDMDWSKNNFLISASMDKTAKLWHP-SKMRSLKSFQHPDFVTCVKFH 461

Query: 203 EADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYV 262
             DDRFFISGCLD   R WS+ D+ V + FNC + +  +T++PG   +T+VGTF GYI+V
Sbjct: 462 PTDDRFFISGCLDQKCRLWSILDDEVSFEFNCRDLVTSLTLTPGDGTYTIVGTFNGYIHV 521

Query: 263 FSTMGLKLIDKFHIINGR-----------SIDGNLRNGADKIKITGIEWI--VTDNRLDE 309
             T GL+ I  FH+   +           S D  +R+G    ++TG++    + DN L  
Sbjct: 522 LQTKGLEHITSFHVTAKKTHENTHEVLCPSNDSKVRHGP---RVTGLQCFNSLIDNSL-- 576

Query: 310 IQEDNEYSTARIVVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLCIWDDKPFIY 369
                     R+VVTS D RIRVF LT      + L+GF C   +H+AQ+ ++ ++P + 
Sbjct: 577 ----------RLVVTSSDSRIRVFDLTRRKLIEI-LRGFQCGSSQHKAQISVYRNQPIVI 625

Query: 370 CSSEDQWFYVWRLNYQDLMLTRATNEILYASTTHRRRRTERILGHTKEVTSSVLDMFFST 429
            SS+D W Y WRL   D +      EI   +  H   R+  I G           +F  +
Sbjct: 626 NSSDDHWVYGWRLKSSDPV------EINKKAKKHGMSRSGSIRG-----------LFSKS 668

Query: 430 YAAADVEMGSNDKGMRHGQQQSMTFSHESTVTQTMPIGQPTGSTTKSTIEEQREENYILR 489
            + +  +   + + +R+  +          ++  +PI   + S            + +++
Sbjct: 669 ISRSSSQGSEDRQSLRNTLK----------LSSLLPIPHSSHS------------DGVMK 706

Query: 490 HSHTFSFHAHDHPITTVNIAPIGTIAAVTQSNDFIYEFTCRCYSNN-----VELRDVEMD 544
           +S  FSFHAH+ P+TTV +AP  T   ++ SND I E +   +  +     ++L+D +  
Sbjct: 707 NSDYFSFHAHNAPVTTVTMAPEETSKTLSLSNDPICELSLEFFEPSDEVDIIKLKDTQKG 766

Query: 545 SCD--------------------IIGPIVVTTDSVGKLRVFRTDLSDIARETLINVLH 582
             D                    +IG I+++TDS G +RVFR D+S   R  ++  L 
Sbjct: 767 GHDNIPATKTPVTTSLAKPTPVEVIGSILISTDSNGLIRVFRADMSKSIRARVLQKLQ 824

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 27  SRVQINDVTNFDHDQFEKYLVRPDYVKLLKKQADCDILPFKRLFLAQELQ 76
           +R   N     D +QFE YL  P Y+++ KK++      F+RLFLAQEL+
Sbjct: 181 TRSDFNPFAFIDREQFETYLKEPRYIRIFKKRSRSSKQ-FRRLFLAQELK 229

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score =  227 bits (578), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 192/674 (28%), Positives = 277/674 (41%), Gaps = 183/674 (27%)

Query: 41  QFEKYLVRPDYVKLLKKQADCDILPFKRLFLAQELQLGGSSVTVS--------------- 85
           QFE+YL  P+Y+K+ KK+    +  F+R FLAQEL++G S V  +               
Sbjct: 206 QFEQYLKEPEYIKVFKKRKG--LKQFRRFFLAQELKIGTSPVNSNVGTNNVDGIPHVASS 263

Query: 86  --------------------------RFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGI- 118
                                     +FSKDG     G KD  L + KV+ + +E+L + 
Sbjct: 264 ASIATLSSSSPTGSSSSSAGKSVWSMKFSKDGRFLATGGKDRILRIWKVIASPTERLELD 323

Query: 119 ------SDAECEETGK-----RKIQ-------------------------------YAPI 136
                 S   C   GK     R +                                YAP+
Sbjct: 324 SSTMKPSKTVCMLNGKLISYSRDVPQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPV 383

Query: 137 FNELDIVSLNSDEKVHREVLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLV 196
           F+ L   S       ++++LD+ WS N+F+L  S+D  V LW   D  + +  F HPD V
Sbjct: 384 FHPLPYRSFLGH---NQDILDIDWSKNNFVLTGSMDKTVKLWH-CDRKQLLKNFPHPDFV 439

Query: 197 TSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTF 256
           T  KF   DDRFFISGCLDH  R WS+ D+ V + F+C + I  + VSPG S +T++GTF
Sbjct: 440 TCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTF 499

Query: 257 GGYIYVFSTMGLKLIDKFHI----------INGRSIDGNLRNGADKIKITGIEWIVTDNR 306
            GY+ V  T GL+ +  FH+          +  R +  +  N     K+TGIE     N 
Sbjct: 500 NGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVND 559

Query: 307 LDEIQEDNEYSTARIVVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLCIW--DD 364
           +          T +++VTS D +IRVF L +     + LKGF  E  +  A L     + 
Sbjct: 560 M----------TLKLLVTSNDSKIRVFNLKDNILQEV-LKGFENESSQISAHLITGSKNK 608

Query: 365 KPFIYCSSEDQWFYVWRLNYQDLMLTRATNEILYASTTHRRRRTERILGHTKEVTSSVLD 424
           + F+   SED W Y W+L    LM      E      +  R  + R L H K        
Sbjct: 609 QQFVIAPSEDHWIYCWKLQ-SSLMTKDKDKEHAAGKNSLPRSGSLRGLLHRK-------- 659

Query: 425 MFFSTYAAADVEMGSNDKGMRHGQQQSMTFSHESTVTQTMPIGQPTGSTTKSTIEEQREE 484
                     + +GSN         +S + S +S                         E
Sbjct: 660 ----------LSIGSN----HSDSNRSFSKSQKSHYHHLH-----------LPHPHHSRE 694

Query: 485 NYILRHSHTFSFHAHDHPITTVNIAPIGTIAAVTQSNDFIYEFTCRCYSNNVELRDV--- 541
           N  L+++   +FHAH HP+TT   AP  T   ++ SNDFI E T     +  ++R V   
Sbjct: 695 NQHLKNNEYIAFHAHHHPLTTAIAAPPETARTLSLSNDFICELTMEFCEDYDDVRIVNTY 754

Query: 542 ----------------EMDSCD-----------------IIGPIVVTTDSVGKLRVFRTD 568
                           E D+CD                  IG I+VT+D  G +RVFR+D
Sbjct: 755 NKKQKQKKKKDADIAQEDDACDNDGDVGTNPRRIPTVDEFIGAILVTSDDNGVIRVFRSD 814

Query: 569 LSDIARETLINVLH 582
           +S   R+ ++  L 
Sbjct: 815 ISTNIRKRVLAKLQ 828

>Scas_717.68
          Length = 908

 Score =  220 bits (560), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 155/491 (31%), Positives = 236/491 (48%), Gaps = 93/491 (18%)

Query: 133 YAPIFNELDIVSLNSDEKVHRE----VLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIM 188
           YAP+FN        S  K+ +E    VLDL WS N+FL+ SS+D  V LW   +    + 
Sbjct: 312 YAPVFNP-------SCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWH-LERQTSLK 363

Query: 189 RFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMS 248
            F H D VT  +F   DDRFFISGCLDH VR WS+ +N + + F+C++ I  +T+SPG  
Sbjct: 364 TFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDG 423

Query: 249 HFTVVGTFGGYIYVFSTMGLKLIDKFHIINGRSIDGNLRNGADKI----KITGIEWIVTD 304
            +T+VGTF GY++V  T GL+ +  FH+++  + + N    + KI    ++TG+E     
Sbjct: 424 KYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERN--TASTKIHHGPRVTGLECF--- 478

Query: 305 NRLDEIQEDNEYSTARIVVTSGDERIRVFKLTEGGYHNLE-LKGFHCEQFRHRAQLCIWD 363
               + + DN   + RIVVTS D RIR+F L +     LE LKGF     +H+A L    
Sbjct: 479 ----KYEPDN---SLRIVVTSSDSRIRIFDLEKKKL--LEYLKGFQSGASQHKACLATVK 529

Query: 364 DKPFIYCSSEDQWFYVWRLNYQ-DLMLTRATNEILYASTTHRRRRTERILGHTKEVTSSV 422
            +  +  SS+D W + W+L     L  +   N I   + T    +      H+   + S 
Sbjct: 530 GQQVVLSSSDDHWVHGWKLKSSTSLTESEKNNNIDQTAATTTTTKKSN--SHSISRSGSF 587

Query: 423 LDMFFSTYAAADVEMGSNDKGMRHGQQQSMTFSHESTVTQTMPIGQPTGSTTKSTIEEQR 482
             +F  +    ++     D+  +H   +         +T  +P     GST         
Sbjct: 588 RSLFSKSSKKDNI-----DENGKHSHLK---------LTSLIPHCH-NGST--------- 623

Query: 483 EENYILRHSHTFSFHAHDHPITTVNIAPIGTIAAVTQSNDFIYEFTC------------- 529
               ++++S   SFHAH  P+TT  +AP GT   ++ SNDFIYE +              
Sbjct: 624 ----VIKNSDGISFHAHHAPVTTAIVAPSGTAKTLSLSNDFIYELSSEFAMESRDFEMNT 679

Query: 530 ------------------RCYSNNVELRDVEMDSCDIIGPIVVTTDSVGKLRVFRTDLSD 571
                             R +S++  L    + + D+IG I+VTTD+ G +RVFR D+S 
Sbjct: 680 NSDTHSVTTSGSSDKSKIRSHSSSATLVPPSISAVDLIGSIIVTTDNTGIIRVFRADISS 739

Query: 572 IARETLINVLH 582
             R+ ++  L 
Sbjct: 740 TIRKKVLCTLQ 750

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 69/176 (39%), Gaps = 65/176 (36%)

Query: 3   EEDTESVRSGTYSADLQPLDFD------ARSRVQINDV---------------------- 34
           E    SV +  YSAD++PL F        R R  I+                        
Sbjct: 38  ETSLSSVDNSKYSADIKPLQFKMNHVPGTRDRKHISYAAAAPSSSLRSNGSMKGQKYSYL 97

Query: 35  -TNFDHDQFEKYLVRPDYVKLLKKQADCDILPFKRLFLAQELQ----------------- 76
             + D DQFEKYL+ P Y+K+LK++ +  +  F+RLFLAQEL+                 
Sbjct: 98  FNSIDQDQFEKYLMEPTYIKILKRRKNLKM--FRRLFLAQELKAFDDENKINAFTNQING 155

Query: 77  -----------------LGGSSVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEK 115
                            L   ++ +++FS DG       K G + V KVL +  E+
Sbjct: 156 LQSPPLTPTSSSSNLNALADRAIWITKFSLDGKFMASAGKSGIIRVWKVLNSPIER 211

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score =  188 bits (478), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 174/630 (27%), Positives = 276/630 (43%), Gaps = 149/630 (23%)

Query: 42  FEKYLVRPDYVKLL--KKQADCDILPFKRLFLAQELQ---------------LG------ 78
             ++   P+Y+K+L  KK A C    F+RLF+AQELQ               LG      
Sbjct: 51  LRRFAAEPEYIKVLARKKGARC----FRRLFVAQELQPPVDSPLHANHSSQSLGQAAPAG 106

Query: 79  --GSSVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGI-----------------S 119
               SV + RFSKDG     G K   L V KV+ +  E+  +                 +
Sbjct: 107 DKARSVWLLRFSKDGKYLASGGKGRQLCVWKVIASPMERWNLLPVYGGDKHHSNTLSLLN 166

Query: 120 DAECEETGKR------------------KIQYAPIFNELDIVSLNSDEKVHREVLDLSWS 161
               + +GKR                  + QYAP+F+  D   +  +    +++LD  WS
Sbjct: 167 QQLLKYSGKRTEAVPAPGPERKEIPFDLEQQYAPVFHP-DPHRVFGEHL--QDILDCDWS 223

Query: 162 VNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFW 221
            N FLL +S+D  V LW   +    +  F HPD VT  +F   DDRFF SGCLDH VR W
Sbjct: 224 KNSFLLTASMDKTVKLWH-INRTTSLKTFVHPDFVTCVRFHPHDDRFFFSGCLDHTVRTW 282

Query: 222 SVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKFHIINGRS 281
           S+ +  V  +FNC + I  + VSP   ++ ++GTF GY++V  T GLKL+  FH++   +
Sbjct: 283 SILEGEVAEAFNCGDLIMALDVSPD-GNWLLIGTFNGYVHVLHTNGLKLLHSFHLLQKPN 341

Query: 282 -IDGNLRNGADKIKITGIEWIVTDNRLDEIQEDNEYSTARIVVTSGDERIRVFKLTEGGY 340
             +   R+G    KITG+E+I              Y    +++TS D R+R+F ++    
Sbjct: 342 ETENRPRHGP---KITGVEFI----------RHKAYPWLGLLITSNDSRVRLFDMSTTRL 388

Query: 341 HNLEL-KGFHCEQFRHRA-QLCIWDDKPFIYCSSEDQWFYVWRLNYQDLMLTRATNEILY 398
             LE+ +GF  E  R  A  L + D +  +  +SE+ W Y W L++++ M +       +
Sbjct: 389 --LEIFRGFSNESSRISAHHLEMEDGESVVLSASENHWLYTWMLHHEEYMYS-------H 439

Query: 399 ASTTHRRRRTERILGHTKEVTSSVLDMFFSTYA-AADVEMGSNDKGMRHGQQQSMTFSHE 457
           +   + R     I G   +   S+ ++F  + +  +D+   SN     H       F H+
Sbjct: 440 SDLDNARTVPSPIDGKDPK-KHSIRNIFRRSISFNSDILSESNPVARHHFP----LFHHK 494

Query: 458 STVTQTMPIGQPTGSTTKSTIEEQREENYILRHSHTFSFHAHDHPITTVNIAPIGTIAAV 517
           +         Q  G   K++        YI       +FHAH +P+T   IAP  T   +
Sbjct: 495 A---------QHKGGCVKNS-------EYI-------TFHAHHNPVTAATIAPKETTHVL 531

Query: 518 TQSNDFIYEFTCRCYSNNVE------LRDV--------------------EMDSCDIIGP 551
           + S+D I E   +     +E      +R+                     +  +   +G 
Sbjct: 532 SLSDDIICELNMKFGGEALEHLRTKSIREPGSPAGRSDHKRNHSAEKNYSQSTAKQNVGT 591

Query: 552 IVVTTDSVGKLRVFRTDLSDIARETLINVL 581
           I+V+  + G++RVFRTD+S   R   +  +
Sbjct: 592 IIVSAAATGQIRVFRTDVSSSVRAKALEAI 621

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score =  128 bits (322), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 109/397 (27%), Positives = 172/397 (43%), Gaps = 86/397 (21%)

Query: 154 EVLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRP--IMRFDHPDLVTSAKFIEADDRFFIS 211
           ++LD+ WS N F+L  S+D    LW      RP  +  F H D VT+ +F   DDRFF+S
Sbjct: 265 DILDIDWSKNSFILTGSMDKSCKLW---HCARPTSLKTFVHSDFVTAVRFHPEDDRFFLS 321

Query: 212 GCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLI 271
            CLD   R WS+ + +V + ++C + I  + +S    ++T++GTF GYI+V  T  L+L+
Sbjct: 322 ACLDQKCRLWSILEKQVIFEYDCGDLITAMDISYD-GNYTILGTFNGYIHVLITKSLELL 380

Query: 272 DKFHIING--------RSIDGNLRNGADKI----KITGIEWIVTDNRLDEIQEDNEYSTA 319
             F++++         R+     +  +DK     KITG+E+I  D R  +I   +   + 
Sbjct: 381 FSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFIQKDARNYKISSKD--VSD 438

Query: 320 RIVVTSGDERIRVFKLTEGGYHNLE----LKGFHCEQFRHRAQLCIW-DDKPFIYCSSED 374
             +V+S D RIR++ L      N E    +KG   E  +  A   +    K ++   SED
Sbjct: 439 WFLVSSNDSRIRIYTL------NQEFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSED 492

Query: 375 QWFYVWRLNYQDLMLTRATNEILYASTTHRRRRTERILGHTKE---VTSSVLDMFFSTYA 431
            W Y W+L+ + +  T  +++   + +T  R  + R     +    V S  LD   S   
Sbjct: 493 HWIYCWKLSDEVVKSTETSSK--DSKSTRSRSGSLRSFCRRRNNDSVASETLDAVLSRGY 550

Query: 432 AADVEMGSNDKGMRHGQQQSMTFSHESTVTQTMPIGQPTGSTTKSTIEEQREENYILRHS 491
             + ++ SN                                            NYI    
Sbjct: 551 TKNHQVSSN-------------------------------------------SNYI---- 563

Query: 492 HTFSFHAHDHPITTVNIAPIGTIAAVTQSNDFIYEFT 528
               FHAH HPIT     P+     ++ SND I E T
Sbjct: 564 ---GFHAHHHPITCATAVPMQVTKVLSLSNDLICELT 597

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 27/37 (72%)

Query: 547 DIIGPIVVTTDSVGKLRVFRTDLSDIARETLINVLHS 583
           + IG IVV+ D+ G +RVFR+D+S   R+ ++N L++
Sbjct: 691 EFIGGIVVSADTTGVIRVFRSDISSNVRKKVLNRLNA 727

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 2/73 (2%)

Query: 161 SVNHFLLVSSVDSYVTLWTPFDGNRPIMRF-DHPDLVTSAKFIEADDRFFISGCLDHCVR 219
           ++   ++  S D  + LW P  G++PI+R   H  LV    F   D R+ +S   D+ ++
Sbjct: 367 TMEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAF-SPDGRYIVSASFDNSIK 425

Query: 220 FWSVTDNRVEYSF 232
            W   D +   +F
Sbjct: 426 LWDGRDGKFIATF 438

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 4/107 (3%)

Query: 163 NHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWS 222
           N  LL +S D+ + +W   + N   + + H   +TSA ++  DD   IS  +D  +R WS
Sbjct: 335 NKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV--DDDTIISTSMDGSIRVWS 392

Query: 223 VTDNRVEYSFNCEEPINVV-TVSPGMSHFTVVGTFGGYIYVFSTMGL 268
           +  N    S   +   N    +SP    F   GT  G + V+    L
Sbjct: 393 LASNSTVASATVDGVPNFTGALSPDQGKF-ATGTLDGEVMVYDIQKL 438

>Scas_720.95
          Length = 515

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 3/69 (4%)

Query: 166 LLVSSVDSYVT-LWTPFDGNRPIMRF-DHPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
           L+V++ D +   LW P   N+PI R   H  LV    F   D R+ +S   D+ ++ W  
Sbjct: 373 LMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAF-SPDGRYIVSASFDNSIKLWDG 431

Query: 224 TDNRVEYSF 232
            D +   +F
Sbjct: 432 RDGKFISTF 440

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 62/162 (38%), Gaps = 43/162 (26%)

Query: 76  QLGGSSVTVSRFSKDGTL-----------FCVGCKDGSLMVLKVLQTKSEKLGISDAECE 124
           + GGSS+     S DG+L           F +    G++ V ++             E  
Sbjct: 303 ETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQI------------TEKT 350

Query: 125 ETGKRKIQYAPIFNELDIVSLNSDEKVHREVLDLSWSVNHFLLVSSVDSYVTLWTPFDGN 184
            TGK    + PI                  VL+ +   N  LL +S D  + +W   +GN
Sbjct: 351 PTGKLIGHHGPI-----------------SVLEFN-DTNKLLLSASDDGTLRIWHGGNGN 392

Query: 185 RPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDN 226
                + H   + SA ++  DD+  IS  +D  VR WS+  N
Sbjct: 393 SQNCFYGHSQSIVSASWV-GDDK-VISCSMDGSVRLWSLKQN 432

>Kwal_26.7736
          Length = 507

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 44/101 (43%), Gaps = 10/101 (9%)

Query: 168 VSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVT--- 224
           VS  DSY     P      I    HP  V  AKF  AD R  ++   D  VR W +T   
Sbjct: 105 VSVYDSY----NPRAQLVSIAASSHPTHV--AKFHPADSRTLVTASDDRVVRVWDITQAQ 158

Query: 225 DNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFST 265
           + +VE +    + +  V + P   H  V G++ G + +F T
Sbjct: 159 EPQVELT-GASDYVRSVCMVPQAPHLVVTGSYDGQVRLFDT 198

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 3/100 (3%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRFD-HPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
           FL   + D  + +W   +  + +M    H   + S  +  + ++  +SG  D  VR W +
Sbjct: 420 FLATGAEDKLIRIWD-LETKKIVMTLKGHEQDIYSLDYFPSGNKL-VSGSGDRTVRIWDL 477

Query: 224 TDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVF 263
           T      + + E+ +  V VSPG   F   G+    + V+
Sbjct: 478 TTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVW 517

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/110 (18%), Positives = 48/110 (43%), Gaps = 1/110 (0%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVT 224
           FL   + D  + +W        ++   H   + S  + ++ ++  +SG  D  +R W + 
Sbjct: 387 FLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKL-VSGSGDRTIRIWDLH 445

Query: 225 DNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKF 274
             +   + + E+ +  V VSPG  ++   G+    + V+ +    L+++ 
Sbjct: 446 TGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERL 495

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 3/69 (4%)

Query: 166 LLVSSVDSYVT-LWTPFDGNRPIMRF-DHPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
           ++V++ D Y   LW P    +PI R   H  LV    F   D R+ +S   D+ ++ W  
Sbjct: 373 MMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAF-SPDGRYIVSASFDNSIKLWDG 431

Query: 224 TDNRVEYSF 232
            D +   +F
Sbjct: 432 RDGKFISTF 440

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 6/90 (6%)

Query: 144 SLNSDEKVHREVLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIMRF-DHPDLVTSAKFI 202
           +L + EKV +   D        ++ +S D  + LW P    +PI R   H  LV    F 
Sbjct: 356 ALKNYEKVAKRKGDF----EELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAF- 410

Query: 203 EADDRFFISGCLDHCVRFWSVTDNRVEYSF 232
             D R+ +S   D+ ++ W   D +   +F
Sbjct: 411 SPDGRYIVSASFDNSIKLWDGRDGKFLSTF 440

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 2/72 (2%)

Query: 162 VNHFLLVSSVDSYVTLWTPFDGNRPIMRF-DHPDLVTSAKFIEADDRFFISGCLDHCVRF 220
           V   ++ +S D  + LW P    +PI R   H  LV    F   D R  +S   D+ ++ 
Sbjct: 370 VEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAF-SPDGRHIVSASFDNSIKL 428

Query: 221 WSVTDNRVEYSF 232
           W+  D +   +F
Sbjct: 429 WNGRDGKFISTF 440

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 3/100 (3%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRFD-HPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
           FL   + D  + +W   +  + +M    H   + S  +  + D+  +SG  D  VR W +
Sbjct: 569 FLATGAEDKLIRIWD-IEQKKIVMVLKGHEQDIYSLDYFPSGDKL-VSGSGDRTVRIWDL 626

Query: 224 TDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVF 263
              +   + + E+ +  V VSPG   F   G+    + V+
Sbjct: 627 KTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW 666

>Kwal_23.6429
          Length = 750

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 66/178 (37%), Gaps = 5/178 (2%)

Query: 80  SSVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGISDAECEETGKRKIQYAPIFNE 139
           S V   RFS DG     GC + +  V KV   +       DA    +G      +     
Sbjct: 401 SVVCCVRFSHDGEFLATGC-NKTTQVYKVSTGELIARLSEDASSAPSGADASATSENAKA 459

Query: 140 LDIVSLNSDEKVHREVLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIMRFD-HPDLVTS 198
              V+ ++   ++   +  S     FL   + D  + +W      R +M    H   + S
Sbjct: 460 SPAVATSASSDLYIRSVCFSPD-GKFLATGAEDKLIRIWD-LATRRIVMTLQGHEQDIYS 517

Query: 199 AKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTF 256
             +  + D+  +SG  D  VR W +   +   + + E+ +  V VSPG       G+ 
Sbjct: 518 LDYFPSGDKL-VSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSL 574

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 50/103 (48%), Gaps = 5/103 (4%)

Query: 166 LLVSSVDSYVTLW--TPFDGN-RPIMRFD--HPDLVTSAKFIEADDRFFISGCLDHCVRF 220
           LL  S DS + LW  + F+ N +P + F+  H D++   K+  ++   F S   D  ++ 
Sbjct: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254

Query: 221 WSVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVF 263
           +    +++ ++ N ++P N +  SP  S+          +Y++
Sbjct: 255 FDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLY 297

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 166 LLVSSVDSYVT-LWTPFDGNRPIMRF-DHPDLVTSAKFIEADDRFFISGCLDHCVRFW 221
           L+V++ D +   LW P  G +PI R   H  LV    F   D ++ +S   D+ ++ W
Sbjct: 375 LMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAF-SPDGKYIVSASFDNSIKLW 431

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 5/85 (5%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRF--DHPDLVTSAKFIEADDRFFISGCLDHCVRFWS 222
           F+L  S D  + LW  ++ N    +    H   V S  F   D   F SGCLDH ++ WS
Sbjct: 111 FVLTGSDDLTIKLWN-WEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWS 169

Query: 223 VTDNRVEYSFNCEEP--INVVTVSP 245
           +  +   ++    E   +N V   P
Sbjct: 170 IGQDVPNFTLKAHETKGVNYVDYYP 194

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 54/121 (44%), Gaps = 14/121 (11%)

Query: 112 KSEKLGISDAECEETGKRKIQ-YAPIFNELDIVSLNSDEKVHR---------EVLDLSWS 161
           KS+K   S  E E+  + +++ +  ++ E   V  N  + ++R          VL L  +
Sbjct: 209 KSDKASASKGEGEDAPQSRMRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVLSLQLT 268

Query: 162 VNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFW 221
            N  LL  S DS V +W    G        H D V + +F   DD+  I+G LD  +R W
Sbjct: 269 -NKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVW 324

Query: 222 S 222
           +
Sbjct: 325 N 325

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 34/84 (40%), Gaps = 16/84 (19%)

Query: 166 LLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTD 225
           L  SS+D  V LW    G  PI+   HPD+VTS  F      +  + C D  +R W +  
Sbjct: 156 LASSSLDHTVRLWNVEQGTNPIV-LTHPDMVTSMSFSYG-GTYLATVCRDKMLRVWDIRK 213

Query: 226 NRVEYSFNCEEPINVVTVSPGMSH 249
             V              VS GM H
Sbjct: 214 GEV--------------VSEGMGH 223

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/111 (20%), Positives = 48/111 (43%), Gaps = 3/111 (2%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRFD-HPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
           FL   + D  + +W   +  + +M    H   + S  +  + D+  +SG  D  VR W +
Sbjct: 457 FLATGAEDRLIRIWD-IENRKIVMILQGHEQDIYSLDYFPSGDKL-VSGSGDRTVRIWDL 514

Query: 224 TDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKF 274
              +   + + E+ +  V VSPG   +   G+    + V+ +    L+++ 
Sbjct: 515 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERL 565

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 3/78 (3%)

Query: 161 SVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRF 220
           S +  L   + D  + LW    G    +   H D +TS KF   D    ISG LD  +R 
Sbjct: 572 SFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKF---DATTIISGSLDGTIRL 628

Query: 221 WSVTDNRVEYSFNCEEPI 238
           W +  N +    + E+PI
Sbjct: 629 WDLRSNNLTDIISYEKPI 646

>AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248)
           [1242 bp, 413 aa]
          Length = 413

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 166 LLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTD 225
           LL +S+D  + +W+  DG  P   F H   +T    IE   R  +S   D  VR W    
Sbjct: 161 LLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIER-GRNVLSSSKDGSVRLWECGS 219

Query: 226 NRVEYSFN 233
             +  +F+
Sbjct: 220 GSMLRAFH 227

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 48/109 (44%), Gaps = 4/109 (3%)

Query: 161 SVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRF 220
           S N  LL +S D  +  W   + N     + H   +T A +++ DDR  IS  +D  VR 
Sbjct: 346 SDNKLLLSASDDKTLRTWRGGNANSSNCFYGHTQSITYADWLD-DDRL-ISTSMDGSVRV 403

Query: 221 WSVTDNR-VEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGL 268
           WSV  N  V  S     PI   T+S     F   GT  G + V++   L
Sbjct: 404 WSVKQNALVGLSVVDGVPIFCGTLSSDKQKF-ATGTLDGEVSVYNVKKL 451

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 23/111 (20%), Positives = 47/111 (42%), Gaps = 3/111 (2%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRFD-HPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
           +L   + D  + +W      + +M    H   + S  +  A D+  +SG  D  VR W +
Sbjct: 366 YLATGAEDKLIRIWD-LTTKKILMTLQGHEQDIYSLDYFPAGDKL-VSGSGDRTVRIWDL 423

Query: 224 TDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKF 274
              +   + + E+ +  V VSPG   +   G+    + V+ +    L+++ 
Sbjct: 424 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERL 474

>Kwal_23.6324
          Length = 514

 Score = 36.6 bits (83), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 166 LLVSSVDSYVT-LWTPFDGNRPIMRF-DHPDLVTSAKFIEADDRFFISGCLDHCVRFW 221
           L+V++ D +   LW P   ++PI R   H  LV    F   D R+ +S   D+ ++ W
Sbjct: 372 LMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAF-SPDGRYIVSASFDNSIKLW 428

>KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces
           cerevisiae YMR146c TIF34 translation initiation factor
           eIF3, p39 subunit singleton, start by similarity
          Length = 347

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 36/89 (40%), Gaps = 1/89 (1%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVT 224
            +   S DS  ++W   +G R     DH   + S   ++    + ++G  D C + W V 
Sbjct: 24  LVFACSKDSVASIWYAINGERLGTLDDHSGTIWSID-VDESTTYALTGGADFCFKIWKVA 82

Query: 225 DNRVEYSFNCEEPINVVTVSPGMSHFTVV 253
                +S +   P+  V  SP  S   +V
Sbjct: 83  TGVAVHSVSTRSPVLRVEFSPDGSKLLIV 111

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 36.2 bits (82), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 67/168 (39%), Gaps = 22/168 (13%)

Query: 79  GSSVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGISDAECEETGKRKIQ-YAPIF 137
           GS +  +R      LF    +DGS M+ +           +D    +T K +++ +    
Sbjct: 65  GSHLYKARLDGHDFLFNTIIRDGSKMLKR-----------ADYTAVDTAKLQMRRFILGT 113

Query: 138 NELDIVSLNSDEKVHREVLDLSWS---------VNHFLLVSSVDSYVTLWTPFDGNRPIM 188
            E DI  L+S+  + RE+     S             L+ SS D  + +W+  DG+ P  
Sbjct: 114 TEGDIKVLDSNFNLQREIDQAHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRT 173

Query: 189 RFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEE 236
              H   VT    I+   R  +S  LD  +R W        ++FN +E
Sbjct: 174 LIGHRATVTDIAIIDR-GRNVLSASLDGTIRLWECGTGTTIHTFNRKE 220

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 36.2 bits (82), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 36/84 (42%), Gaps = 3/84 (3%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRFD-HPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
           ++L  S D  V LW   +       F  H   V    F   D   F SGCLDH V+ WS+
Sbjct: 111 YILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSL 170

Query: 224 TDNRVEYSFNC--EEPINVVTVSP 245
             +   ++ +   E+ +N V   P
Sbjct: 171 GQSTPNFTLHTGQEKGVNYVDYYP 194

>Scas_660.8
          Length = 510

 Score = 35.8 bits (81), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 78/189 (41%), Gaps = 29/189 (15%)

Query: 167 LVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDN 226
           LVS  DSY     P      I    HP  VT  KF   D++  I+   D  +R W +++ 
Sbjct: 104 LVSVYDSY----NPRTILLSINASTHPTHVT--KFHPQDNKTLITASDDRVIRLWDISNA 157

Query: 227 ---RVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKFHIINGRSID 283
              ++E + + +  +  VT  P   H  V G++ G I ++ T        + +++ + I+
Sbjct: 158 YQPQLELTGSTDY-VRSVTCVPSAPHMIVSGSYDGIIRLYDTRASGSSPIYSLLHDQPIE 216

Query: 284 GNLRNGADKIKITGIE----WIVTDNR--------------LDEIQE-DNEYSTARIVVT 324
             +   A +I   G      W +T N+              LD +   D+    + ++ +
Sbjct: 217 DIISISATQIVSCGGSNFKVWDLTSNKKLYERGNFNKTVTCLDHVSSLDDSPMNSALIAS 276

Query: 325 SGDERIRVF 333
           S D  ++VF
Sbjct: 277 SLDGHVKVF 285

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 35.8 bits (81), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 30/77 (38%), Gaps = 2/77 (2%)

Query: 165 FLLVSSVDSYVTLWTPFDGNR-PIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
           +L   S D  + LW    G R   MR    + V S  F   +    ISG  DH VR W V
Sbjct: 673 WLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSF-NKEGNVLISGGADHSVRVWDV 731

Query: 224 TDNRVEYSFNCEEPINV 240
                E     E+P N 
Sbjct: 732 KHGTTEQGPEPEQPFNA 748

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 3/73 (4%)

Query: 166 LLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTD 225
           L   + D  V LW    G        H D VTS +F   D    ++G LD+ +R W +  
Sbjct: 580 LATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQF---DSLNLVTGSLDNSIRIWDLRT 636

Query: 226 NRVEYSFNCEEPI 238
             +  +F+ E P+
Sbjct: 637 GTLADTFSYEHPV 649

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMR-FD-HPDLVTSAKFIEADDRFFISGCLDHCVRFWS 222
           ++L +S D  V LW  ++ N  + + F+ H   V S  F   D   F + CLDH V+ WS
Sbjct: 111 YVLSASDDLTVKLWN-WEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWS 169

Query: 223 VTDNRVEYSFNC--EEPINVVTVSP 245
           +      ++     E+ +N V   P
Sbjct: 170 LGQETSNFTLRAHLEKGVNFVDYYP 194

>Scas_680.11
          Length = 347

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 7/92 (7%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSA---KFIEADDRFFISGCLDHCVRFW 221
            L   S D++ ++W   +G R      H   + S    KF E    + ++G  D+ ++ W
Sbjct: 24  LLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTE----YCVTGSADYSIKMW 79

Query: 222 SVTDNRVEYSFNCEEPINVVTVSPGMSHFTVV 253
            V      YS++   P+  V+ SP  ++   V
Sbjct: 80  KVETGENVYSWDSPVPVKNVSFSPCGNYVAAV 111

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 51/119 (42%), Gaps = 17/119 (14%)

Query: 152 HREVLDLSWSVNHFLLVSSV-DSYVTLW----TPFDGNRPIMRFDHPDLVT--------- 197
           +RE+  L +S +  L+ +   DSY+ LW    TP +   P    D  + VT         
Sbjct: 487 NREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVY 546

Query: 198 SAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNC-EEPINVVTVSPGMSHFTVVGT 255
           S  F   D+R+ +S   D  VR WS+       S+     P+  V  SP + H+   G+
Sbjct: 547 SVSF-SPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSP-LGHYFATGS 603

>Kwal_47.17555
          Length = 417

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 46/108 (42%), Gaps = 8/108 (7%)

Query: 149 EKVHREVLDLSW-SVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDR 207
           E  + E+ D+ +      LL  S D  + +W+  DG+ P     H   VT+   I+   R
Sbjct: 145 EGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDR-GR 203

Query: 208 FFISGCLDHCVRFWSVTDNRVEYSF----NCEEPIN--VVTVSPGMSH 249
             +S   D  ++ W        +SF    +  +P+N  ++  SPG S 
Sbjct: 204 NVMSSSKDGSLKLWECGSGETIHSFARKTDQSDPVNDMLILCSPGSSE 251

>Scas_630.6
          Length = 621

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 38/225 (16%), Positives = 81/225 (36%), Gaps = 38/225 (16%)

Query: 164 HFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
            FL   + D  + +W   +    ++   H   + S  +   D +  +SG  D  +R W +
Sbjct: 354 EFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYF-PDGQKLVSGSGDRSIRIWDL 412

Query: 224 TDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKFHIINGRSID 283
              +   + + E+ +  V VSP        G+    + ++ +    L+++          
Sbjct: 413 KTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLD-------- 464

Query: 284 GNLRNGADKIKITGIEWIVTDNRLDEIQEDNEYSTA------RIVVTSGDERIRVFKL-- 335
                              +DN      +D+ YS A       +V  S D  ++++ L  
Sbjct: 465 -------------------SDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGD 505

Query: 336 TEGGYHNLELKGFHCEQFRHRAQLCIWDDKPFIYCSSEDQWFYVW 380
           T+ G    E+     + F     +   +D  +I+  S+D+   +W
Sbjct: 506 TQSGTGKCEVTYIGHKDF--VLSVATSNDDKYIFSGSKDRGVIIW 548

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 158 LSWSVN-HFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDH 216
           + WS++ H L     D  +T+W     ++     +H  +VTS KF +A+D   IS   D 
Sbjct: 388 MDWSIDGHTLATGGGDGVITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDR 447

Query: 217 CVRFWSVTDNRVEYS 231
            +  +S  DN ++ S
Sbjct: 448 SIFVYS-KDNYLKVS 461

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 3/73 (4%)

Query: 166 LLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTD 225
           L   + D  V LW    G    M   H D +TS +F   D    ++G +D  +R W +  
Sbjct: 570 LATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQF---DSVNLVTGAMDRSIRIWDLRT 626

Query: 226 NRVEYSFNCEEPI 238
             +   F  E+PI
Sbjct: 627 GILSDVFAYEQPI 639

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 69/156 (44%), Gaps = 15/156 (9%)

Query: 75  LQLGGSSVTVSRFSKDGTLFCVGCKDGSLMVLKVL--QTKSEKLGISDAECEETG----K 128
           L L   +V V RF   G +      DG +++ K+   +T+ ++  + D   E  G    K
Sbjct: 76  LSLHEQAVNVIRFDHRGNVLASAGDDGQVLLWKLTNEETRKKQQRMGDEPVEGDGWAVWK 135

Query: 129 RKIQYAPIFNELDIVSLNSDEKVHREVLDLSWSV-NHFLLVSSVDSYVTLWTPFDGNRPI 187
           R    A   N+LD    N       E+ DLSWS  + +L+ +S+D+ + ++    GN   
Sbjct: 136 RLRGTA---NDLD----NMPGGGASEIYDLSWSPDDKYLVTASMDNSLKVFNVDTGNCVA 188

Query: 188 MRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
              DH   V    + +  +++ IS  +D  +  + +
Sbjct: 189 FAKDHNHYVQGVTW-DPLNQYIISQSVDRSINIYEI 223

>Kwal_47.17465
          Length = 800

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 65/143 (45%), Gaps = 20/143 (13%)

Query: 81  SVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGISDAECEETGKRKIQYAPIFNEL 140
           SVTV RFS DG     G  D  L++ +  + + + +  ++ + E    R+          
Sbjct: 24  SVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRR---------- 73

Query: 141 DIVSLNSDEKVHREVLDLSWSVNHFLLVS-SVDSYVTLWTPFDGNRPIMRFD-HPDLVTS 198
            +V+ ++D      + D+ W+ +  +LV+  +D  V +W      + I RFD H  LV  
Sbjct: 74  RLVAHDND------IQDICWAPDSSILVTVGLDRSVIVWNGSTFEK-IKRFDVHQSLVKG 126

Query: 199 AKFIEADDRFFISGCLDHCVRFW 221
             F  A +++F +   D  VR +
Sbjct: 127 VIFDPA-NKYFATASDDRTVRIF 148

>Scas_719.52
          Length = 628

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 164 HFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
           + L  SS+D  V LW   +    ++   HPD+VTS  F    +    + C D  +R W +
Sbjct: 154 NVLASSSLDYTVKLWN-IETGEAVITLKHPDMVTSMSFSYGGNH-LATVCRDKKLRVWDI 211

Query: 224 TDNRV 228
            + ++
Sbjct: 212 REGKI 216

>Scas_658.1
          Length = 442

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 43/104 (41%), Gaps = 4/104 (3%)

Query: 164 HFLLVSSVDSYVTLWTPFDGNRPIMR--FDHPDLVTSAKFIEADDRFFISGCLDHCVRFW 221
           + LL    D+ V +W  F   R ++R    H   + S  F + D   FIS   DH ++ W
Sbjct: 163 NLLLSGGNDNIVKVWD-FYHKRNLLRDYKGHSKAINSLDFND-DGTNFISSSFDHTIKIW 220

Query: 222 SVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFST 265
                +V+   + +   N V   P  S   +VG     IY + T
Sbjct: 221 DTEQGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHYDT 264

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 162 VNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFW 221
             + L  SS D  V LW   +  + ++   HPD+VTS  F   D  +  +   D  +R W
Sbjct: 152 AENVLASSSGDYTVKLWN-VETGKDMITLKHPDMVTSMSF-SYDGNYLATVARDKKLRVW 209

Query: 222 SVTDNRV 228
           ++ + ++
Sbjct: 210 NIREEKI 216

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 186 PIMRFD-HPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVS 244
           P+  F+ H   VTS  F + D+++ +S   D  ++ W V    V+ ++  + P+N V + 
Sbjct: 67  PVTSFEGHRGNVTSIAF-QQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEVVIH 125

Query: 245 P 245
           P
Sbjct: 126 P 126

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 163 NHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWS 222
           N  LL  S D  + +W+  DG+ P     H   +T    IE   R  +S  LD  VR W 
Sbjct: 153 NAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIER-GRNVLSSSLDGSVRLWE 211

Query: 223 VTDNRVEYSF 232
           +   +    F
Sbjct: 212 LGSGKTISKF 221

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 186 PIMRFD-HPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVS 244
           P+  F+ H   VTS  F + ++R+ +S   D  ++ W V    V+ ++    P+N V + 
Sbjct: 67  PVSSFEGHKGNVTSIAF-QQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVAIH 125

Query: 245 P 245
           P
Sbjct: 126 P 126

>Scas_719.30
          Length = 940

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 60/148 (40%), Gaps = 19/148 (12%)

Query: 192 HPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMSHFT 251
           H + +T+  F   D R+ +S  LD  +R W +           E     V  SP      
Sbjct: 585 HSNRITALDF-SPDGRWIVSASLDSTIRTWDLPTGGCIDGIKLESVATDVKFSPNGDMLA 643

Query: 252 VVGTFGGYIYVFSTMGLKLIDKFHIINGRSIDGN------LRNGADKIKITGIEWIVT-- 303
                G  IY+++        +F  I+ R+ID        L +G+    ++G E ++T  
Sbjct: 644 TTHVIGNGIYIWNNKA-----QFKAISTRAIDEEEFENLMLPSGS----LSGNEAMLTGA 694

Query: 304 -DNRLDEIQEDNEYSTARIVVTSGDERI 330
            ++  DE  +D E++T   +    DE +
Sbjct: 695 FEDSKDEKTDDTEFNTYETLAQINDELV 722

>YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransferase
           subunit 2, contains seven WD (WD-40) repeats [1206 bp,
           401 aa]
          Length = 401

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 58/144 (40%), Gaps = 11/144 (7%)

Query: 145 LNSDEKVHRE---VLDLSWSVNHFLLVSSVDSYVTLW---TPFDGNRPIMRFD--HPDLV 196
           L S  K H++    L  S  V   LL  S D  V LW   +  D  +P+  ++  H D++
Sbjct: 152 LQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDII 211

Query: 197 TSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEY-SFNCEEPINVVTVSPGMSHFTVVGT 255
              K+   +   F +   D  ++   V  N     +  C +P N +  S   S+      
Sbjct: 212 NDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAG 271

Query: 256 FGGYIYVFSTMGLKLIDKFHIING 279
              Y+Y++    +K  +  H ++G
Sbjct: 272 MDSYVYLYDLRNMK--EPLHHMSG 293

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 2/63 (3%)

Query: 166 LLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTD 225
           L  SS+D  V +W    G   I +  HPD+VTS  F   D     +   D  +R W+V +
Sbjct: 155 LASSSLDYTVRIWNVETGED-IYKLKHPDMVTSMSF-SYDGTHLATVARDKKLRVWNVRE 212

Query: 226 NRV 228
            +V
Sbjct: 213 EKV 215

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 3/58 (5%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWS 222
            L   S DS + +W  F G        H D V +  F   DDR  I+G LD  +R W+
Sbjct: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---DDRKLITGSLDKTIRVWN 368

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 3/79 (3%)

Query: 155 VLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCL 214
           VLD +      LL   +D+ + LW    G     +F H   V     I AD+   ISG  
Sbjct: 514 VLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGH---VEGVWDIAADNFRIISGSH 570

Query: 215 DHCVRFWSVTDNRVEYSFN 233
           D  ++ W +   +  ++FN
Sbjct: 571 DGSIKVWDLQSGKCMHTFN 589

>Scas_659.9
          Length = 475

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 7/81 (8%)

Query: 321 IVVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLCIWDDKPFIYCSSEDQWFYVW 380
           IV  S D+ IR+F  T G  H+ E+  +H ++ +H  Q+    D  +I   S+D    +W
Sbjct: 314 IVTGSYDKTIRIFNTTHG--HSREI--YHTKRMQHVFQVKFSMDAKYIVSGSDDGNVRLW 369

Query: 381 R---LNYQDLMLTRATNEILY 398
           R       ++  T+  N++ Y
Sbjct: 370 RSKAWERSNVKTTKEKNKLAY 390

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 40/104 (38%), Gaps = 10/104 (9%)

Query: 156 LDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIE-----ADDRFFI 210
           L L     H +L    D+ V LW  F  +R  +R    D V  +K I+     +D   F+
Sbjct: 154 LRLLPGTGHLILSGGNDNTVKLWD-FYHDRKCLR----DFVGHSKPIKTLDFTSDSSQFL 208

Query: 211 SGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVG 254
           SG  D  V+ W     +V    N     N     P   +  VVG
Sbjct: 209 SGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVG 252

>Kwal_23.5351
          Length = 474

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 1/67 (1%)

Query: 153 REVLDLSWSVN-HFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFIS 211
           + +  +SWS N H +   S D  V +W     N+P     H  +V+   F + +  F +S
Sbjct: 356 KPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVS 415

Query: 212 GCLDHCV 218
              D  +
Sbjct: 416 SSYDRTI 422

>Scas_718.6*
          Length = 546

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 9/128 (7%)

Query: 154 EVLDLSWSVNHFLLVSSVDS-YVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISG 212
           ++  LSWS +  L+++SV++  + LW      + +  F H   + S K+ E D + FIS 
Sbjct: 240 QITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNF-HRSPIVSIKWNE-DSKHFISL 297

Query: 213 CLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGM------SHFTVVGTFGGYIYVFSTM 266
            LD+    W+  +  +   F  E+ +   T S G+          VV    G I V+S  
Sbjct: 298 DLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSID 357

Query: 267 GLKLIDKF 274
             K I K 
Sbjct: 358 DNKPIGKL 365

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 7/90 (7%)

Query: 321 IVVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLCIWDDKPFIYCSSEDQWFYVW 380
           IV  S D+ IR++K   G  H+ E+  +H ++ +H  Q+    D  +I   S+D    +W
Sbjct: 320 IVTGSYDKSIRIYKTNHG--HSREI--YHTKRMQHVFQVKYSMDSKYIISGSDDGNVRLW 375

Query: 381 R---LNYQDLMLTRATNEILYASTTHRRRR 407
           R       ++  TR  N++ Y      R R
Sbjct: 376 RSKAWERSNVKTTREKNKLEYDEKLKERFR 405

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 186 PIMRFD-HPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVS 244
           P+  F+ H   VTS  F + D+++ +S   D  ++ W V    V+ ++    P+N V + 
Sbjct: 67  PVTSFEGHRGNVTSISF-QQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVIH 125

Query: 245 P 245
           P
Sbjct: 126 P 126

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 161 SVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRF 220
           S +H   V S++    L T  DG        H   V    F  AD  + ++ C DH VR 
Sbjct: 226 SADHTARVWSIEDNFKLETTLDG--------HQRWVWDCAF-SADSAYLVTACSDHYVRL 276

Query: 221 WSVT 224
           W ++
Sbjct: 277 WDLS 280

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 33.1 bits (74), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 59/135 (43%), Gaps = 16/135 (11%)

Query: 111 TKSEKLGISDAECEETG------KRKIQYAPIFN---------ELDIVSLNSDEKVHREV 155
           T  +K+  +  EC++        K KIQ   + N         EL++  + + +  + ++
Sbjct: 30  TVEDKIRTAKTECKQLYDQINRIKGKIQDTQLMNLSHGVNSLHELNLQPVRTLKGHNNKI 89

Query: 156 LDLSWSVNHF-LLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCL 214
            D+ WS +   +L SS D ++ +W PF G +          V S+    + +    +G  
Sbjct: 90  SDVKWSQDSASVLSSSQDGFIIIWDPFTGLKKSAIPLLSQWVLSSAISPSGNLVASAGLD 149

Query: 215 DHCVRFWSVTDNRVE 229
           +HC  +    DNR++
Sbjct: 150 NHCSVYRVSRDNRIQ 164

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 321 IVVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLCIWDDKPFIYCSSEDQWFYVW 380
           +V  S D+ IR+F + +G  H+ E+  +H ++ +H  Q     D  ++   S+D    +W
Sbjct: 317 VVTASYDKTIRIFPINKG--HSREI--YHTKRMQHVFQAKFSMDSKYVMSGSDDGNVRLW 372

Query: 381 RLNYQDLMLTRATNEI 396
           R    +    ++T E+
Sbjct: 373 RAKAWERSNVKSTKEL 388

>Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement
          Length = 411

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 5/74 (6%)

Query: 172 DSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYS 231
           D  + +W+  DG+ P     H  ++T  + IE   R  +S   D  V+ W     +  Y+
Sbjct: 162 DMRLKIWSALDGSNPRTIMGHKSIITGTEIIER-GRNILSCSKDGTVKLWECGSGKNIYT 220

Query: 232 F----NCEEPINVV 241
           F    N ++ +N +
Sbjct: 221 FTRRENKKDSVNAI 234

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 32.7 bits (73), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 186 PIMRFD-HPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVS 244
           P+  F+ H   VTS  F + D+R+ ++   D  ++ W V    +  ++    P+N V + 
Sbjct: 67  PVASFEGHRGNVTSVSF-QQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIH 125

Query: 245 P 245
           P
Sbjct: 126 P 126

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 5/85 (5%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMR-FD-HPDLVTSAKFIEADDRFFISGCLDHCVRFWS 222
           ++L  S D  V LW  ++ N  + + F+ H   V    F   D   F SGCLD  V+ WS
Sbjct: 111 YVLSGSDDLTVKLWN-WENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWS 169

Query: 223 VTDNRVEYSFNC--EEPINVVTVSP 245
           +  +   ++     E  +N V   P
Sbjct: 170 LGQSTPNFTLTTGQERGVNYVDYYP 194

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 32.7 bits (73), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 49/111 (44%), Gaps = 14/111 (12%)

Query: 166 LLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFI-------EADDR--FFISGCLDH 216
           ++ +S D  + +W    G+   +   H D VT  +         E DD    F+S  +D 
Sbjct: 123 IISASRDKTIRVWNTV-GDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDK 181

Query: 217 CVRFWSVTDN--RVEYSF-NCEEPINVVTVSPGMSHFTVVGTFGGYIYVFS 264
            VR WS+ ++  R+E  F      INVV  SP  S     G   G IYV++
Sbjct: 182 IVRSWSLNEDSYRIEADFIGHNNYINVVQPSPDGSLAASAGK-DGQIYVWN 231

>Scas_629.12
          Length = 671

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 46/112 (41%), Gaps = 3/112 (2%)

Query: 164 HFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
            FL   + D  + +W   +    ++   H   V S  +    ++  +SG  D  VR W +
Sbjct: 400 EFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKL-VSGSGDRTVRIWDL 458

Query: 224 TDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVF-STMGLKLIDKF 274
              +   + + E  +  V VSP    F   G+    + V+ ST G  L+++ 
Sbjct: 459 RTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGF-LVERL 509

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 22/56 (39%), Gaps = 2/56 (3%)

Query: 192 HPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEP--INVVTVSP 245
           H   V    F   D   F S CLDH V+ WS+      ++    E   +N V   P
Sbjct: 21  HEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYP 76

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 5/76 (6%)

Query: 172 DSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADD--RFFISGCLDHCVRFWSVTDNRVE 229
           DS  ++W   +G R      H   + S   I+ D    + ++G  D  V+ W V D    
Sbjct: 31  DSVASVWYAINGERLGTFEGHMGTIWS---IDVDQFTEYAVTGSADFSVKLWKVCDGSNV 87

Query: 230 YSFNCEEPINVVTVSP 245
           Y++  + P+  V  SP
Sbjct: 88  YTWKTKTPVRRVEFSP 103

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 321 IVVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLCIWDDKPFIYCSSEDQWFYVW 380
           IV  S D+ IR+F L  G  H+ E+  +H ++ +H  Q+    D  +I   S+D    +W
Sbjct: 317 IVTGSYDKTIRIFNLKHG--HSREV--YHTKRMQHVFQVKFTMDSKYIVSGSDDGNVRLW 372

Query: 381 RLNYQDLMLTRATNE 395
           R    +    + T E
Sbjct: 373 RAKAWERSHVKTTKE 387

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 73/173 (42%), Gaps = 22/173 (12%)

Query: 81  SVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGISDAECEETGKRKIQYAPIFNEL 140
           SVT  +FS DG     G  D  L++  + +        S+ E E    RK          
Sbjct: 76  SVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRK---------- 125

Query: 141 DIVSLNSDEKVHREVLDLSWSVNHFLLVS-SVDSYVTLWTPFDGNRPIMRFD-HPDLVTS 198
            +V+ ++D      + D+ W+ +  +LV+  +D  V +W   +  R + RFD H  LV  
Sbjct: 126 RLVAHDND------IQDICWAPDSSILVTVGLDRSVIVWNGLNFER-LKRFDVHQSLVKG 178

Query: 199 AKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPI-NVVTVSPGMSHF 250
             F  A +++F +   D  +R +       E SF  E+ I      SP  ++F
Sbjct: 179 VIFDPA-NKYFATASDDRTMRVFRYHKTG-EVSFTIEQVIVEPFIASPLTTYF 229

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 32.7 bits (73), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 3/58 (5%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWS 222
            L   S D+ V +W  F G        H D V +  F   DD+  I+G LD  +R W+
Sbjct: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF---DDQKLITGSLDKTIRVWN 400

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 32.3 bits (72), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 13/94 (13%)

Query: 93  LFCVGCKDGSLMVLKV--LQTKSEKLGISDAE---CEETGKRKIQYAPIFNELDI-VSLN 146
           L   GCKDG + + +V    +KS    +SD++    E+ G ++ Q     N  D+ V L 
Sbjct: 230 LIATGCKDGRVRIFRVNDSPSKSNTPNLSDSDDYNMEDQGIKQRQ-----NNTDLEVELL 284

Query: 147 SDEKVHR-EVLDLSWSVNHFLLVSS-VDSYVTLW 178
           S+   H+ EV  +SW++   +L S+  D  V LW
Sbjct: 285 SEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLW 318

>Kwal_33.15136
          Length = 473

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 4/75 (5%)

Query: 321 IVVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLCIWDDKPFIYCSSEDQWFYVW 380
           IV  S D+ IR++++  G  H+ E+  +H ++ +H  Q+    D  +I   S+D    +W
Sbjct: 315 IVTGSYDKTIRIYQVKHG--HSREI--YHTKRMQHVFQVKYTMDSRYIVSGSDDGNVRMW 370

Query: 381 RLNYQDLMLTRATNE 395
           R    D    ++T E
Sbjct: 371 RAKAWDRSSVKSTRE 385

>Kwal_23.5769
          Length = 627

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 4/91 (4%)

Query: 155 VLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCL 214
            LD S      LL  S+D+ + LW    G      F H + +     I AD+   +SG  
Sbjct: 521 ALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWD---IAADNFRIVSGAH 577

Query: 215 DHCVRFWSVTDNRVEYSFNCEE-PINVVTVS 244
           D  V+ W +   +  ++F+  + PI  V + 
Sbjct: 578 DKTVKVWDLQSGKCIHTFDSHQAPITCVGIG 608

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 44/103 (42%), Gaps = 8/103 (7%)

Query: 163 NHFLLVSSVDSYVTLWTPFDGNRPIMRFD-HPDLVTSAKFIEADDRFFISGCLDHCVRFW 221
           N  L   + D  V LW    G +P+   + H D +TS KF   D    ++G +D+ VR W
Sbjct: 515 NSALATGTKDGIVRLWDLRVG-KPVRLLEGHTDGITSLKF---DSEKLVTGSMDNSVRIW 570

Query: 222 SVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFS 264
            +  + +      + P++ +           VG   G + VF+
Sbjct: 571 DLRTSSILDVIAYDLPVSSLDFD---GKLITVGANEGGVNVFN 610

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 30/66 (45%), Gaps = 4/66 (6%)

Query: 158 LSWSVNHFLLVS-SVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDH 216
           LS   NH LL + S DS V +W    GN       H D V    F   DD+  I+  LD 
Sbjct: 316 LSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF---DDQKMITASLDK 372

Query: 217 CVRFWS 222
            +R W+
Sbjct: 373 TIRVWN 378

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEAD--DRFFISGCLDHCVRFWS 222
            L   S D   ++W   +G R      H   + S   I++D    + ++G  D+ ++ W+
Sbjct: 24  LLFTCSKDISASVWYSNNGERLGTLDGHMGSIWS---IDSDHTSLYCVTGSADYTIKVWT 80

Query: 223 VTDNRVEYSFNCEEPINVVTVSP 245
           + + +   ++NC  P+  V  SP
Sbjct: 81  LMNGQCVQTWNCPVPVKRVEFSP 103

>Kwal_27.9840
          Length = 471

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/95 (21%), Positives = 36/95 (37%), Gaps = 12/95 (12%)

Query: 235 EEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKFHIINGRSIDGNLRNGADKIK 294
           + P+ ++ +SP  +      T G  + +F T    L+ +F            R G D+  
Sbjct: 276 KSPLRLIKLSPNGAMIATCSTQGTIVRIFGTQSGSLVAEF------------RRGLDRAD 323

Query: 295 ITGIEWIVTDNRLDEIQEDNEYSTARIVVTSGDER 329
           I  + W    NRL  + +       +I    GD +
Sbjct: 324 IYEMAWSPRSNRLALVSDKQTLHIFQITNEDGDMK 358

>Kwal_27.12053
          Length = 755

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 30/74 (40%), Gaps = 2/74 (2%)

Query: 165 FLLVSSVDSYVTLWTPFDGNR-PIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
           +L   S D  + +W    G R   MR    + V S  +   +    ISG  DH VR W V
Sbjct: 622 WLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSY-SKEGHVLISGGADHSVRVWDV 680

Query: 224 TDNRVEYSFNCEEP 237
             +  E     E+P
Sbjct: 681 KKSTAEPGSEPEQP 694

>Scas_624.11
          Length = 1205

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRF-DHPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
           ++LV+   S + LW    G   + RF DH   V S  F       F+SG  D+ ++ WS+
Sbjct: 25  WVLVALFSSTIQLWDYRMGTL-LHRFEDHEGPVRSVDF-HPTQPIFVSGGDDYTIKVWSL 82

Query: 224 TDNRVEYSFN 233
             N+  Y+ N
Sbjct: 83  ETNKCLYTLN 92

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 15/99 (15%)

Query: 155 VLDLSWSVN-HFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGC 213
           VL + +SV+   L+ SS D  + +W    G+     F H D + S +F EAD   F S  
Sbjct: 567 VLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMSVRF-EADTHNFFSCG 625

Query: 214 LDHCVRFWSVTDNRVEYSFNCEEPIN-------VVTVSP 245
            D  V+ W          F+C + +N        + VSP
Sbjct: 626 KDGAVKRWDGD------KFDCIQKLNGHQSEVWCIAVSP 658

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 14/98 (14%)

Query: 81  SVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGISDAECEETGKRKIQYAPIFNEL 140
           +V V RF+K G        DG L++ K  +T  ++ G+ D E ++           F E 
Sbjct: 73  AVNVCRFNKQGDTLATAGDDGLLLLWKKNETMVKEFGVDDDEFQD-----------FKES 121

Query: 141 DIV--SLNSDEKVHREVLDLSWSVNHF-LLVSSVDSYV 175
             V   L S    + E+ D+SW+     + ++S+D+ V
Sbjct: 122 WAVWKRLRSGSASNAEIYDISWNPQGTCIAIASLDNTV 159

>CAGL0K09768g 954713..956167 similar to sp|P27929 Saccharomyces
           cerevisiae YNL137c NAM9, start by similarity
          Length = 484

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 37/92 (40%), Gaps = 8/92 (8%)

Query: 98  CKDGSLMVLKVLQTKSEKLGISDAECEETGKRKIQYAPIFNELDIVSLNSDEKVHREVLD 157
            K  S  V+   + K     I+++  +      ++Y P    LD+ ++  DE   RE ++
Sbjct: 345 VKKYSQSVINHFKNKQTDGSIANSSFDPKWAENLKYHP---RLDLEAIKEDEVKAREAIN 401

Query: 158 LSWSVNHFL-LVSSVDSYVTLWTPFDGNRPIM 188
           L W   H      S   Y T W P    RP +
Sbjct: 402 LPWQSKHLYGRKDSNKPYFTPWKP----RPFL 429

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 186 PIMRFD-HPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVS 244
           P+  F+ H   VTS  F + D+++ ++   D  ++ W +    V  ++    P+N V + 
Sbjct: 67  PVASFEGHRGNVTSVSF-QQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIH 125

Query: 245 P 245
           P
Sbjct: 126 P 126

>ACR162C [1209] [Homologous to ScYPL126W (NAN1) - SH]
           (637642..640224) [2583 bp, 860 aa]
          Length = 860

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 175 VTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEY 230
           +TL    DG+  ++++ H D V +  F   DD + ISG  +  V FW ++ N  ++
Sbjct: 263 ITLINVSDGSSRLLKW-HIDAVLAMSF-SVDDTYLISGGWEKVVSFWQLSTNLQQF 316

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 164 HFLLVSSVDSYVTLWTPFDGNRPIMRF--DHPDLVTSAKFIEADDRFFISGCLDHCVRFW 221
           + L  SS+D  V +W   D ++  ++F   HPD+VTS  F   D +  ++   D  +R W
Sbjct: 166 NILASSSLDYTVKIW---DISQEEVKFTLKHPDMVTSMSF-SYDGKHLVTVSRDKKLRVW 221

Query: 222 SVTDNRV 228
            V   ++
Sbjct: 222 DVRAEKI 228

>Scas_720.45
          Length = 755

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 201 FIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNC--EEPINVVTVSP 245
           F   D   F SGCLD  V+ WS+      ++ N   E+ +N V   P
Sbjct: 5   FNPKDPNTFASGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYP 51

>Kwal_34.15818
          Length = 349

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/83 (20%), Positives = 36/83 (43%), Gaps = 5/83 (6%)

Query: 165 FLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADD--RFFISGCLDHCVRFWS 222
            +   + D+  ++W   +G R      H   + S   I+ D   ++ ++G  D  ++ W 
Sbjct: 24  LIFTCAKDNVASVWYSINGERLGTFEGHQGTIWS---IDVDQFTQYAVTGSADFSIKLWK 80

Query: 223 VTDNRVEYSFNCEEPINVVTVSP 245
           V D    +++  + P+  V  SP
Sbjct: 81  VQDGTNVFTWKTKTPVRRVQFSP 103

>Scas_695.15
          Length = 327

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 26/59 (44%), Gaps = 1/59 (1%)

Query: 192 HPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMSHF 250
           H   VTS  F + D+++ ++   D  ++ W V    V  ++    P+N V + P     
Sbjct: 94  HKGNVTSVSF-QQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGEL 151

>Kwal_27.12667
          Length = 721

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 30/76 (39%), Gaps = 3/76 (3%)

Query: 166 LLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTD 225
           +   + D  V LW    G        H D VT  +F   D    ++G LD  +R W +  
Sbjct: 583 MATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQF---DSVNLVTGSLDRSIRIWDLRT 639

Query: 226 NRVEYSFNCEEPINVV 241
             +  +F    PI+ +
Sbjct: 640 GLLADAFAYNSPISSL 655

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 14/89 (15%)

Query: 192 HPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFN-------CEEPINVVTVS 244
           H   V + KF+  D +  +SG  D  VR W++   +  + F        C E      V 
Sbjct: 299 HEGGVWALKFV--DGKILVSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLE-----VVE 351

Query: 245 PGMSHFTVVGTFGGYIYVFSTMGLKLIDK 273
            G S + V G+    ++V+    +K +DK
Sbjct: 352 YGDSKYIVTGSRDNTLHVWKLPPMKELDK 380

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 4/75 (5%)

Query: 321 IVVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLCIWDDKPFIYCSSEDQWFYVW 380
           +V  S D+ IR++++  G  H+ E+  +H ++ +H  Q+    D  +I   S+D    +W
Sbjct: 313 VVTGSYDKTIRIYQVKHG--HSREI--YHTKRMQHIFQVKYTMDSKYIVSGSDDGNVRLW 368

Query: 381 RLNYQDLMLTRATNE 395
           R    +    ++T E
Sbjct: 369 RAKAWERSNAKSTRE 383

>YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and
           COMPASS complex, contains a WD (WD-40) repeat [1281 bp,
           426 aa]
          Length = 426

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 52/129 (40%), Gaps = 15/129 (11%)

Query: 153 REVLDLSWSVN-HFLLVSSVDSYVTLWTPFDGNRPI--MRFDHPDL----------VTSA 199
           R +  ++WS +   LL SS D  + LW     ++P+  +RFD P            +  A
Sbjct: 73  RPITSIAWSPDGRLLLTSSRDWSIKLWDLSKPSKPLKEIRFDSPIWGCQWLDAKRRLCVA 132

Query: 200 KFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGY 259
              E  D + I    D      S +D +   S      + V TV     +  +VGT  G+
Sbjct: 133 TIFEESDAYVIDFSNDPVASLLSKSDEKQLSSTPDHGYVLVCTVHTKHPNIIIVGTSKGW 192

Query: 260 I--YVFSTM 266
           +  Y F ++
Sbjct: 193 LDFYKFHSL 201

>Kwal_56.24163
          Length = 729

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 2/47 (4%)

Query: 201 FIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEP--INVVTVSP 245
           F   D   F S CLDH V+ WS+      ++    E   +N V   P
Sbjct: 5   FNPKDPSTFASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYP 51

>Scas_704.40
          Length = 608

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 154 EVLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGC 213
           + LD S      LL  S+D+ + LW    G     +F H + V     I AD+   ISG 
Sbjct: 468 QTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWD---IAADNFRIISGS 524

Query: 214 LDHCVRFWSVTDNRVEYSFN 233
            D  ++ W +   +  ++F+
Sbjct: 525 HDGSIKIWDLQSGKCMHTFH 544

>Scas_603.5
          Length = 589

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 38/98 (38%), Gaps = 3/98 (3%)

Query: 143 VSLNSDEKVHREVLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFI 202
           +S NS   +    ++   SV   L   S D  + LW    G        H   +TS +F 
Sbjct: 431 LSHNSGTNIKDSTVEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQF- 489

Query: 203 EADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINV 240
             D    I+G  D  +    +    +  +++C+ PIN 
Sbjct: 490 --DSTKIITGSTDANISVSDLRTGNILETYHCDAPINT 525

>Kwal_56.23920
          Length = 937

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 202 IEADDRFFISGCLDHCVRFWSVTDNRV 228
           I +D RF +S   D  +R WS TD++V
Sbjct: 659 ISSDGRFVVSASHDQSIRVWSETDDQV 685

>Scas_589.13
          Length = 1311

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 11/88 (12%)

Query: 161 SVNHFLLVSSVDSYVTLWTPFDGNR------PIMRF--DHPDLVTSAKFIEADDRFFISG 212
           S NH+  + +  + +++   FD +R      P++    +H   V S  F        ISG
Sbjct: 184 SSNHYTAICTTSTDISI---FDISRNINIENPLLTSLSEHTRSVNSFDFNMVQSNLIISG 240

Query: 213 CLDHCVRFWSVTDNRVEYSFNCEEPINV 240
             D CV+ W +  N ++ S  C+   N 
Sbjct: 241 GQDGCVKIWDLRSNSIKGSSRCDISFNT 268

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 91/228 (39%), Gaps = 38/228 (16%)

Query: 175 VTLWTPFDGNRPIMRF---DHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYS 231
           + LW P + N   +      H   VT  +F+  D  F +S   DH V+ W  TD    YS
Sbjct: 38  IALWDPIEPNNKGVYATLKGHEAEVTCVRFV-PDSDFMVSASEDHHVKIWKFTD----YS 92

Query: 232 -FNCEEPIN-----VVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKFHIINGRSIDGN 285
              C + I      +V +S  +     VG   G I ++        D+F    G + +  
Sbjct: 93  HLQCIQTIQHYSKTIVALS-ALPSLISVGCADGTISIWRQNIQN--DEF----GLAHEFT 145

Query: 286 LRNGADKIKITGIEWIVTDNRLDEI--QEDNEYSTARIVVTSGDERIRVFKLTEGGYHNL 343
           ++ G        +  +     L  I     N +  + I+  SG E+ RV    EG  H  
Sbjct: 146 IKKGFFYPLCLSLSKVEEKKYLLAIGGTNVNVFIASFILSDSGIEKCRVVAELEG--HED 203

Query: 344 ELKGFHCEQFRHRAQLCIWDDKP--FIYCS-SEDQWFYVWRLNYQDLM 388
            +K      FRH+       + P  ++ CS S+D++  +WR+   DL+
Sbjct: 204 WVKSL---AFRHQ-------ETPGDYLLCSGSQDRYIRLWRIRINDLI 241

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 59/145 (40%), Gaps = 24/145 (16%)

Query: 75  LQLGGSSVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGISDAECEETGKRKIQYA 134
           +Q   S+VTV  +S  G     G  DG L + +      + +  +  EC     R+I ++
Sbjct: 119 MQAHDSAVTVMTYSHTGDWMVSGSADGELKIWQPNFNMVKVMDQAHMEC----VREISFS 174

Query: 135 PI---------FNELDIVSLNSDEKV------HREVLDLSWSVNHFLLVS-SVDSYVTLW 178
           P           N L I + ++ ++       H +V    W     L+VS S D+ +  W
Sbjct: 175 PTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFW 234

Query: 179 TPFDGN--RPIMRFDHPDLVTSAKF 201
            P  G+    ++ F H   + S KF
Sbjct: 235 DPRSGSCVSTMLGFKH--TIISTKF 257

>Kwal_33.13515
          Length = 398

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 7/48 (14%)

Query: 192 HPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPIN 239
           H   +T  K ++ D+RF ++G LD    FW ++      S  CE  IN
Sbjct: 235 HTGAITCMK-LDPDNRFLVAGSLDTICSFWDLS------SMCCERVIN 275

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 17/81 (20%), Positives = 34/81 (41%), Gaps = 1/81 (1%)

Query: 164 HFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSV 223
           H  L SS+D  + +W    G        H   V     ++   R F+S   D  ++ W  
Sbjct: 171 HGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRG-RNFVSASSDGSLKLWEC 229

Query: 224 TDNRVEYSFNCEEPINVVTVS 244
           + +   ++ N  + IN ++++
Sbjct: 230 STSACVFTLNSNDGINCISLA 250

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,302,875
Number of extensions: 858588
Number of successful extensions: 2740
Number of sequences better than 10.0: 125
Number of HSP's gapped: 2731
Number of HSP's successfully gapped: 148
Length of query: 583
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 476
Effective length of database: 12,891,983
Effective search space: 6136583908
Effective search space used: 6136583908
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)