Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K11616g32031516710.0
YKL120W (OAC1)32431414160.0
Scas_721.12932331113910.0
Sklu_2430.1032430713230.0
Kwal_26.765332530613140.0
KLLA0B12826g31931112611e-176
ABL023W3093086926e-90
Sklu_2432.52882913061e-32
YLR348C (DIC1)2983012702e-27
Scas_702.103022862607e-26
CAGL0G01166g2952882474e-24
Sklu_2363.23233062441e-23
YIL134W (FLX1)3113032353e-22
CAGL0J01661g3273122353e-22
Sklu_2359.69022912316e-21
ADL049W9122822309e-21
Scas_709.93652982261e-20
YPR011C3262942222e-20
KLLA0E13453g9062982272e-20
KLLA0D15015g3173212222e-20
Kwal_47.173218813062272e-20
Scas_602.88852862272e-20
Sklu_2431.53703112223e-20
AAR036W3173232203e-20
YMR056C (AAC1)3092812161e-19
Scas_640.253063012151e-19
YPR021C (AGC1)9022912192e-19
CAGL0J02002g3612952152e-19
YEL006W3353232117e-19
YPL134C (ODC1)3102972091e-18
CAGL0F04213g3062752081e-18
CAGL0K02365g9192882122e-18
YBL030C (PET9)3182742063e-18
Kwal_26.86692963082053e-18
Kwal_23.39653073262044e-18
ADL009W3792982064e-18
Scas_721.273743432065e-18
YBR085W (AAC3)3072922011e-17
ACR109W2992882001e-17
YJR095W (SFC1)3222932002e-17
KLLA0D07073g2972991983e-17
Kwal_55.208683802992003e-17
Scas_667.43082871973e-17
Sklu_2334.23193011984e-17
Kwal_14.22103153191974e-17
YOR222W (ODC2)3071671974e-17
KLLA0D09889g3642141976e-17
Scas_489.42972831957e-17
Kwal_27.124813042831957e-17
Scas_718.243373021968e-17
KLLA0E18810g3772811961e-16
Kwal_23.47313143001922e-16
YIL006W3732891942e-16
YGR096W (TPC1)3143251895e-16
AGL311C3622031905e-16
KLLA0E09680g3073071887e-16
Scas_589.103162131887e-16
Scas_691.43343121888e-16
YBR291C (CTP1)2992881879e-16
Scas_716.293163231871e-15
AER184W3052741861e-15
Sklu_1149.22962861851e-15
KLLA0E23705g3683401862e-15
CAGL0L02079g2972861833e-15
KLLA0E12353g3052851791e-14
CAGL0M05225g3813161801e-14
Scas_669.63732141792e-14
Kwal_26.79672973091772e-14
AEL253W3653061773e-14
Kwal_27.120813693431773e-14
CAGL0M09020g3482111764e-14
YMR166C3682051764e-14
YPR058W (YMC1)3073211745e-14
CAGL0G03135g3073271728e-14
KLLA0F03212g3052871702e-13
KLLA0E02772g2842751682e-13
KLLA0D14036g4312221668e-13
Kwal_55.213353172711622e-12
Scas_667.223063171612e-12
CAGL0F07711g3682491613e-12
Sklu_2037.23103021604e-12
CAGL0J09790g3002891569e-12
AGL047C3163061561e-11
Sklu_2127.52782781561e-11
Sklu_2075.33451941562e-11
KLLA0D04290g1881831502e-11
KLLA0F04697g3072931532e-11
Kwal_33.154463053201532e-11
CAGL0J04114g3032841514e-11
Kwal_47.182163333151515e-11
YGR257C (MTM1)3662831509e-11
YBR104W (YMC2)3293121499e-11
CAGL0D01606g3053111491e-10
Kwal_27.116262992961481e-10
YNL083W5452131492e-10
CAGL0G08910g2892911452e-10
CAGL0H03839g2822861443e-10
CAGL0B03883g3062941444e-10
Scas_562.123002971444e-10
AFL196W3611871454e-10
Scas_328.12271511415e-10
AGR383W2933041426e-10
Scas_632.92922911418e-10
Kwal_27.125993042951419e-10
YOR100C (CRC1)3272431411e-09
YBR192W (RIM2)3773181411e-09
YDL198C (YHM1)3003111392e-09
Sklu_2117.22982891382e-09
Sklu_1275.13113031382e-09
YKR052C (MRS4)3041981382e-09
Sklu_2374.75133251393e-09
KLLA0A00979g3431311383e-09
Scas_662.123081781373e-09
Scas_379.23011941373e-09
KLLA0F13464g3002821373e-09
Kwal_23.30425423291383e-09
AFR146W2811951354e-09
Kwal_33.140503142911356e-09
Kwal_47.192282811201338e-09
Sklu_2433.84201311358e-09
Scas_687.15*3281261349e-09
KLLA0A09383g3662781349e-09
Sklu_2398.43091981339e-09
CAGL0J05522g5193261359e-09
Kwal_23.35293951871341e-08
Scas_718.53242981321e-08
ACR260W3111801312e-08
CAGL0F08305g3742821312e-08
CAGL0B04543g3173191302e-08
KLLA0F08547g3081971303e-08
Scas_645.93912891303e-08
KLLA0B08503g3031901293e-08
KLLA0F17864g3071821293e-08
YFR045W2851491284e-08
YJL133W (MRS3)3142301284e-08
AGR191W2983061284e-08
AFR147C3152811285e-08
Kwal_33.129883033221275e-08
CAGL0K12210g3113021276e-08
Scas_558.22892001276e-08
KLLA0C11363g5173221278e-08
Sklu_2260.53022861268e-08
YOR130C (ORT1)2922761259e-08
CAGL0K08250g2972011251e-07
KLLA0C13431g3283181251e-07
Sklu_2194.33121911251e-07
Scas_582.73291631251e-07
Scas_715.453051791213e-07
Kwal_56.230113032991214e-07
Kwal_23.43543433281214e-07
CAGL0L05742g3051631204e-07
Sklu_2435.23443161188e-07
AFR131C3443531188e-07
Scas_697.473283071189e-07
Kwal_34.159073122821171e-06
Scas_578.3*5242131181e-06
KLLA0E08877g2941941161e-06
Kwal_23.29133203101161e-06
Kwal_23.57573071901152e-06
YMR241W (YHM2)3143001152e-06
AER366W2932871152e-06
YER053C3002861143e-06
CAGL0K07436g3072801143e-06
AFR253W3443211134e-06
Sklu_1926.23052951124e-06
CAGL0K10362g3013011125e-06
YHR002W (LEU5)3571281108e-06
Kwal_0.2322742111099e-06
CAGL0C02013g3293011091e-05
KLLA0E02750g3042971081e-05
KLLA0E15532g3261941081e-05
YNL003C (PET8)2842891072e-05
Kwal_33.155973053201062e-05
Sklu_1119.13073211053e-05
Kwal_55.211063283061045e-05
AGL065C3351501045e-05
AER419W4932091046e-05
Scas_714.183053071019e-05
Kwal_27.114192981921011e-04
Kwal_55.213383232841011e-04
Sklu_2442.82751851011e-04
ADL264C3292971011e-04
CAGL0H10538g2972091001e-04
Scas_696.93122701001e-04
AFR542W310141992e-04
Sklu_2115.4299206992e-04
Scas_613.24177182962e-04
Scas_705.9323304983e-04
AAL014C271289973e-04
KLLA0D04950g274215955e-04
Sklu_2127.4323272965e-04
Scas_717.20356129956e-04
Scas_673.17314307947e-04
KLLA0B14454g305299947e-04
CAGL0K02915g342111948e-04
KLLA0B11319g355186940.001
YJR077C (MIR1)311174930.001
AGL064W296278930.001
Scas_671.1*12375870.002
CAGL0F00231g307301910.002
Kwal_26.7972358154900.003
YDL119C30778890.004
CAGL0D04774g322303880.005
KLLA0E18788g38193870.007
YPR128C (ANT1)328287840.014
Scas_198.17233760.019
KLLA0D04312g10382780.019
CAGL0K06545g51294770.12
Scas_720.941683124672.4
ADR036C34028662.5
KLLA0A01342g78121653.5
YDR470C (UGO1)502112653.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K11616g
         (315 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...   648   0.0  
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...   550   0.0  
Scas_721.129                                                          540   0.0  
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                        514   0.0  
Kwal_26.7653                                                          510   0.0  
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...   490   e-176
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...   271   6e-90
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement      122   1e-32
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...   108   2e-27
Scas_702.10                                                           104   7e-26
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...   100   4e-24
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          99   1e-23
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    95   3e-22
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    95   3e-22
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          94   6e-21
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    93   9e-21
Scas_709.9                                                             92   1e-20
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    90   2e-20
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    92   2e-20
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    90   2e-20
Kwal_47.17321                                                          92   2e-20
Scas_602.8                                                             92   2e-20
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            90   3e-20
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    89   3e-20
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    88   1e-19
Scas_640.25                                                            87   1e-19
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    89   2e-19
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    87   2e-19
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    86   7e-19
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    85   1e-18
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    85   1e-18
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    86   2e-18
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    84   3e-18
Kwal_26.8669                                                           84   3e-18
Kwal_23.3965                                                           83   4e-18
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    84   4e-18
Scas_721.27                                                            84   5e-18
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    82   1e-17
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    82   1e-17
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    82   2e-17
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    81   3e-17
Kwal_55.20868                                                          82   3e-17
Scas_667.4                                                             80   3e-17
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         81   4e-17
Kwal_14.2210                                                           80   4e-17
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    80   4e-17
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    80   6e-17
Scas_489.4                                                             80   7e-17
Kwal_27.12481                                                          80   7e-17
Scas_718.24                                                            80   8e-17
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    80   1e-16
Kwal_23.4731                                                           79   2e-16
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    79   2e-16
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    77   5e-16
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    78   5e-16
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    77   7e-16
Scas_589.10                                                            77   7e-16
Scas_691.4                                                             77   8e-16
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    77   9e-16
Scas_716.29                                                            77   1e-15
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    76   1e-15
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         76   1e-15
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    76   2e-15
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    75   3e-15
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    74   1e-14
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    74   1e-14
Scas_669.6                                                             74   2e-14
Kwal_26.7967                                                           73   2e-14
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    73   3e-14
Kwal_27.12081                                                          73   3e-14
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    72   4e-14
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    72   4e-14
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    72   5e-14
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    71   8e-14
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    70   2e-13
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    69   2e-13
KLLA0D14036g complement(1203522..1204817) some similarities with...    69   8e-13
Kwal_55.21335                                                          67   2e-12
Scas_667.22                                                            67   2e-12
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    67   3e-12
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         66   4e-12
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    65   9e-12
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    65   1e-11
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         65   1e-11
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                65   2e-11
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    62   2e-11
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    64   2e-11
Kwal_33.15446                                                          64   2e-11
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    63   4e-11
Kwal_47.18216                                                          63   5e-11
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    62   9e-11
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    62   9e-11
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    62   1e-10
Kwal_27.11626                                                          62   1e-10
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    62   2e-10
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    60   2e-10
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    60   3e-10
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    60   4e-10
Scas_562.12                                                            60   4e-10
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    60   4e-10
Scas_328.1                                                             59   5e-10
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    59   6e-10
Scas_632.9                                                             59   8e-10
Kwal_27.12599                                                          59   9e-10
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    59   1e-09
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    59   1e-09
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    58   2e-09
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            58   2e-09
Sklu_1275.1 , Contig c1275 314-1249                                    58   2e-09
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    58   2e-09
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       58   3e-09
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    58   3e-09
Scas_662.12                                                            57   3e-09
Scas_379.2                                                             57   3e-09
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    57   3e-09
Kwal_23.3042                                                           58   3e-09
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    57   4e-09
Kwal_33.14050                                                          57   6e-09
Kwal_47.19228                                                          56   8e-09
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       57   8e-09
Scas_687.15*                                                           56   9e-09
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    56   9e-09
Sklu_2398.4 , Contig c2398 9476-10405                                  56   9e-09
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    57   9e-09
Kwal_23.3529                                                           56   1e-08
Scas_718.5                                                             55   1e-08
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    55   2e-08
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    55   2e-08
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    55   2e-08
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    55   3e-08
Scas_645.9                                                             55   3e-08
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    54   3e-08
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    54   3e-08
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    54   4e-08
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    54   4e-08
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    54   4e-08
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    54   5e-08
Kwal_33.12988                                                          54   5e-08
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    54   6e-08
Scas_558.2                                                             54   6e-08
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    54   8e-08
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         53   8e-08
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    53   9e-08
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    53   1e-07
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    53   1e-07
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            53   1e-07
Scas_582.7                                                             53   1e-07
Scas_715.45                                                            51   3e-07
Kwal_56.23011                                                          51   4e-07
Kwal_23.4354                                                           51   4e-07
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    51   4e-07
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         50   8e-07
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    50   8e-07
Scas_697.47                                                            50   9e-07
Kwal_34.15907                                                          50   1e-06
Scas_578.3*                                                            50   1e-06
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    49   1e-06
Kwal_23.2913                                                           49   1e-06
Kwal_23.5757                                                           49   2e-06
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    49   2e-06
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    49   2e-06
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    49   3e-06
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    49   3e-06
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    48   4e-06
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          48   4e-06
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    48   5e-06
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    47   8e-06
Kwal_0.232                                                             47   9e-06
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    47   1e-05
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    46   1e-05
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    46   1e-05
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    46   2e-05
Kwal_33.15597                                                          45   2e-05
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             45   3e-05
Kwal_55.21106                                                          45   5e-05
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    45   5e-05
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    45   6e-05
Scas_714.18                                                            44   9e-05
Kwal_27.11419                                                          44   1e-04
Kwal_55.21338                                                          44   1e-04
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          44   1e-04
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    44   1e-04
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    43   1e-04
Scas_696.9                                                             43   1e-04
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    43   2e-04
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            43   2e-04
Scas_613.24                                                            42   2e-04
Scas_705.9                                                             42   3e-04
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    42   3e-04
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    41   5e-04
Sklu_2127.4 , Contig c2127 6322-7293                                   42   5e-04
Scas_717.20                                                            41   6e-04
Scas_673.17                                                            41   7e-04
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    41   7e-04
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    41   8e-04
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    41   0.001
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    40   0.001
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    40   0.001
Scas_671.1*                                                            38   0.002
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    40   0.002
Kwal_26.7972                                                           39   0.003
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    39   0.004
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    39   0.005
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    38   0.007
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    37   0.014
Scas_198.1                                                             34   0.019
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    35   0.019
CAGL0K06545g complement(641129..642667) similar to tr|Q03327 Sac...    34   0.12 
Scas_720.94                                                            30   2.4  
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    30   2.5  
KLLA0A01342g complement(120385..122730) some similarities with s...    30   3.5  
YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein ...    30   3.5  

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/315 (100%), Positives = 315/315 (100%)

Query: 1   MAKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIY 60
           MAKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIY
Sbjct: 1   MAKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIY 60

Query: 61  TNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHK 120
           TNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHK
Sbjct: 61  TNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHK 120

Query: 121 VQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMT 180
           VQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMT
Sbjct: 121 VQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMT 180

Query: 181 EGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVA 240
           EGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVA
Sbjct: 181 EGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVA 240

Query: 241 VVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLT 300
           VVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLT
Sbjct: 241 VVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLT 300

Query: 301 FLEQTMKLVHAFESK 315
           FLEQTMKLVHAFESK
Sbjct: 301 FLEQTMKLVHAFESK 315

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/314 (81%), Positives = 291/314 (92%)

Query: 2   AKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYT 61
           +K + +I+K+AAQK+SKFGSF AGGLAACIAVTVTNPIE++KIRMQLQGE+ A+  ++Y 
Sbjct: 6   SKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYK 65

Query: 62  NPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKV 121
           NP Q M V+F+NEGI+GLQKGL AAYIYQI LNGSRLGFYEPIR+ +N+ F+PDQE HKV
Sbjct: 66  NPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKV 125

Query: 122 QSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTE 181
           QSVG+NVF+GAASGIIGAV+GSPLFLVKTRLQSYS  IKIGEQTHYTGVWNGL TI+ TE
Sbjct: 126 QSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTE 185

Query: 182 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAV 241
           GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKN L++ND+M+DGP+LHLTASTISGLGVAV
Sbjct: 186 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAV 245

Query: 242 VMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTF 301
           VMNPWDVILTRIYNQKGDLYKGPIDCLVKTV+IEG+TALYKGF AQVFRI PHTI+CLTF
Sbjct: 246 VMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTF 305

Query: 302 LEQTMKLVHAFESK 315
           +EQTMKLV++ ES+
Sbjct: 306 MEQTMKLVYSIESR 319

>Scas_721.129
          Length = 323

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/311 (81%), Positives = 283/311 (90%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
           + +I+K+AAQKVSKFGSF AGG+AACIAVT TNPIE+VKIRMQLQGEL A  Q++Y NP 
Sbjct: 8   KKEIEKTAAQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPI 67

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSV 124
           Q MGV+FRNEGIRGLQKGLVAAYIYQI LNGSRLGFYEPIR  +N TFYP++ESHK+Q V
Sbjct: 68  QGMGVIFRNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKV 127

Query: 125 GINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK 184
            INV AGA+SGIIGAV+GSPLFLVKTR+QSYS+AIKIGEQTHY  VWNGL TI  TEG K
Sbjct: 128 SINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFK 187

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMN 244
           GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLL+ND+M+DGP LHLTASTISGLGVAVVMN
Sbjct: 188 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLGVAVVMN 247

Query: 245 PWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQ 304
           PWDVILTRIYNQKG+LYKGP+DC VKTV+ EGI+ALYKGF+AQ+ RI PHTI+CLTF+EQ
Sbjct: 248 PWDVILTRIYNQKGNLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTIICLTFMEQ 307

Query: 305 TMKLVHAFESK 315
           TMKLV++ ESK
Sbjct: 308 TMKLVYSVESK 318

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 236/307 (76%), Positives = 277/307 (90%)

Query: 9   QKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMG 68
           +KSAAQKVSK GSF AGGLAACIAVTVTNP E+VK RMQLQGE+ A NQRIY NPFQA+G
Sbjct: 14  EKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALG 73

Query: 69  VVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINV 128
           V+F+NEG++GLQ+GLV+AY+YQI LNGSRLGFYEPIR V+NKTF+P+ + HK+Q+V +NV
Sbjct: 74  VIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNV 133

Query: 129 FAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFR 188
            AGA SGIIGA++GSPLFLVKTR+QSYSNAIKIGEQTHYT + NGL TI+  EGV GLFR
Sbjct: 134 TAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFR 193

Query: 189 GIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDV 248
           G+DAAILRTGAGSSVQLPIYNT KNFLL+NDIM++G +LHL +ST++GLGV +VMNPWDV
Sbjct: 194 GVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVTGLGVGIVMNPWDV 253

Query: 249 ILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKL 308
           +LTR+YNQKG+ YKGPIDC+ KT+KIEGI ALYKGF AQ+FRI PHTILCLTF+EQTMKL
Sbjct: 254 VLTRVYNQKGNTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAPHTILCLTFMEQTMKL 313

Query: 309 VHAFESK 315
           V+A ES+
Sbjct: 314 VYAVESR 320

>Kwal_26.7653
          Length = 325

 Score =  510 bits (1314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 235/306 (76%), Positives = 272/306 (88%)

Query: 10  KSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGV 69
           K AAQKVSK GSF AGG+AACIAVTVTNPIE+VK RMQLQGE+ A  QRIY NP QA+ V
Sbjct: 16  KPAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKV 75

Query: 70  VFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF 129
           +F+NEGIRGLQKGL  AYIYQI LNGSRLGFYEPIR+V+NKTFYP  + HKVQ+V +NV 
Sbjct: 76  IFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVV 135

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
           +GA SGIIGA+MGSPLFL+KTR+QSYSNAI+IG+QTHYT +WNGL +IY  EG KGL+RG
Sbjct: 136 SGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRG 195

Query: 190 IDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVI 249
           +DAAILRTGAGSSVQLPIYNTAK+FLL++D+M++G  LHL AST+SG GV VVMNPWDVI
Sbjct: 196 VDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVI 255

Query: 250 LTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309
           LTR+YNQKG+LYKGP+DC VKTV+IEGI ALYKGFEAQ+FRI PHTILCLTF+EQTMK+V
Sbjct: 256 LTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315

Query: 310 HAFESK 315
           +A E +
Sbjct: 316 YAVEKQ 321

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score =  490 bits (1261), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 223/311 (71%), Positives = 266/311 (85%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
           E   QK+AA KVSKFGSF AGGLAACIAVTVTNP + VK RMQLQGEL A   ++YTNP 
Sbjct: 7   EKHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPI 66

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSV 124
           QA GV+F+NEGI GLQKGL +AY+YQIALNGSRLGFYEPIR ++N  FYP+ ESHKVQ +
Sbjct: 67  QAFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHI 126

Query: 125 GINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK 184
           GINV AGA SG++GA +GSPLFLVKTR+QSYSNAI IG+QTHYT  +NGL TI+ +EG+K
Sbjct: 127 GINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIK 186

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMN 244
           GLFRG+DAA+LRTG GS+VQLPIYN  KNFLL++D+M DG  LHL +STI+G GV V MN
Sbjct: 187 GLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMN 246

Query: 245 PWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQ 304
           PWDV+LTR+YNQKG+LY GPIDC +KTV+ EG++ALYKGF AQ+ RIGPHT+LCLTF+EQ
Sbjct: 247 PWDVVLTRVYNQKGNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGPHTVLCLTFMEQ 306

Query: 305 TMKLVHAFESK 315
           T+KLV++ ES+
Sbjct: 307 TLKLVYSVESR 317

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score =  271 bits (692), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 153/308 (49%), Positives = 215/308 (69%), Gaps = 5/308 (1%)

Query: 8   IQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAM 67
           +  S    VSK GSF A G AAC+AVT TNPIE VK R+QLQGEL+A   R+Y+ P QA+
Sbjct: 1   MSPSTDTPVSKLGSFAAAGAAACVAVTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAV 60

Query: 68  GVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN 127
            +++R EG+RGLQ+GL  AY YQI LNGSRLG Y+P+RA +      D+ ++   ++ +N
Sbjct: 61  SLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYGTAALAVN 120

Query: 128 VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF 187
             AGAA+G+IGA +GSPL LVKTR+Q+ +   ++       G    L  ++   GV+GL+
Sbjct: 121 ATAGAAAGMIGAALGSPLQLVKTRMQALAPR-RVPPLPGRMG--RRLVALFKDRGVRGLY 177

Query: 188 RGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWD 247
           +G+DAA+LRTG GS+VQL +Y+ AK  L R+  + DG +L+  AS +S + V + MNP+D
Sbjct: 178 QGVDAALLRTGVGSAVQLAVYSHAKEALSRH--VPDGMALYTLASALSSVAVCIAMNPFD 235

Query: 248 VILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMK 307
           V +TR+Y+ +G LY+GP+DCL KTV+ EG +ALYKG  AQ+ RI PHTILCLT +EQ ++
Sbjct: 236 VAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALR 295

Query: 308 LVHAFESK 315
           +V   E++
Sbjct: 296 VVRLVENR 303

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score =  122 bits (306), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 87/291 (29%), Positives = 150/291 (51%), Gaps = 23/291 (7%)

Query: 19  FGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRG 78
           +G F  GG+ AC+A   T+P+++ K+R+Q          R+ +        + RNEG+ G
Sbjct: 14  YGGF--GGIVACVA---THPLDLAKVRLQTAPAPKPTLVRMASQ-------ILRNEGVPG 61

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQE-SHKVQSVGINVFAGAASGII 137
           L  GL AA + Q     +R G Y+ ++    + + P +  +  +  +  ++F+GA  G+I
Sbjct: 62  LYSGLTAAILRQCTYTTARFGVYDFVK----ERYIPKEYLNSMLYLLPCSMFSGAVGGLI 117

Query: 138 GAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
           G    +P  +V  R+Q+ S ++    + +Y    +GL  I   EGV  LF G    ++R 
Sbjct: 118 G----NPADVVNIRMQNDS-SLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRG 172

Query: 198 GAGSSVQLPIYNTAKNFLLRN-DIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQ 256
              +S Q+  Y+ AKN+L++N  + +D  S H  +S ++GL    V +P DVI TR+ N 
Sbjct: 173 ILMTSSQVVTYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKTRVMNA 232

Query: 257 KGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMK 307
               +   +  L+  VK EG + +++G+     R+GP+TIL    +EQ  K
Sbjct: 233 HKHSHDSAVRILLDAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVEQLRK 283

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score =  108 bits (270), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 89/301 (29%), Positives = 152/301 (50%), Gaps = 21/301 (6%)

Query: 10  KSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGV 69
           K +A K  K+  +  GG A   A  VT+P+++ K+R+Q       A        F+ +  
Sbjct: 6   KESAGKNIKY-PWWYGGAAGIFATMVTHPLDLAKVRLQ-------AAPMPKPTLFRMLES 57

Query: 70  VFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYP-DQESHKVQSVGINV 128
           +  NEG+ GL  GL AA + Q      R G Y+    ++ +   P +Q ++    +  ++
Sbjct: 58  ILANEGVVGLYSGLSAAVLRQCTYTTVRFGAYD----LLKENVIPREQLTNMAYLLPCSM 113

Query: 129 FAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEG-VKGLF 187
           F+GA    IG + G+   +V  R+Q+ S A++  ++ +Y    +G+  IY  EG +K LF
Sbjct: 114 FSGA----IGGLAGNFADVVNIRMQNDS-ALEAAKRRNYKNAIDGVYKIYRYEGGLKTLF 168

Query: 188 RGIDAAILRTGAGSSVQLPIYNTAKNFLL-RNDIMEDGPSLHLTASTISGLGVAVVMNPW 246
            G    ++R    ++ Q+  Y+  KN+L+ + D        HLTAS ++GL    V +P 
Sbjct: 169 TGWKPNMVRGILMTASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPA 228

Query: 247 DVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTM 306
           DV+ TRI N  GD ++  +  L   V+ EG + +++G+     R+GP T+L    +EQ  
Sbjct: 229 DVMKTRIMNGSGD-HQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLK 287

Query: 307 K 307
           K
Sbjct: 288 K 288

>Scas_702.10
          Length = 302

 Score =  104 bits (260), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 137/286 (47%), Gaps = 19/286 (6%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLV 84
           GG A   A  +T+P+++ K+R+Q          R+ T        + RNE + GL  GL 
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTT-------ILRNENVMGLYSGLS 68

Query: 85  AAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQE-SHKVQSVGINVFAGAASGIIGAVMGS 143
           AA + Q      R G Y+    +M +   P    +  V  +  ++F+GA  G++G     
Sbjct: 69  AAVLRQCTYTTVRFGAYD----LMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGNFAD- 123

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEG-VKGLFRGIDAAILRTGAGSS 202
              +V  R+Q+ S A+K   + +Y    +G+  IYM EG +K L  G    ++R    ++
Sbjct: 124 ---VVNIRMQNDS-ALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTA 179

Query: 203 VQLPIYNTAKNFLLRNDIMEDGP-SLHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLY 261
            Q+  Y+  KN+L+     +    S HL+AS ++GL    + +P DVI TRI N      
Sbjct: 180 SQVVTYDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVATTICSPADVIKTRIMNAHKTES 239

Query: 262 KGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMK 307
           +  I  L   +K EG + +++G+     R+GP T+L    +EQ  K
Sbjct: 240 ESAIKILTSAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIEQLKK 285

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 99.8 bits (247), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 138/288 (47%), Gaps = 20/288 (6%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLV 84
           GG A   AV  T+P+++ K+R+Q       A         Q +  + +NEGI GL  GL 
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQ-------AAPIPKPTIVQMLRSILKNEGIVGLYAGLS 65

Query: 85  AAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSP 144
           A+ + Q     +R G Y+   A+       D+ ++    +G ++ +GA  G+ G      
Sbjct: 66  ASLLRQCTYTTARFGMYD---ALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNFAD-- 120

Query: 145 LFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF-RGIDAAILRTGAGSSV 203
             L+  R+Q+ S A+ + ++ +Y    +G+  IY  EG K LF  G    ++R    ++ 
Sbjct: 121 --LINIRMQNDS-ALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTAS 177

Query: 204 QLPIYNTAKNFLLRNDIMEDGP-SLHLTASTISGLGVAVVMNPWDVILTRIYN---QKGD 259
           Q+  Y+  KNFL+    M+    S HLT+S ++G     V +P DVI T + N   + G 
Sbjct: 178 QVVTYDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIVMNAHKKPGH 237

Query: 260 LYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMK 307
            +      L++ +  EG + +++G+     R+ P T+L    +EQ  K
Sbjct: 238 NHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAMEQLKK 285

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 98.6 bits (244), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 132/306 (43%), Gaps = 21/306 (6%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +F AGGLA  ++ TV +P E VKI +Q+Q    A NQ I      A+  V+R EG  GL 
Sbjct: 25  AFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGI----VGAVRQVYREEGTPGLF 80

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN-VFAGAASGIIGA 139
           +G     I     +  +   YE   A     F+ D    + Q      +F+GA  G    
Sbjct: 81  RGNGLNCIRIFPYSAVQFVVYE---ACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSV 137

Query: 140 VMGSPLFLVKTRLQ-SYSNAIKIGEQTHYT-----GVWNGLKTIYMTEG-VKGLFRGIDA 192
           +   PL LV+TRL    +N  K+ +   +      GVW+ L   Y  EG +KGL+RG+  
Sbjct: 138 LATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWP 197

Query: 193 AILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTR 252
             L      ++   +Y   K F+             L+   +SG     V  P+D++  R
Sbjct: 198 TSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRR 257

Query: 253 IY------NQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTM 306
                   N+ G  YK  +D L+   K EG    YKG  A +F++ P T +     E   
Sbjct: 258 FQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVC 317

Query: 307 KLVHAF 312
            L+H +
Sbjct: 318 DLMHVW 323

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 95.1 bits (235), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 83/303 (27%), Positives = 150/303 (49%), Gaps = 41/303 (13%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR----------N 73
           +G  A  +   V +P++++K+R+QL      + Q+ +  PF  +  + R          N
Sbjct: 15  SGLSAGSVTTLVVHPLDLLKVRLQLSA---TSAQKAHYGPFMVIKEIIRSSANSGRSVTN 71

Query: 74  EGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQES--------HKVQSVG 125
           E  RGL   L    I      G   G Y   + ++ K+     E+        HK+ S+ 
Sbjct: 72  ELYRGLSINLFGNAIAW----GVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSL- 126

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185
           I + AGA+SG++ A++ +P++++KTR+ S S     G Q  YT ++NG++ +  T+G +G
Sbjct: 127 IYLSAGASSGLMTAILTNPIWVIKTRIMSTSK----GAQGAYTSMYNGVQQLLRTDGFQG 182

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLT---ASTISGLGVAV- 241
           L++G+  A+     G ++   +Y+T K   LR    E+G  +HLT      I+ LG  V 
Sbjct: 183 LWKGLVPALFGVSQG-ALYFAVYDTLKQRKLRRK-RENGLDIHLTNLETIEITSLGKMVS 240

Query: 242 --VMNPWDVILTRIYNQKGDLYKGPIDCLVK-TVKIEGITALYKGFEAQVFRIGPHTILC 298
             ++ P+ ++ + + + + +  K  +  L+K  +  +G   LYKG  A + R  P T  C
Sbjct: 241 VTLVYPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPST--C 298

Query: 299 LTF 301
           +TF
Sbjct: 299 ITF 301

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 90/203 (44%), Gaps = 13/203 (6%)

Query: 14  QKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN 73
            K++     +AG  +  +   +TNPI V+K R+    +     Q  YT+ +  +  + R 
Sbjct: 121 HKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSK---GAQGAYTSMYNGVQQLLRT 177

Query: 74  EGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAA 133
           +G +GL KGLV A ++ ++        Y+ ++    K     +    +    +      +
Sbjct: 178 DGFQGLWKGLVPA-LFGVSQGALYFAVYDTLK--QRKLRRKRENGLDIHLTNLETIEITS 234

Query: 134 SG-IIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDA 192
            G ++   +  P  L+K+ LQS+    +  EQ     ++  +K I   +G  GL++G+ A
Sbjct: 235 LGKMVSVTLVYPFQLLKSNLQSF----RANEQKFR--LFPLIKLIIANDGFVGLYKGLSA 288

Query: 193 AILRTGAGSSVQLPIYNTAKNFL 215
            ++R    + +   +Y   K+ L
Sbjct: 289 NLVRAIPSTCITFCVYENLKHRL 311

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 95.1 bits (235), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 95/312 (30%), Positives = 137/312 (43%), Gaps = 44/312 (14%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +F AGG+A  I+ TV +P E VKI +Q+Q    A N+ +    F A+G V++ E I+GL 
Sbjct: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGL----FDAIGQVYKEENIKGLF 81

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVM-----NKTFYPDQESHKVQ-SVGINVFAGAAS 134
           +G          LN  R+  Y  ++ V+        F+ D +    Q +    +F+GA  
Sbjct: 82  RG--------NGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALC 133

Query: 135 GIIGAVMGSPLFLVKTRLQ---------SYSNAIKIGEQTHYTGVWNGLKTIYMTE-GVK 184
           G    V   PL LV+TRL          S S A  I +     GVW  L   Y  E G+ 
Sbjct: 134 GGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP---PGVWKLLSKAYAEEGGIM 190

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLR----NDIMEDGPSLH-LTASTISGLGV 239
           GL+RG+    L      ++   +Y   K F+      N  M D  SL+ L+   ISG   
Sbjct: 191 GLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRD--SLYKLSMGAISGGVA 248

Query: 240 AVVMNPWDVILTRIY------NQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
             +  P+D++  R        N+ G  Y    D LV   K EG    YKG  A +F++ P
Sbjct: 249 QTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVP 308

Query: 294 HTILCLTFLEQT 305
            T +     E T
Sbjct: 309 STAVSWLVYELT 320

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 95/221 (42%), Gaps = 22/221 (9%)

Query: 10  KSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQ----GELMAANQRIYTNP-- 63
           K   ++++ +    +G L    +V  T P+++V+ R+ +Q     +L  +       P  
Sbjct: 115 KGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPG 174

Query: 64  -FQAMGVVFRNEG-IRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQES--H 119
            ++ +   +  EG I GL +G+    +  +         YE +     K F P  E+   
Sbjct: 175 VWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQL-----KEFMPSDENGNS 229

Query: 120 KVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQT---HYTGVWNGLKT 176
            ++     +  GA SG +   +  P  L++ R Q     + +G      HY  VW+ L T
Sbjct: 230 SMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQ----VLAMGGNELGFHYNSVWDALVT 285

Query: 177 IYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLR 217
           I  TEG KG ++G+ A + +    ++V   +Y    +++ R
Sbjct: 286 IGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWDYMKR 326

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 93.6 bits (231), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 83/291 (28%), Positives = 124/291 (42%), Gaps = 42/291 (14%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +FT G +A CI  TV  PI++VK RMQ Q          Y N       +F  EGIRG+ 
Sbjct: 521 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQ-----YKNSIDCFAKIFSREGIRGIY 575

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140
            GL    I        +L   + +R  +        + H        + +GA +G    V
Sbjct: 576 SGLGPQLIGVAPEKAIKLTVNDYMRGRL-------MDKHANLKWYFEILSGACAGACQVV 628

Query: 141 MGSPLFLVKTRLQ---SYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
             +PL +VK RLQ    Y+  + +  Q    GV   L       G+KGL++GI A ++R 
Sbjct: 629 FTNPLEVVKIRLQVRSEYAGDV-LKSQVTALGVIKQL-------GIKGLYKGIAACLMRD 680

Query: 198 GAGSSVQLPIYNTAKNFLLRNDIMEDGPSLH-----------LTASTISGLGVAVVMNPW 246
              S++  P Y       L+ D+ +  P              L A  ++G+  A +  P+
Sbjct: 681 VPFSAIYFPTYAH-----LKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPF 735

Query: 247 DVILTR--IYNQKGDL-YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPH 294
           DVI TR  I  +KG+  Y+G        +K E   + +KG  A+V R  P 
Sbjct: 736 DVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQ 786

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 91/194 (46%), Gaps = 16/194 (8%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G  A    V  TNP+EVVKIR+Q++ E       +  +   A+GV+ +  GI+GL KG+
Sbjct: 618 SGACAGACQVVFTNPLEVVKIRLQVRSEYAGD---VLKSQVTALGVI-KQLGIKGLYKGI 673

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF----AGAASGIIGA 139
            A  +  +  +      Y P  A + K  +      K Q   +  +    AG  +G+  A
Sbjct: 674 AACLMRDVPFSA----IYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAA 729

Query: 140 VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199
            + +P  ++KTRLQ      + GE T Y G+++  +TI   E  K  F+G  A +LR+  
Sbjct: 730 YLTTPFDVIKTRLQI---DPRKGE-TRYEGIFHAARTILKEESFKSFFKGGSARVLRSSP 785

Query: 200 GSSVQLPIYNTAKN 213
                L  Y   +N
Sbjct: 786 QFGFTLAAYEIFQN 799

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 96/219 (43%), Gaps = 19/219 (8%)

Query: 104 IRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGE 163
           +R +  +++Y +   + +     N   G+ +G IGA +  P+ LVKTR+Q+  +      
Sbjct: 498 LRLIHGESWYSNFYFYPIFDSIYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSF----- 552

Query: 164 QTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMED 223
            + Y    +    I+  EG++G++ G+   ++      +++L +     N  +R  +M+ 
Sbjct: 553 -SQYKNSIDCFAKIFSREGIRGIYSGLGPQLIGVAPEKAIKLTV-----NDYMRGRLMDK 606

Query: 224 GPSLHLTASTISGLGV----AVVMNPWDVILTRIYNQK---GDLYKGPIDCLVKTVKIEG 276
             +L      +SG        V  NP +V+  R+  +    GD+ K  +  L   +K  G
Sbjct: 607 HANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTAL-GVIKQLG 665

Query: 277 ITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFESK 315
           I  LYKG  A + R  P + +         K V  ++ K
Sbjct: 666 IKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPK 704

 Score = 35.4 bits (80), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 3/77 (3%)

Query: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQ 65
           D   K    K+  +    AGGLA   A  +T P +V+K R+Q+        +  Y   F 
Sbjct: 702 DPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPR---KGETRYEGIFH 758

Query: 66  AMGVVFRNEGIRGLQKG 82
           A   + + E  +   KG
Sbjct: 759 AARTILKEESFKSFFKG 775

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 93.2 bits (230), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 124/282 (43%), Gaps = 26/282 (9%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +FT G +A CI   V  PI++VK RMQ Q +        Y N    +  +   EG+RGL 
Sbjct: 527 NFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSK-----YKNSIDCLLKILSKEGVRGLY 581

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140
            GL    I        +L   + +RA +              S+   + +GA +G    V
Sbjct: 582 SGLGPQLIGVAPEKAIKLTVNDHMRATL-------AGRDGKLSLPCEIISGATAGACQVV 634

Query: 141 MGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAG 200
             +PL +VK RLQ  S+ +    +     +     ++    G+ GL+RG  A +LR    
Sbjct: 635 FTNPLEIVKIRLQVKSDYVADAARNSVNAI-----SVIKNLGLIGLYRGAGACLLRDIPF 689

Query: 201 SSVQLPIYNTAKNFLLRNDIMEDGPSLHLT------ASTISGLGVAVVMNPWDVILTR-- 252
           S++  P Y   K+ +   D  +      L       +  ++G+  A +  P+DVI TR  
Sbjct: 690 SAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQ 749

Query: 253 IYNQKGD-LYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
           I  +KG+ +Y G  D     +K EGI + +KG  A+V R  P
Sbjct: 750 IDPKKGESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSP 791

 Score = 79.3 bits (194), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 94/193 (48%), Gaps = 10/193 (5%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G  A    V  TNP+E+VKIR+Q++ + +A   R   N   A+ V+ +N G+ GL +G 
Sbjct: 624 SGATAGACQVVFTNPLEIVKIRLQVKSDYVADAAR---NSVNAISVI-KNLGLIGLYRGA 679

Query: 84  VAAYIYQIALNGSRLGFYEPIRA-VMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMG 142
            A  +  I  +      Y  I++ V N       + +K+ +  + V +G  +G+  A + 
Sbjct: 680 GACLLRDIPFSAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLV-SGGLAGMPAAFLT 738

Query: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           +P  ++KTRLQ      K GE   Y G+W+  +TI   EG+K  F+G  A +LR+     
Sbjct: 739 TPFDVIKTRLQI---DPKKGESV-YNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFG 794

Query: 203 VQLPIYNTAKNFL 215
             L  Y    N  
Sbjct: 795 FTLAAYEIFHNLF 807

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 228 HLTASTISGLGVAVVMNPWDVILTRIYNQKG-DLYKGPIDCLVKTVKIEGITALYKGFEA 286
           + T  +++G   A+V+ P D++ TR+  Q+    YK  IDCL+K +  EG+  LY G   
Sbjct: 527 NFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGP 586

Query: 287 QVFRIGPHTILCLT 300
           Q+  + P   + LT
Sbjct: 587 QLIGVAPEKAIKLT 600

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 48/115 (41%), Gaps = 3/115 (2%)

Query: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQ 65
           D        K++ +    +GGLA   A  +T P +V+K R+Q+  +     + +Y   + 
Sbjct: 708 DPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPK---KGESVYNGIWD 764

Query: 66  AMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHK 120
           A   + + EGI+   KG  A  +      G  L  YE    +     Y D  +H+
Sbjct: 765 AARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNLFPAPRYDDSTTHR 819

>Scas_709.9
          Length = 365

 Score = 91.7 bits (226), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 134/298 (44%), Gaps = 36/298 (12%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G LA  ++  +  P++V K R+Q QG + +     Y      M  +  +EG+RGL KGL
Sbjct: 70  SGALAGFLSGIIVCPLDVTKTRLQAQG-IQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYP------DQESHKVQSVGINVFAGAASGII 137
           +   +            YE       K  YP      D  SH   ++     AGAAS   
Sbjct: 129 IPIILGYFPTWMIYFSVYE-----FAKDLYPRVLPNSDFISHSCSAIT----AGAAS--- 176

Query: 138 GAVMGSPLFLVKTRLQSYSNAIKIGE-QTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILR 196
             V+ +P+++VKTRL   +    +GE +THY G  +  K I   EGV+ L+ G+  ++  
Sbjct: 177 -TVLTNPIWVVKTRLMLQT---PLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFG 232

Query: 197 TGAGSSVQLPIYNTAKNFLLRNDIM----EDGPSLHLT----ASTISGLGVAVVMNPWDV 248
                ++  P+Y   KN L  + I         SLHLT    AS+ S +  +++  P ++
Sbjct: 233 L-LHVAIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEI 291

Query: 249 ILTRIYNQKGDLYKGP---IDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLE 303
           + TR+  +   L       +D + +T + EG+   Y GF   + R  P + + L   E
Sbjct: 292 LRTRMQLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFE 349

 Score = 72.8 bits (177), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 96/210 (45%), Gaps = 15/210 (7%)

Query: 85  AAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSP 144
           A+++YQ  L    L  +EP + + +      Q    +    I   +GA +G +  ++  P
Sbjct: 32  ASHLYQNML----LQSHEPEKHIASTVI---QSKLHLSDPKITALSGALAGFLSGIIVCP 84

Query: 145 LFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQ 204
           L + KTRLQ+    I+  E  +Y GV   + TI + EGV+GL++G+   IL       + 
Sbjct: 85  LDVTKTRLQA--QGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGLIPIILGYFPTWMIY 142

Query: 205 LPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQ-----KGD 259
             +Y  AK+   R     D  S H  ++  +G    V+ NP  V+ TR+  Q        
Sbjct: 143 FSVYEFAKDLYPRVLPNSDFIS-HSCSAITAGAASTVLTNPIWVVKTRLMLQTPLGESRT 201

Query: 260 LYKGPIDCLVKTVKIEGITALYKGFEAQVF 289
            Y+G ID   K +  EG+  LY G    +F
Sbjct: 202 HYRGTIDAFKKIITQEGVRTLYTGLVPSMF 231

 Score = 70.5 bits (171), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 105/216 (48%), Gaps = 15/216 (6%)

Query: 17  SKFGSFTAGGLAACIAVTV-TNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEG 75
           S F S +   + A  A TV TNPI VVK R+ LQ  L   ++  Y     A   +   EG
Sbjct: 160 SDFISHSCSAITAGAASTVLTNPIWVVKTRLMLQTPL-GESRTHYRGTIDAFKKIITQEG 218

Query: 76  IRGLQKGLVAAY--IYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN--VFAG 131
           +R L  GLV +   +  +A++      YE ++  ++        + +  S+ +   + A 
Sbjct: 219 VRTLYTGLVPSMFGLLHVAIH---FPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIAS 275

Query: 132 AASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGID 191
           +AS ++ +++  P  +++TR+Q  S+ + I +      + + +K  Y  EG+ G + G  
Sbjct: 276 SASKMLASILTYPHEILRTRMQLKSDKLLISKHK----LLDLIKRTYRYEGLLGFYSGFA 331

Query: 192 AAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSL 227
             +LRT   S++ L  +   +N LL+  I +D PSL
Sbjct: 332 TNLLRTVPASAITLVSFEYFRNALLK--INQDHPSL 365

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 131/294 (44%), Gaps = 28/294 (9%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +F AGG+A  ++ TV +P E VKI +Q+Q    + N+ I+++  Q    V+  EG +GL 
Sbjct: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQ----VYHEEGTKGLF 80

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN-VFAGAASGIIGA 139
           +G     I     +  +   YE   A   K F+ +  + + Q      +F+GA  G    
Sbjct: 81  RGNGLNCIRIFPYSAVQFVVYE---ACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137

Query: 140 VMGSPLFLVKTRLQ------SYSNAIKIGEQTHYTGVWNGLKTIYMTE-GVKGLFRGIDA 192
           V   PL L+KTRL       S  N  K    +   G+W  L   Y  E G++GL+RG+  
Sbjct: 138 VATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWP 197

Query: 193 AILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSL-----HLTASTISGLGVAVVMNPWD 247
             L      ++   +Y   + F + +   +  PS       LT   ISG     +  P+D
Sbjct: 198 TSLGVVPYVALNFAVYEQLREFGVNSS--DAQPSWKSNLYKLTIGAISGGVAQTITYPFD 255

Query: 248 VILTRIY------NQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHT 295
           ++  R        N+ G  Y    D LV   + EG++  YKG  A +F++ P T
Sbjct: 256 LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPST 309

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 82/201 (40%), Gaps = 23/201 (11%)

Query: 122 QSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTE 181
           Q   I   AG  +G +   + SP   VK  LQ     ++    ++  G+++ ++ +Y  E
Sbjct: 20  QDSNIAFLAGGVAGAVSRTVVSPFERVKILLQ-----VQSSTTSYNRGIFSSIRQVYHEE 74

Query: 182 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGL---G 238
           G KGLFRG     +R    S+VQ  +Y   K  L   +       L  T    SG    G
Sbjct: 75  GTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGG 134

Query: 239 VAVVMN-PWDVILTRIYNQKGDLYK-------------GPIDCLVKTVKIE-GITALYKG 283
            +VV   P D+I TR+  Q  +L               G    L +T ++E G+  LY+G
Sbjct: 135 CSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRG 194

Query: 284 FEAQVFRIGPHTILCLTFLEQ 304
                  + P+  L     EQ
Sbjct: 195 VWPTSLGVVPYVALNFAVYEQ 215

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 89/198 (44%), Gaps = 22/198 (11%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQR-----IYTNP--FQAMGVVFRNEG- 75
           +G L    +V  T P++++K R+ +Q   +++  R     I   P  +Q +   +R EG 
Sbjct: 128 SGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGG 187

Query: 76  IRGLQKGLVAAYIYQIALNGSRLGFYEPIR--AVMNKTFYPDQESHKVQSVGINVFAGAA 133
           +RGL +G+    +  +         YE +R   V +    P  +S+  +     +  GA 
Sbjct: 188 LRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYK-----LTIGAI 242

Query: 134 SGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQT---HYTGVWNGLKTIYMTEGVKGLFRGI 190
           SG +   +  P  L++ R Q     + +G       YT VW+ L TI   EGV G ++G+
Sbjct: 243 SGGVAQTITYPFDLLRRRFQ----VLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298

Query: 191 DAAILRTGAGSSVQLPIY 208
            A + +    ++V   +Y
Sbjct: 299 AANLFKVVPSTAVSWLVY 316

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 88/298 (29%), Positives = 129/298 (43%), Gaps = 38/298 (12%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +FT G +A CI  TV  PI++VK RMQ Q      N   Y N    +  +F+ +GIRGL 
Sbjct: 507 NFTLGSIAGCIGATVVYPIDLVKTRMQAQ-----RNSVQYKNSIDCVVKIFQTKGIRGLY 561

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRA-VMNKTFYPDQESHKVQSVGINVFAGAASGIIGA 139
            GL    I        +L   + +R   MNK+        +       + +GA +G    
Sbjct: 562 SGLGPQLIGVAPEKAIKLTVNDFMRQYFMNKS--------RTIKWYQEILSGATAGACQV 613

Query: 140 VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199
           V  +PL +VK RLQ  S+ +    +     V      I    G++GL++G  A +LR   
Sbjct: 614 VFTNPLEIVKIRLQMRSDYVGENARPQLGAV-----GIIRQLGLRGLYKGAAACLLRDVP 668

Query: 200 GSSVQLPIYNTAKNFLLRNDIMEDGPSLH-----------LTASTISGLGVAVVMNPWDV 248
            S++  P Y       L+ D+    P+             L A  I+G+  A +  P+DV
Sbjct: 669 FSAIYFPTYAH-----LKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDV 723

Query: 249 ILTR--IYNQKGD-LYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLE 303
           I TR  I  +KG+  Y G I      +K E I + +KG  A+V R  P     L   E
Sbjct: 724 IKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFE 781

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 226 SLH-LTASTISGLGVAVVMNPWDVILTRIYNQKGDL-YKGPIDCLVKTVKIEGITALYKG 283
           S+H  T  +I+G   A V+ P D++ TR+  Q+  + YK  IDC+VK  + +GI  LY G
Sbjct: 504 SIHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSG 563

Query: 284 FEAQVFRIGPHTILCLT 300
              Q+  + P   + LT
Sbjct: 564 LGPQLIGVAPEKAIKLT 580

 Score = 36.2 bits (82), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 3/77 (3%)

Query: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQ 65
           D   K+   K+  +    AGG+A   A  +T P +V+K R+Q+        +  YT    
Sbjct: 688 DPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPR---KGETTYTGVIH 744

Query: 66  AMGVVFRNEGIRGLQKG 82
           A   + + E I+   KG
Sbjct: 745 AARTILKEESIKSFFKG 761

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 82/321 (25%), Positives = 139/321 (43%), Gaps = 38/321 (11%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
           +D ++K   + VS + S  AG ++   A   T P++ VKIR QLQ       +  Y    
Sbjct: 7   KDHLRK--GETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQ----PVQEDKYKGIA 60

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSV 124
             +  + + EG+R L KG + A    +     + G Y     V +  F       +    
Sbjct: 61  STVRTIMKEEGLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKF------PRFSQQ 114

Query: 125 GINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK 184
           G  +  GA +G+  +V+  PL L++TRL +          +H T V    + +++ EGV+
Sbjct: 115 GQTLTVGALAGMTSSVVSYPLDLLRTRLIA-------NRTSHRTSVAEECRQMWLNEGVR 167

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTAST--ISGLGVAVV 242
           G F GI  A+      +++    Y T  N +  N   E   S  ++AS+  I+G     +
Sbjct: 168 GFFTGISTAMTTVTLSTAIMFLTYETV-NIVCENHEKEFW-SRPVSASSGIIAGFVSKTM 225

Query: 243 MNPWDVILTR--IYNQKGDL-------------YKGPIDCLVKTVKIEGITALYKGFEAQ 287
           + P D +  R  + N K  +             YK     + K ++ EG++ALY+G    
Sbjct: 226 VFPIDTLRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMG 285

Query: 288 VFRIGPHTILCLTFLEQTMKL 308
           + +  P T + L   E+TM L
Sbjct: 286 LCKSVPTTAISLFVYERTMDL 306

>Kwal_47.17321
          Length = 881

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 137/306 (44%), Gaps = 35/306 (11%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +F  G +A CI  T   PI++VK RMQ Q      N   Y N       +F  EGIRG+ 
Sbjct: 503 NFLLGSVAGCIGATAVYPIDLVKTRMQAQ-----RNFSQYKNSIDCFVKIFSREGIRGIY 557

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140
            GL    +        +L   + +R ++        + +   ++ + + +GAA+G    +
Sbjct: 558 SGLGPQLVGVAPEKAIKLTVNDYVRKLL-------MDENNRLTLPLEIISGAAAGACQVI 610

Query: 141 MGSPLFLVKTRLQ---SYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
             +PL +VK RLQ    Y++++   + T   GV   L       G++GL++G+ A ++R 
Sbjct: 611 FTNPLEIVKIRLQVRSEYADSLPKSQLTA-LGVVKSL-------GLRGLYKGLVACLMRD 662

Query: 198 GAGSSVQLPIYNTAKNFLLRNDIMEDGP--SLH----LTASTISGLGVAVVMNPWDVILT 251
              S++  P Y   K  +   D  +      LH    LTA  ++G+  A +  P+DVI T
Sbjct: 663 VPFSAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKT 722

Query: 252 R--IYNQKGDL-YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPH---TILCLTFLEQT 305
           R  I  +KG+  Y G +      +K E   + +KG  A+V R  P    T+      +  
Sbjct: 723 RLQIDPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQNM 782

Query: 306 MKLVHA 311
             L H+
Sbjct: 783 FPLQHS 788

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 16/106 (15%)

Query: 205 LPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKG-DLYKG 263
            PI+++  NFLL                +++G   A  + P D++ TR+  Q+    YK 
Sbjct: 495 FPIFDSIYNFLL---------------GSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKN 539

Query: 264 PIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309
            IDC VK    EGI  +Y G   Q+  + P   + LT  +   KL+
Sbjct: 540 SIDCFVKIFSREGIRGIYSGLGPQLVGVAPEKAIKLTVNDYVRKLL 585

 Score = 35.8 bits (81), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 56/141 (39%), Gaps = 11/141 (7%)

Query: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQ 65
           D   K+   ++  +   TAGGLA   A  +T P +V+K R+Q+        +  YT    
Sbjct: 684 DPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPR---KGETRYTGILH 740

Query: 66  AMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVG 125
           A   + + E  +   KG  A  +      G  L  YE  + +     +P Q S   +S  
Sbjct: 741 AARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQNM-----FPLQHSENNESRE 795

Query: 126 IN---VFAGAASGIIGAVMGS 143
            N   +  G  S  + ++  S
Sbjct: 796 TNDTPIVTGMFSNFLESLKKS 816

>Scas_602.8
          Length = 885

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 82/286 (28%), Positives = 127/286 (44%), Gaps = 31/286 (10%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +F+ G +A CI  T+  PI+ +K RMQ Q  L       Y N    +  +F  EGIRGL 
Sbjct: 501 NFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTK-----YKNSIDCLVKIFGKEGIRGLY 555

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140
            GL    I        +L   + +R  +      D++ +    +G  V +GA +G    V
Sbjct: 556 SGLGPQLIGVAPEKAIKLTVNDFMRKSL-----VDKKGN--LQLGAEVLSGATAGACQVV 608

Query: 141 MGSPLFLVKTRLQ---SYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
             +PL +VK RLQ    Y+NA+    Q     +   LK I       GL++G+ A +LR 
Sbjct: 609 FTNPLEIVKIRLQVKSEYTNAMIPKSQLTAFQIIKELKLI-------GLYKGVGACLLRD 661

Query: 198 GAGSSVQLPIYNTAKNFLLRNDIMEDGPSLH------LTASTISGLGVAVVMNPWDVILT 251
              S++  P Y   K  + + D  +            LTA  ++G+  A +  P+DVI T
Sbjct: 662 VPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKT 721

Query: 252 RIYNQKG---DLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPH 294
           R+  + G     Y G +  +   +K E   + +KG  A+V R  P 
Sbjct: 722 RLQIEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQ 767

 Score = 69.3 bits (168), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 92/195 (47%), Gaps = 17/195 (8%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G  A    V  TNP+E+VKIR+Q++ E    N  I  +   A  ++ +   + GL KG+
Sbjct: 598 SGATAGACQVVFTNPLEIVKIRLQVKSEY--TNAMIPKSQLTAFQII-KELKLIGLYKGV 654

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF----AGAASGIIGA 139
            A  +  +  +      Y P  A + K  +    + K +   +  +    AGA +G+  A
Sbjct: 655 GACLLRDVPFSA----IYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAA 710

Query: 140 VMGSPLFLVKTRLQSYSNAIKIGE-QTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
            + +P  ++KTRLQ     I+ G  +T YTG+ + ++TI   E  +  F+G  A ++R+ 
Sbjct: 711 FLTTPFDVIKTRLQ-----IEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVMRSS 765

Query: 199 AGSSVQLPIYNTAKN 213
                 L  Y   KN
Sbjct: 766 PQFGFTLAAYELFKN 780

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 227 LHLTASTISGLGVAVVMNPWDVILTRIYNQKG-DLYKGPIDCLVKTVKIEGITALYKGFE 285
            + +  +++G   A ++ P D I TR+  Q+    YK  IDCLVK    EGI  LY G  
Sbjct: 500 FNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLG 559

Query: 286 AQVFRIGPHTILCLT 300
            Q+  + P   + LT
Sbjct: 560 PQLIGVAPEKAIKLT 574

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 59/154 (38%), Gaps = 12/154 (7%)

Query: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQ 65
           D   K    ++  +   TAG LA   A  +T P +V+K R+Q++       +  YT    
Sbjct: 683 DPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEP---GVGETRYTGILH 739

Query: 66  AMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMN--KTFYPDQESHKVQS 123
           A+  + + E  R   KG  A  +      G  L  YE  + + N      P +     + 
Sbjct: 740 AVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFKNMFNISDDKQPTKNEKSTED 799

Query: 124 VGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSN 157
              +V  G  S    ++  +P +       SYSN
Sbjct: 800 YNDSVGTGYPSSFFSSMKYTPSY-------SYSN 826

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 90.1 bits (222), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 136/311 (43%), Gaps = 46/311 (14%)

Query: 35  VTNPIEVVKIRMQL-----------------QGELMAANQRIYTNPFQAMGVVFRNEGIR 77
           VT P +VVK R+Q                  Q  ++A   R +   F  +  V+RNEG R
Sbjct: 69  VTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFR 128

Query: 78  GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGII 137
            L KGL    +  I         Y   + + +KT    QE+     V I++ A A +G  
Sbjct: 129 SLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEA-----VWIHLMAAATAGWA 183

Query: 138 GAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
            +   +P++LVKTRLQ      K G    Y   W+ LK +   EG+ GL++G+ A+ L +
Sbjct: 184 TSTATNPIWLVKTRLQ----LDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGS 239

Query: 198 GAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTAST---------------ISGLGVAVV 242
             G  +Q  +Y   K+ + +  + + G    +  ST               ++    +++
Sbjct: 240 VEG-ILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASII 298

Query: 243 MNPWDVILTRIYN---QKGDL-YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILC 298
             P +V+ TR+     + G L Y G +  +   +K EG+ ++Y G    + R  P++I+ 
Sbjct: 299 TYPHEVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSIIM 358

Query: 299 LTFLEQTMKLV 309
               E  ++L+
Sbjct: 359 FGTWELVIRLL 369

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 72/167 (43%), Gaps = 20/167 (11%)

Query: 140 VMGSPLFLVKTRLQS-------YSNAIKIGEQT---------HYTGVWNGLKTIYMTEGV 183
           V+  P  +VKTRLQS        S+A  IG            H+   +  +  +Y  EG 
Sbjct: 68  VVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGF 127

Query: 184 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRN-DIMEDGPSLHLTASTISGLGVAVV 242
           + LF+G+   ++      S+    Y T K    +  +  ++   +HL A+  +G   +  
Sbjct: 128 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVWIHLMAAATAGWATSTA 187

Query: 243 MNPWDVILTRIYNQKG---DLYKGPIDCLVKTVKIEGITALYKGFEA 286
            NP  ++ TR+   K      YK   DCL   V+ EGI  LYKG  A
Sbjct: 188 TNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSA 234

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 89.4 bits (220), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 86/323 (26%), Positives = 137/323 (42%), Gaps = 46/323 (14%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
           ED ++K  A  VS   +  AG ++  +A +VT P++ VKIR QLQ     A++  Y    
Sbjct: 13  EDHLRKGEA--VSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQ----LASEHKYHGIL 66

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSV 124
                V R EG+R L KG V A    +     + G Y  +         P Q      S+
Sbjct: 67  HTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQ----AHSL 122

Query: 125 GINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK 184
            +    GA +G++ +++  PL L++TRL +  +A       H+  +    + I+ TEG  
Sbjct: 123 AV----GALAGLVSSLLTYPLDLLRTRLVANRSA-------HFFSLRRQARVIWDTEGPA 171

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDG---PSLHLTASTISGLGVAV 241
           G FRG   AI  T   + +   IY T         I  D    P L   AS  +GL    
Sbjct: 172 GFFRGGAWAIAATTLTTGLIFGIYETC-------TIAADTYGLPWLAAAASPTAGLVSKA 224

Query: 242 VMNPWDVILTRI----------YNQKGDLYKGP-----IDCLVKTVKIEGITALYKGFEA 286
            + P D +  R+          + +    Y        +   V  V+ EGI +LYKG   
Sbjct: 225 AVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTM 284

Query: 287 QVFRIGPHTILCLTFLEQTMKLV 309
            + +  P T++ L   ++ ++L+
Sbjct: 285 ALCKSTPTTVITLWVYQRCLRLL 307

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 87.8 bits (216), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/281 (26%), Positives = 127/281 (45%), Gaps = 13/281 (4%)

Query: 17  SKFG-SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR--- 72
           S FG  F  GG++A IA T   PIE VK+ MQ Q E++   Q      ++ +   F+   
Sbjct: 11  SHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEML--KQGSLDTRYKGILDCFKRTA 68

Query: 73  -NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAG 131
            +EGI    +G  A  +           F + I+++++   Y  +     +    N+F+G
Sbjct: 69  THEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLS---YDRERDGYAKWFAGNLFSG 125

Query: 132 AASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGID 191
            A+G +  +    L   +TRL + +   K   Q  + G+ +  K    T+G+ GL+RG  
Sbjct: 126 GAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFV 185

Query: 192 AAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILT 251
            ++L       +   +Y++ K  LL   +     +  L    I+ +G +    P D +  
Sbjct: 186 PSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVIT-MGASTASYPLDTVRR 244

Query: 252 RIYNQKGDL--YKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
           R+    G    Y G +DCL K V+ EG  +L+KG  A +FR
Sbjct: 245 RMMMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFR 285

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 83/197 (42%), Gaps = 19/197 (9%)

Query: 108 MNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGE-QTH 166
           M+ T    Q+SH     G++   G  S  I     +P+  VK  +Q+    +K G   T 
Sbjct: 1   MSHTETQTQQSH----FGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTR 56

Query: 167 YTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPS 226
           Y G+ +  K     EG+   +RG  A +LR     ++     +  K+ LL  D   DG +
Sbjct: 57  YKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKS-LLSYDRERDGYA 115

Query: 227 LHLTASTISGLGVA-----VVMNPWDVILTRIY-NQKGD------LYKGPIDCLVKTVKI 274
                +  SG G A     + +   D   TR+  + +G        + G +D   KT+K 
Sbjct: 116 KWFAGNLFSG-GAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKT 174

Query: 275 EGITALYKGFEAQVFRI 291
           +G+  LY+GF   V  I
Sbjct: 175 DGLLGLYRGFVPSVLGI 191

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 79/193 (40%), Gaps = 18/193 (9%)

Query: 20  GSFTAGGLAACIAVTVTNPIEVVKIRMQLQGE-LMAANQRIYTNPFQAMGVVFRNEGIRG 78
           G+  +GG A  +++     ++  + R+        + +QR +           + +G+ G
Sbjct: 120 GNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLG 179

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS--VGINVFAGAASGI 136
           L +G V + +  I   G   G Y+  + V+        E   V S  +G  +  GA++  
Sbjct: 180 LYRGFVPSVLGIIVYRGLYFGLYDSFKPVL---LTGALEGSFVASFLLGWVITMGASTA- 235

Query: 137 IGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILR 196
                  PL  V+ R+   S     G+   Y G  + L+ I   EG   LF+G  A I R
Sbjct: 236 -----SYPLDTVRRRMMMTS-----GQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFR 285

Query: 197 TGAGSSVQLPIYN 209
             A + V + +Y+
Sbjct: 286 GVAAAGV-ISLYD 297

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 261 YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309
           YKG +DC  +T   EGI + ++G  A V R  P   L   F ++   L+
Sbjct: 57  YKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLL 105

>Scas_640.25
          Length = 306

 Score = 87.4 bits (215), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 126/301 (41%), Gaps = 21/301 (6%)

Query: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRI--YTNPFQAMGVVFRNEGIRGL 79
           F AG +A    + V  P++VVK RMQLQ    AA      Y      +  + + EG   +
Sbjct: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76

Query: 80  QKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGA 139
            KG+ +  + +      +    +    +    F   Q + +     I+V +GA++GI  A
Sbjct: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQ-----ISVLSGASAGITEA 131

Query: 140 VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199
           ++  P  LVK RLQ  ++  K        G    LK I   +G+KGL+ G+++ + R   
Sbjct: 132 LVIVPFELVKIRLQDVNSKFK--------GPVEVLKHIIKQDGLKGLYSGVESTVWRNAV 183

Query: 200 GSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGD 259
            ++    +    +  L      ++     L A  + G    +   P+DV+ +RI +   +
Sbjct: 184 WNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNE 243

Query: 260 L------YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFE 313
           +      Y      ++K    EG  ALYKGF  +V R+GP   + L      M +   F 
Sbjct: 244 IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFH 303

Query: 314 S 314
            
Sbjct: 304 E 304

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 91/204 (44%), Gaps = 18/204 (8%)

Query: 10  KSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGV 69
           K   Q++S     +AG   A + V    P E+VKIR+Q        N + +  P + +  
Sbjct: 112 KQLTQQISVLSGASAGITEALVIV----PFELVKIRLQ------DVNSK-FKGPVEVLKH 160

Query: 70  VFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF 129
           + + +G++GL  G+ +        N    G    +R ++     P  +S K +    ++ 
Sbjct: 161 IIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELL-----PVAKS-KQEKTRNDLC 214

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
           AG   G  G +  +P  +VK+R+QS  N I I     Y   W  +  IY  EG + L++G
Sbjct: 215 AGFVGGTFGVMFNTPFDVVKSRIQSDGNEI-INGVRKYNWTWPSVMKIYHEEGFRALYKG 273

Query: 190 IDAAILRTGAGSSVQLPIYNTAKN 213
               +LR G G +V L ++    N
Sbjct: 274 FVPKVLRLGPGGAVLLVVFTNVMN 297

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 129/291 (44%), Gaps = 41/291 (14%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +F+ G +A CI  TV  PI+ +K RMQ Q  L       Y N    +  +   EGI+GL 
Sbjct: 533 NFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQ-----YKNSIDCLLKIISREGIKGLY 587

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140
            GL    I        +L   + +R  +        + +   S+   + +GA++G    +
Sbjct: 588 SGLGPQLIGVAPEKAIKLTVNDFMRNRL-------TDKNGKLSLFPEIISGASAGACQVI 640

Query: 141 MGSPLFLVKTRLQSYSNAIKIGE---QTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
             +PL +VK RLQ  S+   +GE   Q + T        I    G++GL+ G+ A ++R 
Sbjct: 641 FTNPLEIVKIRLQVQSDY--VGENIQQANETAT-----QIVKKLGLRGLYNGVAACLMRD 693

Query: 198 GAGSSVQLPIYNTAKNFLLRNDIMEDGPSLH-----------LTASTISGLGVAVVMNPW 246
              S++  P Y       L+ D+ +  P+             LTA  I+G+  A +  P+
Sbjct: 694 VPFSAIYFPTYAH-----LKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPF 748

Query: 247 DVILTR--IYNQKGDL-YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPH 294
           DVI TR  I  +KG+  Y G    +   +K E   + +KG  A+V R  P 
Sbjct: 749 DVIKTRLQIDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQ 799

 Score = 78.6 bits (192), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 97/205 (47%), Gaps = 15/205 (7%)

Query: 15  KVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNE 74
           K+S F    +G  A    V  TNP+E+VKIR+Q+Q + +  N  I      A  +V +  
Sbjct: 621 KLSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGEN--IQQANETATQIV-KKL 677

Query: 75  GIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF----A 130
           G+RGL  G+ A  +  +  +      Y P  A + K  +    + K +   +  +    A
Sbjct: 678 GLRGLYNGVAACLMRDVPFS----AIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTA 733

Query: 131 GAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGI 190
           GA +G+  A + +P  ++KTRLQ      + GE T Y G+++ ++TI   E  +  F+G 
Sbjct: 734 GAIAGMPAAFLTTPFDVIKTRLQI---DPRKGE-TKYNGIFHAIRTILKEESFRSFFKGG 789

Query: 191 DAAILRTGAGSSVQLPIYNTAKNFL 215
            A +LR+       L  Y   K F+
Sbjct: 790 GARVLRSSPQFGFTLAAYELFKGFI 814

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 82/195 (42%), Gaps = 24/195 (12%)

Query: 108 MNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHY 167
           +N  FYP      +     N   G+ +G IGA +  P+  +KTR+Q+  +         Y
Sbjct: 520 INYYFYP------IFDSLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSL------AQY 567

Query: 168 TGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSL 227
               + L  I   EG+KGL+ G+   ++      +++L +     N  +RN + +    L
Sbjct: 568 KNSIDCLLKIISREGIKGLYSGLGPQLIGVAPEKAIKLTV-----NDFMRNRLTDKNGKL 622

Query: 228 HLTASTISGLGV----AVVMNPWDVILTRIYNQK---GDLYKGPIDCLVKTVKIEGITAL 280
            L    ISG        +  NP +++  R+  Q    G+  +   +   + VK  G+  L
Sbjct: 623 SLFPEIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGL 682

Query: 281 YKGFEAQVFRIGPHT 295
           Y G  A + R  P +
Sbjct: 683 YNGVAACLMRDVPFS 697

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 45/96 (46%), Gaps = 16/96 (16%)

Query: 206 PIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKG-DLYKGP 264
           PI+++  NF L                +I+G   A V+ P D I TR+  Q+    YK  
Sbjct: 526 PIFDSLYNFSL---------------GSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNS 570

Query: 265 IDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLT 300
           IDCL+K +  EGI  LY G   Q+  + P   + LT
Sbjct: 571 IDCLLKIISREGIKGLYSGLGPQLIGVAPEKAIKLT 606

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 3/77 (3%)

Query: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQ 65
           D   K+   ++  +   TAG +A   A  +T P +V+K R+Q+        +  Y   F 
Sbjct: 715 DPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPR---KGETKYNGIFH 771

Query: 66  AMGVVFRNEGIRGLQKG 82
           A+  + + E  R   KG
Sbjct: 772 AIRTILKEESFRSFFKG 788

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 141/295 (47%), Gaps = 31/295 (10%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTN-PFQAMGVVFRNEGIRGLQKG 82
           +G LA  ++  V  P++V K R+Q QG      + +Y       M  + R+EG+RGL KG
Sbjct: 74  SGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKG 133

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINV----FAGAASGIIG 138
           LV             +G++ P   +    +   +++ +  S   +     F+   +G + 
Sbjct: 134 LVPII----------MGYF-PTWMIYFSVYEFCKDNLRTNSSNWSFVSHSFSAITAGAVS 182

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQT-HYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
            V+ +P+++VKTRL   ++   IG  T HY G ++  K I   EGVK L+ G+  ++L  
Sbjct: 183 TVVTNPIWVVKTRLMLQTH---IGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGL 239

Query: 198 GAGSSVQLPIYNTAK-NF-LLRNDIMEDGPSLHLT----ASTISGLGVAVVMNPWDVILT 251
               ++  P+Y   K +F   + D   +   ++L     AS++S +  +V+  P +++ T
Sbjct: 240 -LHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRT 298

Query: 252 RIYNQKGDL--YKGPIDCLVKTVKI-EGITALYKGFEAQVFRIGPHTILCLTFLE 303
           R+   K DL  ++  +  L+K   I EGI   Y GF   +FR  P + + L   E
Sbjct: 299 RL-QLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFE 352

 Score = 70.5 bits (171), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 99/200 (49%), Gaps = 17/200 (8%)

Query: 19  FGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRG 78
           F + TAG     ++  VTNPI VVK R+ LQ  +  +N   Y   + A   +   EG++ 
Sbjct: 173 FSAITAGA----VSTVVTNPIWVVKTRLMLQTHI-GSNTTHYQGTYDAFKKIINQEGVKA 227

Query: 79  LQKGLVAAYI--YQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQ-SVGINVFAGAASG 135
           L  GLV + +    +A++      YE ++ V  K +  D+ S++ + ++   + A + S 
Sbjct: 228 LYAGLVPSLLGLLHVAIH---FPVYERLK-VSFKCYQRDESSNESKINLKRLILASSVSK 283

Query: 136 IIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAIL 195
           ++ +V+  P  +++TRLQ     +K    +H   +   +K  Y+ EG+ G + G    + 
Sbjct: 284 MVASVLSYPHEILRTRLQ-----LKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLF 338

Query: 196 RTGAGSSVQLPIYNTAKNFL 215
           RT   S++ L  +   +NFL
Sbjct: 339 RTLPASAITLVSFEYVRNFL 358

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 76/164 (46%), Gaps = 6/164 (3%)

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185
           IN  +GA +G++  ++  PL + KTRLQ+     +  E  +Y G    + TI   EGV+G
Sbjct: 70  INAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRG 129

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNP 245
           L++G+   I+       +   +Y   K+ L  N       S   +A T +G    VV NP
Sbjct: 130 LYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHSFSAIT-AGAVSTVVTNP 188

Query: 246 WDVILTRIYNQ-----KGDLYKGPIDCLVKTVKIEGITALYKGF 284
             V+ TR+  Q         Y+G  D   K +  EG+ ALY G 
Sbjct: 189 IWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGL 232

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 85.9 bits (211), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 85/323 (26%), Positives = 142/323 (43%), Gaps = 35/323 (10%)

Query: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQG-ELMAANQRIYTNPF 64
           ++++K+A  +V+      +G L+  ++  +  P +V K R+Q QG + M    + Y   F
Sbjct: 30  NRLKKNADPRVAAI----SGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFF 85

Query: 65  QAMGVVFRNEGIRGLQKGL---VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKV 121
                +F++EG  GL KGL   V  YI  + +  S   F         + +  D   H  
Sbjct: 86  GTFATIFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDF--------CRKYSVDIFPH-- 135

Query: 122 QSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGE-QTHYTGVWNGLKTIYMT 180
                N  +   +G I  V  +P+++VKTRL   +    IG+  THY G  +  + I   
Sbjct: 136 SPFLSNASSAITAGAISTVATNPIWVVKTRLMLQTG---IGKYSTHYKGTIDTFRKIIQQ 192

Query: 181 EGVKGLFRGIDAAILRTGAGSSVQLPIYNTAK---NFLLRNDIMEDGPSLH----LTAST 233
           EG K L+ G+  A+L      ++Q P+Y   K    +    D+  D  S +    + AS 
Sbjct: 193 EGAKALYAGLVPALLGM-LNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASM 251

Query: 234 ISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKI----EGITALYKGFEAQVF 289
           +S +  + V  P +++ TR+   K DL       L+  +KI    EG    Y GF   + 
Sbjct: 252 LSKMVASTVTYPHEILRTRM-QLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLV 310

Query: 290 RIGPHTILCLTFLEQTMKLVHAF 312
           R  P  ++ L   E + K +  F
Sbjct: 311 RTVPAAVVTLVSFEYSKKYLTTF 333

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/297 (26%), Positives = 120/297 (40%), Gaps = 21/297 (7%)

Query: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQ--------GELMAANQRIYTNPFQAMGVVFRN 73
           FTAG +A    + V  P++VVK RMQLQ             A    YT     +  + + 
Sbjct: 15  FTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKK 74

Query: 74  EGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAA 133
           EG   L KG+ +  + +      +    +  +    K F P       Q + I  ++GA+
Sbjct: 75  EGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIF-PTPNGEMTQKIAI--YSGAS 131

Query: 134 SGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAA 193
           +G + A + +P  LVK RLQ  ++  K   +     V  G        GV  LF G++A 
Sbjct: 132 AGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKG--------GVLSLFNGLEAT 183

Query: 194 ILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRI 253
           I R    ++    I    +  L       +     L A  I G    ++  P+DV+ +RI
Sbjct: 184 IWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRI 243

Query: 254 YNQKGDL--YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKL 308
               G L  Y   +  ++   + EG  ALYKGF  +V R+ P   L L      M  
Sbjct: 244 QRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDF 300

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 84.7 bits (208), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 123/275 (44%), Gaps = 11/275 (4%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELM---AANQRIYTNPFQAMGVVFRNEGIR 77
            F  GG++A +A T  +PIE VK+ +Q Q E++   + + R Y           R EGI 
Sbjct: 14  DFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHR-YKGIVDCFQRTARQEGII 72

Query: 78  GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGII 137
              +G  A  I           F + I+A+     +  +E +     G N+ +G  +G +
Sbjct: 73  SFWRGNTANVIRYFPTQALNFAFKDQIKAMFG---FKKEEGYAKWFAG-NLASGGIAGGL 128

Query: 138 GAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
             +    L   +TRL + + + K G +  + G+ +  K    ++GV GL+RG   +++  
Sbjct: 129 SLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGI 188

Query: 198 GAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQK 257
                +   +Y++ K  LL   +     +  L    ++  G +    P D +  R+    
Sbjct: 189 VVYRGLYFGLYDSCKPLLLTGSLEGSFIASFLLGWVVT-TGASTASYPLDTVRRRMMMTS 247

Query: 258 GDL--YKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
           G    YKG +DCL K V  EG+++L+KG  A + R
Sbjct: 248 GQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILR 282

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 81/196 (41%), Gaps = 31/196 (15%)

Query: 117 ESHKVQS-VGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTH-YTGVWNGL 174
           E+ K QS   I+   G  S  +     SP+  VK  +Q+    IK G   H Y G+ +  
Sbjct: 3   ETKKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCF 62

Query: 175 KTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIM-------EDGPSL 227
           +     EG+   +RG  A ++R         P    A NF  ++ I        E+G + 
Sbjct: 63  QRTARQEGIISFWRGNTANVIR-------YFP--TQALNFAFKDQIKAMFGFKKEEGYAK 113

Query: 228 HLTASTISGLGVA-----VVMNPWDVILTRI-----YNQKG--DLYKGPIDCLVKTVKIE 275
               +  SG G+A     + +   D   TR+      ++KG    + G +D   KT+  +
Sbjct: 114 WFAGNLASG-GIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASD 172

Query: 276 GITALYKGFEAQVFRI 291
           G+  LY+GF   V  I
Sbjct: 173 GVAGLYRGFLPSVIGI 188

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 90/203 (44%), Gaps = 24/203 (11%)

Query: 20  GSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR----NEG 75
           G+  +GG+A  +++     ++  + R+    +   ++++     F  +  V++    ++G
Sbjct: 117 GNLASGGIAGGLSLMFVYSLDYARTRLAADAK---SSKKGGERQFNGLVDVYKKTIASDG 173

Query: 76  IRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS--VGINVFAGAA 133
           + GL +G + + I  +   G   G Y+  + ++        E   + S  +G  V  GA+
Sbjct: 174 VAGLYRGFLPSVIGIVVYRGLYFGLYDSCKPLL---LTGSLEGSFIASFLLGWVVTTGAS 230

Query: 134 SGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAA 193
           +         PL  V+ R+   S     G+   Y G  + L+ I   EGV  LF+G  A 
Sbjct: 231 TA------SYPLDTVRRRMMMTS-----GQAVKYKGAMDCLQKIVAAEGVSSLFKGCGAN 279

Query: 194 ILRTGAGSSVQLPIYNTAKNFLL 216
           ILR  AG+ V + +Y+  +  L 
Sbjct: 280 ILRGVAGAGV-ISLYDQLQMILF 301

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 261 YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFESK 315
           YKG +DC  +T + EGI + ++G  A V R  P   L   F +Q +K +  F+ +
Sbjct: 55  YKGIVDCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQ-IKAMFGFKKE 108

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 86.3 bits (212), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 127/288 (44%), Gaps = 37/288 (12%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +F+ G +A CI  T+  PI+ VK RMQ Q  L       Y N       +   EGIRG+ 
Sbjct: 546 NFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQ-----YKNSIDCFLKILSREGIRGVY 600

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS----VGI--NVFAGAAS 134
            GL           G +L    P +A+  K    D   +K++     +G+   + +GA++
Sbjct: 601 SGL-----------GPQLIGVAPEKAI--KLTVNDYMRNKLKDKNGKLGLLSEIISGASA 647

Query: 135 GIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAI 194
           G    +  +PL +VK RLQ     +    +         +K +    G+ GL++G  A +
Sbjct: 648 GACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRL----GLPGLYKGAAACL 703

Query: 195 LRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLH------LTASTISGLGVAVVMNPWDV 248
           LR    S++  P Y   K  L   D  +            L+A  ++G+  A +  P+DV
Sbjct: 704 LRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDV 763

Query: 249 ILTR--IYNQKGD-LYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
           I TR  I  +KG+ +YKG I      ++ E   + +KG  A+V R  P
Sbjct: 764 IKTRLQIDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSP 811

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 110/248 (44%), Gaps = 28/248 (11%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G  A    V  TNP+E+VKIR+Q++GE +A N         A+ ++ R  G+ GL KG 
Sbjct: 643 SGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAE--NAKLTALQIIKR-LGLPGLYKGA 699

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF----AGAASGIIGA 139
            A  +  +  +      Y P  A + +  +    + K +   +N +    AGA +G+  A
Sbjct: 700 AACLLRDVPFS----AIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAA 755

Query: 140 VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199
            + +P  ++KTRLQ      K GE T Y G+ +  +TI   E  K  F+G  A +LR+  
Sbjct: 756 YLTTPFDVIKTRLQI---DPKKGE-TIYKGIIHAARTILREESFKSFFKGGAARVLRSSP 811

Query: 200 GSSVQLPIYNTAKN-FLLRND-----IMEDGPSLHLTASTISGLGVA------VVMNPW- 246
                L  Y    N F L ND     I ED     +  +   G  +       +V NP+ 
Sbjct: 812 QFGFTLAAYELFHNIFPLPNDKDKFVISEDDRRAKILNNNARGPNIDKRELTRIVENPYS 871

Query: 247 DVILTRIY 254
           D  L   Y
Sbjct: 872 DSYLNYYY 879

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/220 (20%), Positives = 87/220 (39%), Gaps = 41/220 (18%)

Query: 104 IRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGE 163
           +R +  ++ Y +   + +     N   G+ +G IGA +  P+  VKTR+Q+  +      
Sbjct: 523 LRHIEEESLYTNYYFYPIFDSLYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSL----- 577

Query: 164 QTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMED 223
            + Y    +    I   EG++G++ G+   ++      +++L +     N  +RN + + 
Sbjct: 578 -SQYKNSIDCFLKILSREGIRGVYSGLGPQLIGVAPEKAIKLTV-----NDYMRNKLKDK 631

Query: 224 GPSLHLTASTISGLGV----AVVMNPWDVILTRIYNQKGD-------------------- 259
              L L +  ISG        +  NP +++  R+   KG+                    
Sbjct: 632 NGKLGLLSEIISGASAGACQVIFTNPLEIVKIRL-QVKGEYVAENAENAKLTALQIIKRL 690

Query: 260 ----LYKGPIDCLVKTVKIEGIT-ALYKGFEAQVFRIGPH 294
               LYKG   CL++ V    I    Y   +  +F   P+
Sbjct: 691 GLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPN 730

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 44/96 (45%), Gaps = 16/96 (16%)

Query: 206 PIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKG-DLYKGP 264
           PI+++  NF L                +++G   A ++ P D + TR+  Q+    YK  
Sbjct: 539 PIFDSLYNFSL---------------GSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNS 583

Query: 265 IDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLT 300
           IDC +K +  EGI  +Y G   Q+  + P   + LT
Sbjct: 584 IDCFLKILSREGIRGVYSGLGPQLIGVAPEKAIKLT 619

 Score = 35.8 bits (81), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 3/97 (3%)

Query: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQ 65
           D   K+   +++ +   +AG LA   A  +T P +V+K R+Q+  +     + IY     
Sbjct: 728 DPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPK---KGETIYKGIIH 784

Query: 66  AMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYE 102
           A   + R E  +   KG  A  +      G  L  YE
Sbjct: 785 AARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYE 821

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 117/274 (42%), Gaps = 9/274 (3%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAAN--QRIYTNPFQAMGVVFRNEGIRG 78
            F  GG++A +A T  +PIE VK+ +Q Q E++      R Y             EG+  
Sbjct: 26  DFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVIS 85

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIG 138
             +G  A  I           F + I+A+     +  +E +     G N+ +G A+G + 
Sbjct: 86  FWRGNTANVIRYFPTQALNFAFKDKIKAMFG---FKKEEGYAKWFAG-NLASGGAAGALS 141

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
            +    L   +TRL + S + K G    + G+ +  K    ++GV GL+RG   +++   
Sbjct: 142 LLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIV 201

Query: 199 AGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKG 258
               +   +Y++ K  LL   +     +  L    ++  G +    P D +  R+    G
Sbjct: 202 VYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVT-TGASTCSYPLDTVRRRMMMTSG 260

Query: 259 DL--YKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
               Y G  DCL K V  EG+ +L+KG  A + R
Sbjct: 261 QAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILR 294

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 83/193 (43%), Gaps = 18/193 (9%)

Query: 20  GSFTAGGLAACIAVTVTNPIEVVKIRMQLQGEL-MAANQRIYTNPFQAMGVVFRNEGIRG 78
           G+  +GG A  +++     ++  + R+    +       R +           +++G+ G
Sbjct: 129 GNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAG 188

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS--VGINVFAGAASGI 136
           L +G + + +  +   G   G Y+ ++ ++        E   + S  +G  V  GA++  
Sbjct: 189 LYRGFLPSVVGIVVYRGLYFGMYDSLKPLL---LTGSLEGSFLASFLLGWVVTTGAST-- 243

Query: 137 IGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILR 196
                  PL  V+ R+   S     G+   Y G ++ L+ I   EGV  LF+G  A ILR
Sbjct: 244 ----CSYPLDTVRRRMMMTS-----GQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILR 294

Query: 197 TGAGSSVQLPIYN 209
             AG+ V + +Y+
Sbjct: 295 GVAGAGV-ISMYD 306

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 73/179 (40%), Gaps = 30/179 (16%)

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGE-QTHYTGVWNGLKTIYMTEGVK 184
           I+   G  S  +     SP+  VK  +Q+    +K G     Y G+ +  K     EGV 
Sbjct: 25  IDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVI 84

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIM-------EDGPSLHLTASTISGL 237
             +RG  A ++R         P    A NF  ++ I        E+G +     +  SG 
Sbjct: 85  SFWRGNTANVIR-------YFP--TQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASG- 134

Query: 238 GVAVVMN-----PWDVILTRI-----YNQKGDL--YKGPIDCLVKTVKIEGITALYKGF 284
           G A  ++       D   TR+      ++KG    + G ID   KT+K +G+  LY+GF
Sbjct: 135 GAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGF 193

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 261 YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFESK 315
           Y G +DC  +T   EG+ + ++G  A V R  P   L   F ++ +K +  F+ +
Sbjct: 67  YAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDK-IKAMFGFKKE 120

>Kwal_26.8669
          Length = 296

 Score = 83.6 bits (205), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 127/308 (41%), Gaps = 20/308 (6%)

Query: 13  AQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR 72
           A+ +  F  F AG +A    + V  P++VVK RMQLQ       Q  Y      +  +  
Sbjct: 4   ARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQ--YKGVVDCIKQIVA 61

Query: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGA 132
            EG   L KG+ +  + +     ++    +  + +  + F  ++ +       +++ +GA
Sbjct: 62  KEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQS-----LSILSGA 116

Query: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDA 192
           ++G   A +  P  LVK RLQ  S++        Y G  + ++ I   EGV  ++ G+++
Sbjct: 117 SAGCCEAFVVVPFELVKIRLQDVSSS--------YKGPIDVVRKIIAQEGVLAMYNGLES 168

Query: 193 AILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTR 252
            + R G  ++    I    +  L             L A +I G   +++  P+DV+ +R
Sbjct: 169 TLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSR 228

Query: 253 IYNQK-----GDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMK 307
           I N          Y      +    K EG  ALYKGF  +V R+GP   + L      M 
Sbjct: 229 IQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMD 288

Query: 308 LVHAFESK 315
                  K
Sbjct: 289 FFRTLHYK 296

>Kwal_23.3965
          Length = 307

 Score = 83.2 bits (204), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 83/326 (25%), Positives = 139/326 (42%), Gaps = 45/326 (13%)

Query: 4   GEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNP 63
            ED ++K   Q+V  F S  AG L+   A  VT P++ +KIR+QLQ     AN+  Y   
Sbjct: 2   AEDHLRK--GQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ----LANEAQYGGI 55

Query: 64  FQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS 123
                 + R EG+R L KG V A    I    ++   Y    A++NK     Q   ++ +
Sbjct: 56  LVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY----AILNKLLSKSQLPAQIHT 111

Query: 124 VGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGV 183
             +    GA SG   A+   P  +++TR  +             + + +  + I+  EG 
Sbjct: 112 GMV----GALSGTCSAIASYPCDVLRTRFIA-------NHSRELSTMLSTAQEIWRHEGF 160

Query: 184 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL-LRNDIMEDGPSLHL---TASTISGLGV 239
           +G F+G+ ++I+     +S  L  Y + K F   R D   D   + L   +AS I+G+  
Sbjct: 161 RGFFKGVSSSIVSIAVATSSILATYESVKIFCEQRPD--RDSSVIQLLESSASVIAGIVS 218

Query: 240 AVVMNPWDVILTRIY-------------NQKGDLYKGP-----IDCLVKTVKIEGITALY 281
             ++ P D +  R               N+    YK       +   +  V+ EG+ ALY
Sbjct: 219 KTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALY 278

Query: 282 KGFEAQVFRIGPHTILCLTFLEQTMK 307
            G+   + +  P T++ L   E  ++
Sbjct: 279 HGYTLGIAKSVPSTVVSLGVYEWCLR 304

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 84.0 bits (206), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 128/298 (42%), Gaps = 22/298 (7%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G LA  ++  +  P++V K R+Q QG    + +R Y      +  + R+EG+ GL KGL
Sbjct: 90  SGALAGFVSGIMVCPLDVAKTRLQAQGA--GSGERYYRGIVGTLSAILRDEGVAGLYKGL 147

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
               +            YE       K  YP        S   +  +   +G I   + +
Sbjct: 148 APIVLGYFPTWMLYFSVYEKC-----KQRYPSYLPGGFVS---HAASALTAGAISTALTN 199

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
           P+++VKTRL   S+  +  + T+Y    +  + +Y +EG+K  + G+  ++       ++
Sbjct: 200 PIWVVKTRLMIQSDVSR--DSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGL-FHVAI 256

Query: 204 QLPIYNTAKNFLLRNDIMEDGPSLH---------LTASTISGLGVAVVMNPWDVILTRIY 254
             P+Y   K +L RN    DG  L          + AS +S +  +V+  P +++ TR+ 
Sbjct: 257 HFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQ 316

Query: 255 NQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAF 312
            +   +    ++ L +    EG    Y GF   + R  P +++ L   E   K +  +
Sbjct: 317 VRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFEYFRKYLRMW 374

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 96/206 (46%), Gaps = 23/206 (11%)

Query: 19  FGSFTAGGLAA-CIAVTVTNPIEVVKIRMQLQGELM--AANQRIYTNPFQAMGVVFRNEG 75
           F S  A  L A  I+  +TNPI VVK R+ +Q ++   + N R   + F+ M   +R+EG
Sbjct: 180 FVSHAASALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKM---YRSEG 236

Query: 76  IRGLQKGLVAAY--IYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN----VF 129
           ++    GLV +   ++ +A++      YE ++  +++   P  +  ++    +     + 
Sbjct: 237 LKVFYSGLVPSLFGLFHVAIH---FPVYEKLKIWLHRN-TPAADGQRLDHNKLQLDRLIV 292

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
           A   S ++ +V+  P  +++TR+Q   + +          + N L  I  +EG  G + G
Sbjct: 293 ASCLSKVVASVITYPHEILRTRMQVRHSGVP-------PSLLNLLGRIRASEGYVGFYSG 345

Query: 190 IDAAILRTGAGSSVQLPIYNTAKNFL 215
               ++RT   S + L  +   + +L
Sbjct: 346 FATNLVRTVPASVITLVSFEYFRKYL 371

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 72/169 (42%), Gaps = 10/169 (5%)

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185
           +   +GA +G +  +M  PL + KTRLQ  +     GE+ +Y G+   L  I   EGV G
Sbjct: 86  VTAVSGALAGFVSGIMVCPLDVAKTRLQ--AQGAGSGER-YYRGIVGTLSAILRDEGVAG 142

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNP 245
           L++G+   +L       +   +Y   K        +  G   H  ++  +G     + NP
Sbjct: 143 LYKGLAPIVLGYFPTWMLYFSVYEKCKQRY--PSYLPGGFVSHAASALTAGAISTALTNP 200

Query: 246 WDVILTRIY-----NQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVF 289
             V+ TR+      ++    Y+  +D   K  + EG+   Y G    +F
Sbjct: 201 IWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLF 249

>Scas_721.27
          Length = 374

 Score = 84.0 bits (206), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 87/343 (25%), Positives = 148/343 (43%), Gaps = 50/343 (14%)

Query: 7   KIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQ----------GELMAA- 55
           KI+  +   V  +  F AGG+       VT P ++VK R+Q              + AA 
Sbjct: 41  KIKPESHPNVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAH 100

Query: 56  NQRIYTNPFQA----------MGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIR 105
           N +I  +  QA          +G V++ EG R L KGL    +  I         Y   +
Sbjct: 101 NSKIANSLVQAGTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTK 160

Query: 106 AVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQT 165
            + +K F   QE+       I++ + A +G   +   +P++++KTR+Q      K G   
Sbjct: 161 EIYSKAFNNGQETPL-----IHLMSAATAGWATSTATNPIWMIKTRVQ----LDKAGTTR 211

Query: 166 HYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGP 225
            Y   W+ LKT+  +EG+ GL+RG+ A+ L +  G  +Q  +Y   K+ + +  I + G 
Sbjct: 212 KYKNSWDCLKTVLKSEGIYGLYRGLSASYLGSIEG-ILQWLLYEQMKHLIKQRSIEKFGH 270

Query: 226 SLHLTASTISGL----------GVA-----VVMNPWDVILTRIYNQKGD----LYKGPID 266
              LT S    +          GVA     +V  P +V+ TR+     +     Y G + 
Sbjct: 271 EGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQ 330

Query: 267 CLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309
                +K EG+ ++Y G    + R  P++I+     E  ++L+
Sbjct: 331 SFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWELVIRLL 373

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 129/292 (44%), Gaps = 18/292 (6%)

Query: 8   IQKSAAQKVSKFG-SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAAN--QRIYTNPF 64
           +   A Q+ + F  +F  GG++A IA T  +PIE VKI +Q Q E++      + Y+   
Sbjct: 1   MSSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIV 60

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSV 124
                  + EG+    +G  A  I           F + I+ +     +  +E +     
Sbjct: 61  DCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFG---FKKEEGYGKWFA 117

Query: 125 GINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK 184
           G N+ +G A+G +  +    L   +TRL + + + K G    + G+ +  K    ++G+ 
Sbjct: 118 G-NLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIA 176

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGL----GVA 240
           GL+RG   +++       +   ++++ K  +L   +  DG  L   AS + G     G +
Sbjct: 177 GLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSL--DGSFL---ASFLLGWVVTTGAS 231

Query: 241 VVMNPWDVILTRIYNQKGDL--YKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
               P D +  R+    G    Y G IDCL K V  EG+ +L+KG  A + R
Sbjct: 232 TCSYPLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILR 283

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 89/194 (45%), Gaps = 20/194 (10%)

Query: 20  GSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR----NEG 75
           G+  +GG A  +++     ++  + R+    +   ++++     F  +  V++    ++G
Sbjct: 118 GNLASGGAAGALSLLFVYSLDFARTRLAADAK---SSKKGGARQFNGLTDVYKKTLKSDG 174

Query: 76  IRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASG 135
           I GL +G + + +  +   G   G ++ ++ ++  T   D        +G  V  GA++ 
Sbjct: 175 IAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLV-LTGSLDGSFLASFLLGWVVTTGAST- 232

Query: 136 IIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAIL 195
                   PL  V+ R+   S     G+   Y G  + LK I  +EGV  LF+G  A IL
Sbjct: 233 -----CSYPLDTVRRRMMMTS-----GQAVKYNGAIDCLKKIVASEGVGSLFKGCGANIL 282

Query: 196 RTGAGSSVQLPIYN 209
           R+ AG+ V + +Y+
Sbjct: 283 RSVAGAGV-ISMYD 295

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 261 YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFESK 315
           Y G +DC  +T K EG+ + ++G  A V R  P   L   F ++ +KL+  F+ +
Sbjct: 56  YSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDK-IKLMFGFKKE 109

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 129/288 (44%), Gaps = 42/288 (14%)

Query: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK 81
           F AG +A    + V  P++VVK RMQLQ +  A     YT     +  +   EG+  L K
Sbjct: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH--YTGVVDCLKKIVAGEGVGRLYK 72

Query: 82  GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVM 141
           G+ +  + +     ++    +  + +  + F  ++ S       +++ AGA++G + A +
Sbjct: 73  GISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQP-----LSMLAGASAGCVEAFV 127

Query: 142 GSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201
             P  LVK RLQ  S++        Y G  + ++ I   EGV  ++ G+++ + R    +
Sbjct: 128 VVPFELVKIRLQDASSS--------YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN 179

Query: 202 SVQLPIYNTAKNFL---------LRNDIMED--GPSLHLTASTISGLGVAVVMNPWDVIL 250
                I   A+  L         + ND++ D  G S+    ST           P+DV+ 
Sbjct: 180 GGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-----------PFDVVK 228

Query: 251 TRIYNQ---KGDL--YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
           +RI N     G +  Y   +  L+   + EG  ALYKGF  +V R+GP
Sbjct: 229 SRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 88/206 (42%), Gaps = 15/206 (7%)

Query: 9   QKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMG 68
           Q    +K+S+  S  AG  A C+   V  P E+VKIR+Q            Y  P   + 
Sbjct: 101 QAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ-------DASSSYKGPVDVVR 153

Query: 69  VVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINV 128
            +   EG+  +  GL +        NG   G     RA++          +K Q +  ++
Sbjct: 154 KIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAA------HNKTQCITNDL 207

Query: 129 FAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFR 188
            + +    IG ++ +P  +VK+R+Q+   A+  G    Y      L TIY  EG + L++
Sbjct: 208 ISDSIGCSIGCMLSTPFDVVKSRIQN--TAVIPGVVRKYNWSLPSLLTIYREEGFRALYK 265

Query: 189 GIDAAILRTGAGSSVQLPIYNTAKNF 214
           G    +LR G G  + L ++    +F
Sbjct: 266 GFVPKVLRLGPGGGILLVVFTGVLDF 291

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 81.6 bits (200), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/293 (28%), Positives = 121/293 (41%), Gaps = 17/293 (5%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMG-VVFRNEGIRGL 79
           +  AGG A        +P++ +K+RMQ+    +A  + +    F   G  +++ EG   L
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIY-RRVAGIEHVKPPGFIKTGRTIYQKEGFLAL 71

Query: 80  QKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGA 139
            KGL A  I  I     R   YE       +T   ++ES  V S G    AG  +GI  A
Sbjct: 72  YKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLVNKESGIV-STGNTFVAGVGAGITEA 125

Query: 140 VMG-SPLFLVKTRLQS-YSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
           V+  +P+ +VK RLQ+ +    +      Y    +   TI   EGV  L+RG+     R 
Sbjct: 126 VLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQ 185

Query: 198 GAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTA-STISGLGVAVVMNPWDVILTRIYN- 255
                    +Y+  K FL     M+  PS   +    ISG        P D I TR+   
Sbjct: 186 ATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKD 245

Query: 256 -----QKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLE 303
                +K    K  I    + +K EG  ALYKG   +V R+ P   +  T  E
Sbjct: 246 KSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 298

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 79/178 (44%), Gaps = 14/178 (7%)

Query: 117 ESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKT 176
           +  K     IN+ AG  +G+  A+   PL  +K R+Q Y     I E     G     +T
Sbjct: 3   QKKKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGI-EHVKPPGFIKTGRT 61

Query: 177 IYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRND--IMEDGPSLHLTASTI 234
           IY  EG   L++G+ A ++      +++   Y   +  L+  +  I+  G +    A   
Sbjct: 62  IYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNT--FVAGVG 119

Query: 235 SGLGVAV-VMNPWDVILTRIYNQK--------GDLYKGPIDCLVKTVKIEGITALYKG 283
           +G+  AV V+NP +V+  R+  Q         G  Y   I      VK EG++ALY+G
Sbjct: 120 AGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRG 177

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 80.9 bits (198), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 124/299 (41%), Gaps = 20/299 (6%)

Query: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK 81
           F AG +A    + V  P+++VK  MQLQ    +  Q  Y   F  +  +   EG   L K
Sbjct: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQ--YKGVFDCLKQIAAKEGPSRLYK 70

Query: 82  GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVM 141
           G+ +  + +     ++    +  + +    F  ++ +       +++ +GA++GI  + +
Sbjct: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQP-----LSILSGASAGICESFV 125

Query: 142 GSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201
             P  LVK RLQ  S        + +T     +K I   EG+  ++ G+++ + R G  +
Sbjct: 126 VVPFELVKIRLQDVS--------SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177

Query: 202 SVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQK---- 257
           +    I    +  L +     +     L A T+ G   +++  P+DV+ +R+ N      
Sbjct: 178 AGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPG 237

Query: 258 -GDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFESK 315
               Y      L    K EG  ALYKGF  +V R+GP   + L      M        K
Sbjct: 238 VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTVHEK 296

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 90/203 (44%), Gaps = 15/203 (7%)

Query: 13  AQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR 72
           A+K+++  S  +G  A      V  P E+VKIR+Q            +T+P   +  +  
Sbjct: 103 AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVE 155

Query: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGA 132
            EGI  +  GL +        N    G    +RA++ K       S K +    ++ AG 
Sbjct: 156 KEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKA------STKSEQTRNDLLAGT 209

Query: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDA 192
             G + +++ +P  +VK+R+Q+   A+  G    Y   W  L TIY  EG K L++G   
Sbjct: 210 VGGTLSSLLSTPFDVVKSRVQN--TAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267

Query: 193 AILRTGAGSSVQLPIYNTAKNFL 215
            +LR G G  + L ++    +F 
Sbjct: 268 KVLRLGPGGGILLVVFTGVMDFF 290

>Kwal_55.20868
          Length = 380

 Score = 81.6 bits (200), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 127/299 (42%), Gaps = 33/299 (11%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G +A  +A     P++V K R+Q QG L +     Y      +  + R+EG RGL KGL
Sbjct: 81  SGAMAGFLAGVTVCPLDVAKTRLQAQG-LHSNPSNYYKGILGTLTTIIRDEGARGLYKGL 139

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYP-DQESHKVQSVGINVFAGAASGIIGAVMG 142
           V   +            YE  + +  + F   D  SH   ++         +G +  ++ 
Sbjct: 140 VPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASAL--------TAGTVSTILT 191

Query: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           +P+++VKTRL   ++  K    THYT  ++    +Y TEG++  + G+  ++L      +
Sbjct: 192 NPVWVVKTRLMLQTHVNK--NSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGL-FHVA 248

Query: 203 VQLPIYNTAKNFLLRNDIMEDGPSLHLT------ASTISGLGVAVVMNPWDVILTRIYNQ 256
           +  PIY   K +L     M      +L       AS+ S +  + +  P +++ TR+  Q
Sbjct: 249 IHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRM--Q 306

Query: 257 KGDLYKGPIDCLVK------------TVKIEGITALYKGFEAQVFRIGPHTILCLTFLE 303
                  P+  L K            T K EG+   Y GF A + R  P + + L   E
Sbjct: 307 LKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFE 365

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 70/168 (41%), Gaps = 16/168 (9%)

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185
           I   +GA +G +  V   PL + KTRLQ+    +      +Y G+   L TI   EG +G
Sbjct: 77  ITALSGAMAGFLAGVTVCPLDVAKTRLQA--QGLHSNPSNYYKGILGTLTTIIRDEGARG 134

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLR----NDIMEDGPSLHLTASTISGLGVAV 241
           L++G+   I+       +   +Y  +K    R     D +    S  LTA T+S     +
Sbjct: 135 LYKGLVPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASA-LTAGTVS----TI 189

Query: 242 VMNPWDVILTRIY-----NQKGDLYKGPIDCLVKTVKIEGITALYKGF 284
           + NP  V+ TR+      N+    Y    D   K    EG+   Y G 
Sbjct: 190 LTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGL 237

 Score = 35.0 bits (79), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQG---ELMAANQRIYTNPF-QAMGVVFRNEGIRGL 79
           A   +  +A T+T P E+++ RMQL+    + +AA Q+   +   + +   +++EG+RG 
Sbjct: 283 ASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGF 342

Query: 80  QKGLVAAYIYQIALNGSRLGFYEPIRAVMNK 110
             G  A     +  +   L  +E  R  + K
Sbjct: 343 YSGFTANLARTLPASAITLVSFEYFRKYLTK 373

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 234 ISGLGVAVVMNPWDVILTRI-----YNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQV 288
           ++G    V + P DV  TR+     ++   + YKG +  L   ++ EG   LYKG    +
Sbjct: 84  MAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGLVPII 143

Query: 289 FRIGPHTILCLTFLEQTMKL 308
               P  ++  +  E++ KL
Sbjct: 144 MGYFPTWMIYFSVYERSKKL 163

>Scas_667.4
          Length = 308

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 124/287 (43%), Gaps = 10/287 (3%)

Query: 9   QKSAAQKVSKFG-SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELM--AANQRIYTNPFQ 65
            K   +K S F   F  GG++A +A T  +PIE VK+ +Q Q E++   +    Y    +
Sbjct: 3   SKEEVKKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIE 62

Query: 66  AMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVG 125
                 + EGI    +G  A  I           F + I+A+     +  +E +     G
Sbjct: 63  CFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFG---FKKEEGYGKWFAG 119

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185
            N+ +G A+G +  +    L   +TRL + + + K G    Y G+ +  K    T+G+ G
Sbjct: 120 -NLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAG 178

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNP 245
           L+RG   +++       +   +Y++ K  +L   +     +  L    ++  G +    P
Sbjct: 179 LYRGFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASFLLGWIVT-TGASTASYP 237

Query: 246 WDVILTRIYNQKGDL--YKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
            D +  R+    G    Y G  DC  K V  EG+++L+KG  A + R
Sbjct: 238 LDTVRRRMMMTSGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILR 284

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 82/194 (42%), Gaps = 20/194 (10%)

Query: 20  GSFTAGGLAACIAVTVTNPIEVVKIRMQLQGEL-MAANQRIYTNPFQAMGVVFRNEGIRG 78
           G+  +GG A  +++     ++  + R+    +       R Y             +G+ G
Sbjct: 119 GNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAG 178

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIR-AVMNKTFYPDQESHKVQS--VGINVFAGAASG 135
           L +G + + +  I   G   G Y+ ++ AV+  +     E   + S  +G  V  GA++ 
Sbjct: 179 LYRGFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSL----EGSFLASFLLGWIVTTGASTA 234

Query: 136 IIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAIL 195
                   PL  V+ R+   S     G+   Y G ++  + +   EGV  LF+G  A IL
Sbjct: 235 ------SYPLDTVRRRMMMTS-----GQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANIL 283

Query: 196 RTGAGSSVQLPIYN 209
           R  AG+ V + +Y+
Sbjct: 284 RGVAGAGV-ISMYD 296

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 261 YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFESK 315
           YKG I+C  +T K EGI A ++G  A V R  P   L   F ++ +K +  F+ +
Sbjct: 57  YKGIIECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDK-IKAMFGFKKE 110

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 80.9 bits (198), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 80/301 (26%), Positives = 124/301 (41%), Gaps = 18/301 (5%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGV-VFRNEGIRGLQKG 82
           AGG A        +P++ +K+RMQ+     +A + I    F   G  ++  EG+  L KG
Sbjct: 16  AGGTAGLFEALCCHPLDTIKVRMQIYRR--SALEGIKPPGFIKTGRNIYTEEGLLALYKG 73

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMG 142
           L A  I  I     R   YE  R+ +      D+++  V S G    AG  +G   AV+ 
Sbjct: 74  LGAVVIGIIPKMAIRFSSYEFYRSAL-----ADKQTGSV-STGNTFLAGVGAGTTEAVLV 127

Query: 143 -SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201
            +P+ +VK RLQ+     +      Y         I   EG+  L+RG+     R     
Sbjct: 128 VNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQ 187

Query: 202 SVQLPIYNTAKNFLLRNDIMEDGPSLHLTA-STISGLGVAVVMNPWDVILTRIYNQKGDL 260
                +Y+  K FL  +   +  PS   +    ISG        P D I TR+   K   
Sbjct: 188 GANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTA 247

Query: 261 YKGPIDCLV----KTVKIEGITALYKGFEAQVFRIGPHTILCLT---FLEQTMKLVHAFE 313
                  +V    + +K EG  ALYKG   +V R+ P   +  T   F+ + ++ +  F+
Sbjct: 248 NMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHLETLGIFK 307

Query: 314 S 314
           S
Sbjct: 308 S 308

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 225 PSLHLTASTISGLGVAVVMNPWDVILTR--IYNQ---KGDLYKGPIDCLVKTVKIEGITA 279
           P+++L A   +GL  A+  +P D I  R  IY +   +G    G I         EG+ A
Sbjct: 10  PAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLA 69

Query: 280 LYKGFEAQVFRIGP 293
           LYKG  A V  I P
Sbjct: 70  LYKGLGAVVIGIIP 83

>Kwal_14.2210
          Length = 315

 Score = 80.5 bits (197), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 79/319 (24%), Positives = 138/319 (43%), Gaps = 29/319 (9%)

Query: 1   MAKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIY 60
           MA  +D   + A +  +   +F AGG+A  ++ TV +P E VKI +Q+Q    A N  + 
Sbjct: 1   MAHLQDHSWRCALKSDAGI-AFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGL- 58

Query: 61  TNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHK 120
              F+A+  V+  EG+ GL +G          LN  R+  Y  ++ ++ +          
Sbjct: 59  ---FRAVKQVYLEEGVPGLLRG--------NGLNCIRIFPYSAVQFLVYEFCKKQWFQQN 107

Query: 121 VQSVGIN---VFAGAASGIIGAVMGSPLFLVKTRLQ-SYSNAIKIGEQTHYT-----GVW 171
             +V +N   + +GA  G    +   PL LV+TRL    +N  ++ +    +     GVW
Sbjct: 108 PDTVVLNWHRLVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVW 167

Query: 172 NGLKTIYMTE-GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLT 230
             L+  Y  E G+ GL+RG+    +      ++   +Y   + ++  +          L+
Sbjct: 168 ELLRKTYTQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLS 227

Query: 231 ASTISGLGVAVVMNPWDVILTRI------YNQKGDLYKGPIDCLVKTVKIEGITALYKGF 284
              ISG     +  P+D++  R        ++ G  YK   D L+   + EG    YKG 
Sbjct: 228 IGAISGGVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGL 287

Query: 285 EAQVFRIGPHTILCLTFLE 303
            A +F++ P T +     E
Sbjct: 288 TANLFKVVPSTAVSWVVYE 306

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 94/219 (42%), Gaps = 21/219 (9%)

Query: 8   IQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQ----GELMAANQRIYTNP 63
            Q++    V  +    +G L    +V  T P+++V+ R+ +Q      L  A       P
Sbjct: 104 FQQNPDTVVLNWHRLVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKP 163

Query: 64  ---FQAMGVVFRNEG-IRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESH 119
              ++ +   +  EG I GL +G+    I  +         YE +R  +  +F P   S 
Sbjct: 164 PGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASL 223

Query: 120 KVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQT---HYTGVWNGLKT 176
              S+G      A SG +   +  P  L++ R Q     + +G+     HY  V + L T
Sbjct: 224 YKLSIG------AISGGVAQTITYPFDLLRRRFQ----VLAMGQSELGFHYKSVPDALIT 273

Query: 177 IYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
           I  TEG KG ++G+ A + +    ++V   +Y T ++++
Sbjct: 274 IGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETVRDYM 312

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 80.5 bits (197), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 87/167 (52%), Gaps = 8/167 (4%)

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQ---SYSNAIKIGEQTH-YTGVWNGLKTIYMTEGVKG 185
           +GA +GI    +  PL +VKTR Q   +   A  +G+Q   Y GV + LK I   EG   
Sbjct: 18  SGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR 77

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRN--DIMEDGPSLHLTASTISGLGVAVVM 243
           L+RGI + +L      + +    N     + +N  +  E    + + A   +G+  A V+
Sbjct: 78  LYRGISSPMLMEAPKRATKFAC-NDQYQKIFKNLFNTNETTQKISIAAGASAGMTEAAVI 136

Query: 244 NPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
            P+++I  R+ + K   Y GP+DCL KT+K EGI  LYKG E+ ++R
Sbjct: 137 VPFELIKIRMQDVKSS-YLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/302 (22%), Positives = 123/302 (40%), Gaps = 23/302 (7%)

Query: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQ-----GELMAANQRIYTNPFQAMGVVFRNEGI 76
           F +G +A    +TV  P++VVK R QL+        +      Y      +  + + EG 
Sbjct: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75

Query: 77  RGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGI 136
             L +G+ +  + +     ++    +  + +    F  ++ + K     I++ AGA++G+
Sbjct: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK-----ISIAAGASAGM 130

Query: 137 IGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILR 196
             A +  P  L+K R+Q          ++ Y G  + LK     EG+ GL++GI++ + R
Sbjct: 131 TEAAVIVPFELIKIRMQDV--------KSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182

Query: 197 TGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQ 256
               +     +    +N +             L A  I G    ++  P+DV+ +RI + 
Sbjct: 183 NALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242

Query: 257 KG-----DLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHA 311
                    Y   +  L+   + EG  ALYKGF  +V R+ P   L L      M     
Sbjct: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302

Query: 312 FE 313
            +
Sbjct: 303 LK 304

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 87/198 (43%), Gaps = 21/198 (10%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           S  AG  A      V  P E++KIRMQ         +  Y  P   +    +NEGI GL 
Sbjct: 121 SIAAGASAGMTEAAVIVPFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLY 173

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140
           KG+ +        NG   G++  I  V N       +  K ++   ++ AGA  G +G +
Sbjct: 174 KGIESTMWRNALWNG---GYFGVIYQVRNSMPVAKTKGQKTRN---DLIAGAIGGTVGTM 227

Query: 141 MGSPLFLVKTRLQS---YSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
           + +P  +VK+R+QS    S+A+K      Y      L  IY  EG + L++G    + R 
Sbjct: 228 LNTPFDVVKSRIQSVDAVSSAVK-----KYNWCLPSLLVIYREEGFRALYKGFVPKVCRL 282

Query: 198 GAGSSVQLPIYNTAKNFL 215
             G S+ L ++    NF 
Sbjct: 283 APGGSLMLVVFTGMMNFF 300

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 80.5 bits (197), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 100/214 (46%), Gaps = 35/214 (16%)

Query: 19  FGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF-----------QAM 67
           F   TAG L   I+  V  P EV+K R+QLQG         Y NPF            A+
Sbjct: 151 FSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGR--------YNNPFFRSGYNYKNLTDAV 202

Query: 68  GVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIR----AVMNKTFYPDQESHKVQS 123
             + R EG   L  G  A     +  +G +  FYE  R    AV NKTF  D       S
Sbjct: 203 TTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENKTFDEDL------S 256

Query: 124 VGINVFAGAASGIIGAVMGSPLFLVKTRLQSY------SNAIKIGEQTHYTGVWNGLKTI 177
           +   +  GAA+G +  ++ +PL +VKTR+Q+       +++  + +QT    +  G+ T+
Sbjct: 257 LSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTV 316

Query: 178 YMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTA 211
           Y TEG+ GLF G+    + T   SS+ L +Y  A
Sbjct: 317 YKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQVA 350

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 111/283 (39%), Gaps = 49/283 (17%)

Query: 39  IEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRL 98
           ++ VK R Q      A +   Y N   A   +   EG+R   KGL   Y      +G+ L
Sbjct: 76  LDTVKTRQQ-----GAPSTVKYKNMIGAYRTIILEEGLR---KGLYGGY------SGAML 121

Query: 99  GFYEPIRAVMNKTFYPDQESHKVQSVGIN-VFAGAASGIIGAVMGS----PLFLVKTRLQ 153
           G + P  A+   T Y   +   +   GIN  F+   +G +G  + S    P  ++KTRLQ
Sbjct: 122 GSF-PSAAIFFAT-YEYTKRKMIGEWGINETFSHLTAGFLGDFISSFVYVPSEVLKTRLQ 179

Query: 154 ---SYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNT 210
               Y+N        +Y  + + + TI   EG   LF G  A + R    S +Q   Y  
Sbjct: 180 LQGRYNNPF-FRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEK 238

Query: 211 AKN--FLLRNDIMEDGPSL--HLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPID 266
            +   F + N   ++  SL   +     +G    ++  P DV+ TRI  Q  D+ +    
Sbjct: 239 FRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQ 298

Query: 267 CL-------------VKTVKIEGITALYKGFEAQVFRIGPHTI 296
            L             +   K EG+  L+ G       +GP  I
Sbjct: 299 NLKQQTLTNSITKGMMTVYKTEGLAGLFSG-------VGPRFI 334

>Scas_489.4
          Length = 297

 Score = 79.7 bits (195), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 120/283 (42%), Gaps = 15/283 (5%)

Query: 14  QKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN 73
           + V    SF AG LA  I  ++T P E  K R+QL  +   A++    NP   +    + 
Sbjct: 6   KPVDPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASR----NPLVLIYNTAKT 61

Query: 74  EGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAA 133
           +G   +  G  A  +   A  G R   ++ I+ ++      +    +       V AG  
Sbjct: 62  QGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGELSGPR------GVVAGLG 115

Query: 134 SGIIGAVMG-SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDA 192
           +G++ +V+  +P   +KT L     A+K   Q +  G+     ++   +G+ GL+RG+  
Sbjct: 116 AGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLP 175

Query: 193 AILRTGAGSSVQLPIYNTAKNFLLR-NDIMEDGP---SLHLTASTISGLGVAVVMNPWDV 248
             +R  A  +V+L  YN  K  +    +  +D P    L       SG+       P D 
Sbjct: 176 VSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDT 235

Query: 249 ILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRI 291
           + TR+ +     Y   ++C  K  K EG+   +KG   ++ R+
Sbjct: 236 VKTRMQSLDATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRL 278

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 85/196 (43%), Gaps = 19/196 (9%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAM----GVVFRNEGIRGL 79
           AG L + +AVT   P E +K  +    + +      Y N  + M    G + R++GI GL
Sbjct: 116 AGLLESVVAVT---PFEAIKTALIDDKQALKPK---YQNNGRGMLRNYGSLVRDQGIMGL 169

Query: 80  QKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGA 139
            +G++   + Q A    RLG Y  I+ ++    Y +    +  S G+    GA SG++  
Sbjct: 170 YRGVLPVSMRQAANQAVRLGCYNKIKTMVQD--YTNAPKDRPLSSGLTFIVGAFSGVVTV 227

Query: 140 VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199
               P+  VKTR+QS        + T YT   N    I+  EG+K  ++G    + R   
Sbjct: 228 YTTMPIDTVKTRMQSL-------DATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLIL 280

Query: 200 GSSVQLPIYNTAKNFL 215
              +   IY     FL
Sbjct: 281 SGGIVFTIYENVLVFL 296

>Kwal_27.12481
          Length = 304

 Score = 79.7 bits (195), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 122/283 (43%), Gaps = 10/283 (3%)

Query: 13  AQKVSKFG-SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELM--AANQRIYTNPFQAMGV 69
           ++K S F   F  GG++A ++ T   PIE VK+ +Q Q E++   +  R YT   +    
Sbjct: 4   SKKQSNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKR 63

Query: 70  VFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF 129
              NEGI    +G  A  I           F + I+A+     +  +E +     G N+ 
Sbjct: 64  TAANEGIASFWRGNTANVIRYFPTQALNFAFKDKIKAMFG---FKKEEGYAKWFAG-NLA 119

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
           +G A+G +  +    L   +TRL + S   K G +  + G+ +  K    ++G+ GL+RG
Sbjct: 120 SGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRG 179

Query: 190 IDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVI 249
              +++       +    Y++ K  LL   +     +  L    ++  G +    P D +
Sbjct: 180 FLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAVT-TGASTASYPLDTV 238

Query: 250 LTRIYNQKGDL--YKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
             R+    G    Y G  D   K V  EGI +L+KG  A + R
Sbjct: 239 RRRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILR 281

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 83/193 (43%), Gaps = 18/193 (9%)

Query: 20  GSFTAGGLAACIAVTVTNPIEVVKIRMQLQGE-LMAANQRIYTNPFQAMGVVFRNEGIRG 78
           G+  +GG A  +++     ++  + R+    +      +R +            ++GI G
Sbjct: 116 GNLASGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAG 175

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS--VGINVFAGAASGI 136
           L +G + + +  +   G   G Y+ ++ ++        E   + S  +G  V  GA++  
Sbjct: 176 LYRGFLPSVVGIVVYRGLYFGGYDSLKPLL---LTGSLEGSFLASFLLGWAVTTGASTAS 232

Query: 137 IGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILR 196
                  PL  V+ R+   S     G+   Y G ++  + I   EG+K LF+G  A ILR
Sbjct: 233 Y------PLDTVRRRMMMTS-----GQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILR 281

Query: 197 TGAGSSVQLPIYN 209
             AG+ V + +Y+
Sbjct: 282 GVAGAGV-ISMYD 293

>Scas_718.24
          Length = 337

 Score = 80.1 bits (196), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 132/302 (43%), Gaps = 19/302 (6%)

Query: 1   MAKGED-KIQK----SAAQKVSKFG-SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMA 54
           ++ G+D KIQ     S  +  S F   F  GG++A +A T  +PIE VK+ +Q Q E++ 
Sbjct: 19  VSNGQDHKIQSNTIMSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEML- 77

Query: 55  ANQRIYTNPFQAMGVVFR----NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNK 110
             Q      ++ +   FR     EGI    +G  A  I           F + I+ +   
Sbjct: 78  -KQGTLDTKYKGIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFG- 135

Query: 111 TFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGV 170
             +  ++ +     G N+ +G A+G +  +    L   +TRL + S + K G    + G+
Sbjct: 136 --FKKEDGYGKWFAG-NLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGL 192

Query: 171 WNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLT 230
            +  K    ++GV GL+RG   +++       +   +Y++ K  LL   +     +  L 
Sbjct: 193 IDVYKKTLKSDGVAGLYRGFLPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASFLL 252

Query: 231 ASTISGLGVAVVMNPWDVILTRIYNQKGDL--YKGPIDCLVKTVKIEGITALYKGFEAQV 288
              ++  G +    P D +  ++    G    YKG  DC  K V  EG+ +L+KG  A +
Sbjct: 253 GWVVT-TGASTCSYPLDTVRRKMMMTSGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANI 311

Query: 289 FR 290
            R
Sbjct: 312 LR 313

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 78/187 (41%), Gaps = 17/187 (9%)

Query: 20  GSFTAGGLAACIAVTVTNPIEVVKIRMQLQGEL-MAANQRIYTNPFQAMGVVFRNEGIRG 78
           G+  +GG A  +++     ++  + R+    +       R +           +++G+ G
Sbjct: 148 GNLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAG 207

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS--VGINVFAGAASGI 136
           L +G + + +  I   G   G Y+ I+ V+        E   + S  +G  V  GA++  
Sbjct: 208 LYRGFLPSVVGIIVYRGLYFGLYDSIKPVL---LTGSLEGSFLASFLLGWVVTTGAST-- 262

Query: 137 IGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILR 196
                  PL  V+ ++   S     G+   Y G ++  K I   EGV  LF+G  A ILR
Sbjct: 263 ----CSYPLDTVRRKMMMTS-----GQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILR 313

Query: 197 TGAGSSV 203
             AG+ V
Sbjct: 314 GVAGAGV 320

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 82/202 (40%), Gaps = 28/202 (13%)

Query: 112 FYPDQESHKVQS------------VGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAI 159
           +  + + HK+QS              I+   G  S  +     SP+  VK  +Q+ +  +
Sbjct: 18  YVSNGQDHKIQSNTIMSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEML 77

Query: 160 KIGE-QTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRN 218
           K G   T Y G+ +  +     EG+   +RG  A ++R     ++     +  K  L+  
Sbjct: 78  KQGTLDTKYKGIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIK--LMFG 135

Query: 219 DIMEDGPSLHLTASTISGLGVA-----VVMNPWDVILTRI-----YNQKG--DLYKGPID 266
              EDG       +  SG G A     + +   D   TR+      ++KG    + G ID
Sbjct: 136 FKKEDGYGKWFAGNLASG-GAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLID 194

Query: 267 CLVKTVKIEGITALYKGFEAQV 288
              KT+K +G+  LY+GF   V
Sbjct: 195 VYKKTLKSDGVAGLYRGFLPSV 216

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 261 YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFESK 315
           YKG +DC  +T + EGI + ++G  A V R  P   L   F ++ +KL+  F+ +
Sbjct: 86  YKGIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDK-IKLMFGFKKE 139

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 122/281 (43%), Gaps = 15/281 (5%)

Query: 16  VSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEG 75
           V  F SF AG +A  I  ++T P E  K R+QL  +   A++    NP   +    +N G
Sbjct: 88  VDPFHSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASR----NPLVLIYNTGKNYG 143

Query: 76  IRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASG 135
           I  +  G  A  +   A  G R   ++ I+ ++      D+++ ++      V AG  +G
Sbjct: 144 ISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLR-----DKKTGELSGFR-GVVAGLGAG 197

Query: 136 IIGAVMG-SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAI 194
           ++ +V+  +P   +KT L     A     Q +  G+ +    +   +G  GL+RG+    
Sbjct: 198 LLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVS 257

Query: 195 LRTGAGSSVQLPIYNTAKNFLLR-NDIMEDGP---SLHLTASTISGLGVAVVMNPWDVIL 250
           +R  A  +V+L  YN  K  +    ++ +D P    L       SG+       P D + 
Sbjct: 258 MRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVK 317

Query: 251 TRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRI 291
           TR+ +     Y   I+C     K EG+   +KG   ++ R+
Sbjct: 318 TRMQSLNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRL 358

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 36/88 (40%), Gaps = 6/88 (6%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +F  G  +  + V  T PI+ VK RMQ      + N   Y++       +F+ EG++   
Sbjct: 295 TFIVGAFSGIVTVYTTMPIDTVKTRMQ------SLNAGQYSSTINCFATIFKEEGLKTFW 348

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVM 108
           KG        I   G     YE +  V+
Sbjct: 349 KGATPRLGRLILSGGIVFTIYEKVLTVL 376

>Kwal_23.4731
          Length = 314

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 147/300 (49%), Gaps = 37/300 (12%)

Query: 25  GGLAACIAVTV-TNPIEVVKIRMQLQGELMAANQ-----RIYTNPFQAMGVVFRNEGIRG 78
            GLAA    T+ T+P+++VK+R+QL      ++      +      +A   VFR E  RG
Sbjct: 19  AGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFR-EAYRG 77

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNK-----TFYPDQES-HKVQSVGINVF--A 130
           L   L+   I      G   G Y   + ++ +        P Q S  K +++G +++  +
Sbjct: 78  LGVNLIGNSIAW----GLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLAS 133

Query: 131 GAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGI 190
            A SG+  A++ +P++++KTR+ S S+         Y   W+G++ +Y  EG  G +RG+
Sbjct: 134 AALSGLGTAILTNPIWVIKTRIMSTSSQ----ASERYKTTWDGIRKVYAHEGFSGFWRGL 189

Query: 191 DAAILRTGAGSSVQLPIYNTAKN-FLLRNDIMED---GPSLHLTASTISGLGVAVVMNPW 246
             ++     G ++   IY++ ++ +  R  I ED   G   ++  +++S +     + P+
Sbjct: 190 VPSLFGVAQG-AIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPF 248

Query: 247 DVILTRIYN----QKGDLYKGPIDCLVKTV-KIEGITALYKGFEAQVFRIGPHTILCLTF 301
            ++ + + +    +K D Y+     LVK++ + EG+  LYKG  A + R  P T  C+TF
Sbjct: 249 QLLKSNLQSFAAVEKRDSYR--FWNLVKSIHQKEGLQGLYKGLSANLLRAIPST--CITF 304

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 100/214 (46%), Gaps = 18/214 (8%)

Query: 5   EDKIQKSAAQKVSKF-GSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNP 63
           +   QK  A   S +  S    GL   I   +TNPI V+K R+        A++R Y   
Sbjct: 116 QSSFQKDKAMGPSLYLASAALSGLGTAI---LTNPIWVIKTRIMSTSS--QASER-YKTT 169

Query: 64  FQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRA--VMNKTFYPDQESHKV 121
           +  +  V+ +EG  G  +GLV + ++ +A        Y+ +R      +    D++   +
Sbjct: 170 WDGIRKVYAHEGFSGFWRGLVPS-LFGVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNL 228

Query: 122 QSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTE 181
           +++ I     + S ++      P  L+K+ LQS++      E+      WN +K+I+  E
Sbjct: 229 ENIAIT----SVSKMLSVTAVYPFQLLKSNLQSFAAV----EKRDSYRFWNLVKSIHQKE 280

Query: 182 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
           G++GL++G+ A +LR    + +   IY   +++L
Sbjct: 281 GLQGLYKGLSANLLRAIPSTCITFCIYENLRHWL 314

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 86/208 (41%), Gaps = 37/208 (17%)

Query: 104 IRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGE 163
           + + M   F P Q           + AG A+G +  +   PL LVK RLQ   N      
Sbjct: 2   VSSAMASDFTPLQR---------EIIAGLAAGTLTTIATHPLDLVKLRLQLLVNT----- 47

Query: 164 QTHYTGVWNGLKTIYMTEGV-----KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLR- 217
            TH  G    +KTI           +  +RG+   ++       +   +Y   K+ + R 
Sbjct: 48  -THSHGYKEVIKTIIRDSKADSNVFREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRY 106

Query: 218 ----------NDIMED---GPSLHLTASTISGLGVAVVMNPWDVILTRIY---NQKGDLY 261
                     +   +D   GPSL+L ++ +SGLG A++ NP  VI TRI    +Q  + Y
Sbjct: 107 GVAQMKTPTQSSFQKDKAMGPSLYLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERY 166

Query: 262 KGPIDCLVKTVKIEGITALYKGFEAQVF 289
           K   D + K    EG +  ++G    +F
Sbjct: 167 KTTWDGIRKVYAHEGFSGFWRGLVPSLF 194

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 123/289 (42%), Gaps = 21/289 (7%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G  A  ++     P++V K R+Q QG         Y      +  + R+EG RGL KGL
Sbjct: 83  SGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGL 142

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
           V   +            YE  +   +  F   Q     QS    + AGAAS      + +
Sbjct: 143 VPIVLGYFPTWMIYFSVYEFSKKFFHGIF--PQFDFVAQSCAA-ITAGAAS----TTLTN 195

Query: 144 PLFLVKTRLQSYSNAIKIGEQ-THYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           P+++VKTRL   SN   +GE  THY G ++  + ++  EG K L+ G+  ++L      +
Sbjct: 196 PIWVVKTRLMLQSN---LGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGL-FHVA 251

Query: 203 VQLPIYNTAK----NFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKG 258
           +  PIY   K     +   N+         + AS++S +  + V  P +++ TR+   K 
Sbjct: 252 IHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRM-QLKS 310

Query: 259 DLYKGPIDCLVKTVKI----EGITALYKGFEAQVFRIGPHTILCLTFLE 303
           D+       L   +K     EG+   Y GF   + R  P + + L   E
Sbjct: 311 DIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

 Score = 62.4 bits (150), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 92/203 (45%), Gaps = 20/203 (9%)

Query: 21  SFTAGGLAACIA----VTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGI 76
            F A   AA  A     T+TNPI VVK R+ LQ  L   +   Y   F A   +F  EG 
Sbjct: 175 DFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNL-GEHPTHYKGTFDAFRKLFYQEGF 233

Query: 77  RGLQKGLVAAYI--YQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN--VFAGA 132
           + L  GLV + +  + +A++        PI   +   F+     +   S+ +   + A +
Sbjct: 234 KALYAGLVPSLLGLFHVAIHF-------PIYEDLKVRFHCYSRENNTNSINLQRLIMASS 286

Query: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDA 192
            S +I + +  P  +++TR+Q  S+     ++     ++  +K  Y  EG+KG + G   
Sbjct: 287 VSKMIASAVTYPHEILRTRMQLKSDIPDSIQRR----LFPLIKATYAQEGLKGFYSGFTT 342

Query: 193 AILRTGAGSSVQLPIYNTAKNFL 215
            ++RT   S++ L  +   +N L
Sbjct: 343 NLVRTIPASAITLVSFEYFRNRL 365

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 72/172 (41%), Gaps = 15/172 (8%)

Query: 121 VQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMT 180
           + S  I   +GA +G +  V   PL + KTRLQ+     +  E  +Y G+   L TI   
Sbjct: 74  LSSTQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRF-ENPYYRGIMGTLSTIVRD 132

Query: 181 EGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNF----LLRNDIMEDGPSLHLTASTISG 236
           EG +GL++G+   +L       +   +Y  +K F      + D +         A+  +G
Sbjct: 133 EGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQS-----CAAITAG 187

Query: 237 LGVAVVMNPWDVILTRIYNQKG-----DLYKGPIDCLVKTVKIEGITALYKG 283
                + NP  V+ TR+  Q         YKG  D   K    EG  ALY G
Sbjct: 188 AASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAG 239

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 34/79 (43%), Gaps = 8/79 (10%)

Query: 238 GVAVVMNPWDVILTRIYNQ------KGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRI 291
           GVAV   P DV  TR+  Q      +   Y+G +  L   V+ EG   LYKG    V   
Sbjct: 92  GVAVC--PLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGY 149

Query: 292 GPHTILCLTFLEQTMKLVH 310
            P  ++  +  E + K  H
Sbjct: 150 FPTWMIYFSVYEFSKKFFH 168

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 77.4 bits (189), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/325 (23%), Positives = 143/325 (44%), Gaps = 50/325 (15%)

Query: 1   MAKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIY 60
           M K ED ++K   Q V+ + +  AG ++  +A ++T P++ +KIR+QL      AN    
Sbjct: 1   MFKEEDSLRK--GQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLT----PANG--- 51

Query: 61  TNPF--QAMGV---VFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPD 115
             PF  Q M V   + +NEGIR   KG +   +  +    ++   Y    ++ N+   P 
Sbjct: 52  LKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSY----SLFNRYLTPF 107

Query: 116 QESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLK 175
               ++ S+ +  FAG  S I+      P  +++TRL +         Q H   +   ++
Sbjct: 108 GLEARLHSLVVGAFAGITSSIVSY----PFDVLRTRLVA-------NNQMHSMSITREVR 156

Query: 176 TIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDG------PSLHL 229
            I+  EG+ G F+G  A++      +S+    Y T + +   N+            +L+ 
Sbjct: 157 DIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNH 216

Query: 230 TASTISGLGVAVVMNPWDVILTRI----------YNQKGDLY-----KGPIDCLVKTVKI 274
           +A TI G+   ++  P + I  R+          +++   +Y      G     ++ +K 
Sbjct: 217 SAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQ 276

Query: 275 EGITALYKGFEAQVFRIGPHTILCL 299
           EG+++LY+G    + +  P T +  
Sbjct: 277 EGVSSLYRGILVALSKTIPTTFVSF 301

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 95/209 (45%), Gaps = 18/209 (8%)

Query: 17  SKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGI 76
           ++  S   G  A   +  V+ P +V++ R      L+A NQ    +  + +  +++ EG+
Sbjct: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTR------LVANNQMHSMSITREVRDIWKLEGL 164

Query: 77  RGLQKGLVAAYIYQIALNGS-RLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASG 135
            G  KG +A+ +  I L  S   G YE IR   ++         K +   +N  AG   G
Sbjct: 165 PGFFKGSIAS-MTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGG 223

Query: 136 IIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLK---------TIYMTEGVKGL 186
           +I  ++  PL  ++ R+Q + N+  + + + ++ V+   K          I   EGV  L
Sbjct: 224 VIAKIITFPLETIRRRMQ-FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSL 282

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
           +RGI  A+ +T   + V    Y TA ++L
Sbjct: 283 YRGILVALSKTIPTTFVSFWGYETAIHYL 311

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 77.8 bits (190), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 90/203 (44%), Gaps = 13/203 (6%)

Query: 16  VSKFGSFTAG-GLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNE 74
           VS   +F AG G     AV V NP+EVVKIR+Q Q    AA Q+ Y N  QA  ++ + E
Sbjct: 153 VSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE 212

Query: 75  GIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGI--NVFAGA 132
           GI  L +G+      Q    G+    Y  +   +       QE H  Q++        G 
Sbjct: 213 GIGALYRGVSLTAARQATNQGANFTVYSKLMERL-------QEYHGSQNLPSWETSLIGL 265

Query: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDA 192
            SG IG    +PL  +KTRLQ   +   +      T +    + +   EG + L++GI  
Sbjct: 266 VSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIG---RQLVQEEGFRALYKGITP 322

Query: 193 AILRTGAGSSVQLPIYNTAKNFL 215
            ++R   G +V   +Y   +  L
Sbjct: 323 RVMRVAPGQAVTFTVYEFVRRHL 345

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 114/293 (38%), Gaps = 23/293 (7%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGV-VFRNEGIRGL 79
           +  AGG A        +P++ +K+RMQ+      AN+      F   G  ++  EG+   
Sbjct: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQI---YRRANEGTKPPGFLRTGANIYSGEGLLAF 116

Query: 80  QKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGA 139
            KGL A  I  I     R   YE       +T   D+++  V S G    AG  +G+  A
Sbjct: 117 YKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLADRQT-GVVSTGNTFLAGVGAGVTEA 170

Query: 140 VMG-SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
           V+  +P+ +VK RLQ+  +     EQ  Y         I   EG+  L+RG+     R  
Sbjct: 171 VLVVNPMEVVKIRLQA-QHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229

Query: 199 AGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMN-PWDVILTRIYNQK 257
                   +Y+     L      ++ PS   +   +    +    N P D I TR+   K
Sbjct: 230 TNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDK 289

Query: 258 GDLYKGPIDCLVKTVKI-------EGITALYKGFEAQVFRIGPHTILCLTFLE 303
                  +   V+   I       EG  ALYKG   +V R+ P   +  T  E
Sbjct: 290 STRN---LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 37/83 (44%), Gaps = 4/83 (4%)

Query: 225 PSLHLTASTISGLGVAVVMNPWDVILTR--IYNQKGDLYKGP--IDCLVKTVKIEGITAL 280
           P+++L A   +GL  A+  +P D I  R  IY +  +  K P  +         EG+ A 
Sbjct: 57  PAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAF 116

Query: 281 YKGFEAQVFRIGPHTILCLTFLE 303
           YKG  A V  I P   +  +  E
Sbjct: 117 YKGLGAVVIGIIPKMAIRFSSYE 139

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 77.0 bits (188), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 73/307 (23%), Positives = 119/307 (38%), Gaps = 34/307 (11%)

Query: 1   MAKGEDKIQKS-----AAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAA 55
           M+K  + I +      + +  S+   F AG  +      V +P + +K+R+Q      + 
Sbjct: 1   MSKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ-----TSQ 55

Query: 56  NQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPD 115
           N+  +  P   +   FRN+GIRG   G     +  I ++   LG     R +M+K  YP+
Sbjct: 56  NETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPN 115

Query: 116 QESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLK 175
            E   +      + +G  +G   + +  P+ L K +LQ   +       T Y G  + +K
Sbjct: 116 DEKLPLSGC---IISGVLAGWSVSFIAPPIELAKAKLQVQYDK----TTTRYKGPLDVIK 168

Query: 176 TIYMTEGVKGLFRG-IDAAILRT----GAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLT 230
            IY  +G++GL++G I   I RT      GS      Y     +   N  M +       
Sbjct: 169 KIYSAQGIRGLYKGLISTLIFRTHFVYWWGS------YELLTRWFRENTKMSEAAINFWA 222

Query: 231 ASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVK----IEGITALYKGFEA 286
               +  G      P DV+   +     D Y G        VK     +GI   +KGF  
Sbjct: 223 GGFSASFGFWTTAYPSDVVKQVVLCN--DKYDGSFKSWRTAVKDIYQSKGINGFFKGFVP 280

Query: 287 QVFRIGP 293
              R  P
Sbjct: 281 SFLRSFP 287

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 83/190 (43%), Gaps = 21/190 (11%)

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
           AG  SG+    +G P   +K RLQ+  N      +T + G  + +   +  +G++G + G
Sbjct: 29  AGVFSGVAKNAVGHPFDTIKVRLQTSQN------ETRFKGPLDCVYKTFRNQGIRGFYLG 82

Query: 190 IDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGL----GVAVVMNP 245
               ++      SV L   +  +  L+   +  +   L L+   ISG+     V+ +  P
Sbjct: 83  FTPPLVGWILMDSVMLGCLHNYR-MLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPP 141

Query: 246 WDVILTRI---YNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQ-------VFRIGPHT 295
            ++   ++   Y++    YKGP+D + K    +GI  LYKG  +        V+  G + 
Sbjct: 142 IELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYE 201

Query: 296 ILCLTFLEQT 305
           +L   F E T
Sbjct: 202 LLTRWFRENT 211

>Scas_589.10
          Length = 316

 Score = 77.0 bits (188), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 91/213 (42%), Gaps = 16/213 (7%)

Query: 8   IQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAM 67
           ++K   ++V+   +  AG  A      +  P E+VKIR+Q         Q  Y +P +  
Sbjct: 112 MKKFKLKEVTSTVTLLAGTFAGITESLIVVPFELVKIRLQ-------DAQSDYRSPIRCT 164

Query: 68  GVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESH-KVQSVGI 126
             +  N+G+ G+  G  +        N S  G    +     K F P  +S  K Q +  
Sbjct: 165 RTIIENQGLFGIYAGFESTIWRNTIWNASYFGLIFQV-----KKFIPRAKSTTKFQGIRN 219

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           +   GA +G +   +  P  +VKTR+Q    + K      Y   W  +  IY TEG+KG+
Sbjct: 220 DFLVGAIAGCMSCFLSVPFDVVKTRMQ---GSKKTSSGMCYGWAWQSVFLIYRTEGIKGI 276

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFLLRND 219
           ++GI   I R G G  + L ++N        +D
Sbjct: 277 YKGILPIICRYGPGGGLLLVVFNGVNELFRMSD 309

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 65/286 (22%), Positives = 114/286 (39%), Gaps = 27/286 (9%)

Query: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQ--------GELMAANQRIYTNPFQAMGVVFRN 73
           F +G +A      +  P++VVK R QLQ          +    Q  +++    +  + + 
Sbjct: 17  FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKE 76

Query: 74  EGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAA 133
           EG + L KG+    + ++     +    E  + +M K F   + +  V      + AG  
Sbjct: 77  EGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTV-----TLLAGTF 131

Query: 134 SGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAA 193
           +GI  +++  P  LVK RLQ          Q+ Y       +TI   +G+ G++ G ++ 
Sbjct: 132 AGITESLIVVPFELVKIRLQD--------AQSDYRSPIRCTRTIIENQGLFGIYAGFEST 183

Query: 194 ILRTGAGSSVQLPIYNTAKNFLLR--NDIMEDGPSLHLTASTISGLGVAVVMNPWDVILT 251
           I R    ++    +    K F+ R  +     G         I+G     +  P+DV+ T
Sbjct: 184 IWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKT 243

Query: 252 RIYNQK----GDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
           R+   K    G  Y      +    + EGI  +YKG    + R GP
Sbjct: 244 RMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGP 289

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 14/70 (20%)

Query: 228 HLTASTISGLGVAVVMNPWDVILTRIYNQ--------------KGDLYKGPIDCLVKTVK 273
              +  ++G+   ++M P DV+ TR   Q              K   +   + CL K +K
Sbjct: 16  QFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILK 75

Query: 274 IEGITALYKG 283
            EG   LYKG
Sbjct: 76  EEGFKNLYKG 85

>Scas_691.4
          Length = 334

 Score = 77.0 bits (188), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 82/312 (26%), Positives = 123/312 (39%), Gaps = 33/312 (10%)

Query: 14  QKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQL--QGELMAANQRIYTNPFQAMGVVF 71
           +K S   +  AGG A        +P++ +K+RMQ+  + E M  +  I T        ++
Sbjct: 9   KKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTG-----RNIY 63

Query: 72  RNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAG 131
            +EG   L KGL A  I  I     R   YE  R  +      D+E+  + + G    AG
Sbjct: 64  SHEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALT-----DKETRTI-TTGNTFLAG 117

Query: 132 AASGIIGAVMG-SPLFLVKTRLQ--------------SYSNAIKIGEQTHYTGVWNGLKT 176
             +GI  AV+  +P+ +VK RLQ              S +       +  Y    +   T
Sbjct: 118 VGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYT 177

Query: 177 IYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTA-STIS 235
           I   EG   L+RG+     R          +Y+  K++L +    E  PS   +    IS
Sbjct: 178 IVKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLIS 237

Query: 236 GLGVAVVMNPWDVILTRIYNQKG----DLYKGPIDCLVKTVKIEGITALYKGFEAQVFRI 291
           G        P D I TR+   K       +K       + +K EG  ALYKG   +V R+
Sbjct: 238 GAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRV 297

Query: 292 GPHTILCLTFLE 303
            P   +  T  E
Sbjct: 298 APGQAVTFTVYE 309

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 76.6 bits (187), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 117/288 (40%), Gaps = 15/288 (5%)

Query: 9   QKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMG 68
            K+    V    SF AG LA      +T P E  K R+QL  +   A++    NP   + 
Sbjct: 3   SKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASR----NPLVLIY 58

Query: 69  VVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINV 128
              + +GI  +  G  A  I   A  G R   ++ I+ ++      D E+ ++      V
Sbjct: 59  KTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLR-----DSETGELSGTR-GV 112

Query: 129 FAGAASGIIGAVMG-SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF 187
            AG  +G++ +V   +P   +KT L     +       +  GV     ++   +G  GL+
Sbjct: 113 IAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLY 172

Query: 188 RGIDAAILRTGAGSSVQLPIYNTAKNFLLR-NDIMEDGP---SLHLTASTISGLGVAVVM 243
           RG+    +R  A  +V+L  YN  K  +    D  +D P    L       SG+      
Sbjct: 173 RGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYST 232

Query: 244 NPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRI 291
            P D + TR+ +     Y   ++C     K EG+   +KG   ++ R+
Sbjct: 233 MPLDTVKTRMQSLDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRL 280

>Scas_716.29
          Length = 316

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 144/323 (44%), Gaps = 39/323 (12%)

Query: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQ 65
           D ++K    KVS+  S  AG ++  +A TV  P++ +KIR+QL+           +   +
Sbjct: 12  DHLRKGEDVKVSQ--SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP---SGLLK 66

Query: 66  AM-GVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSV 124
            M G++    G+R   KG V   +  +   G++   Y     +  +T      + ++QS+
Sbjct: 67  MMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGET---SDMNGQLQSL 123

Query: 125 GINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK 184
            +    GA +G+  + +  P  +++TR  + +  + +   +H      G K I+  EG+ 
Sbjct: 124 VV----GALAGMTSSFVSYPTDVLRTRFIA-NQDVALSSLSH------GCKEIWNMEGIP 172

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPS-LHLTASTISGLGVAVVM 243
           G FRG  A++      +S+    Y + K +        D  + L  +AS+ISG+   +V 
Sbjct: 173 GFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVT 232

Query: 244 NPWDVILTRI---------YNQKGDL-------YKGP--IDCLVKTVKIEGITALYKGFE 285
            P D I  RI         +N +  +       YKG   I   +  ++ EG+ +LY+G  
Sbjct: 233 YPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVS 292

Query: 286 AQVFRIGPHTILCLTFLEQTMKL 308
             + +  P T++ L   E  M+L
Sbjct: 293 MSLCKTVPSTVVSLWAYETVMRL 315

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 119/274 (43%), Gaps = 8/274 (2%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELM--AANQRIYTNPFQAMGVVFRNEGIRG 78
           +F  GG++A ++ T   PIE VK+ +Q Q E++   +  R Y            +EG+  
Sbjct: 12  NFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGVIS 71

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIG 138
             +G  A  I           F + I+A+    F  + + +     G N+ +G A+G + 
Sbjct: 72  FWRGNTANVIRYFPTQALNFAFKDKIKAMFG--FRKEVDGYAKWFAG-NLASGGAAGGLS 128

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
            +    L   +TRL + S + K G +  + G+ +  K    ++G+ GL+RG   +++   
Sbjct: 129 LLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIV 188

Query: 199 AGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKG 258
               +   +Y++ K  LL  ++     +  L    ++  G +    P D +  R+    G
Sbjct: 189 VYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAVT-TGASTASYPLDTVRRRMMMTSG 247

Query: 259 DL--YKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
               Y G  D   K V  EG+ +L+KG  A + R
Sbjct: 248 QAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILR 281

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 85/193 (44%), Gaps = 18/193 (9%)

Query: 20  GSFTAGGLAACIAVTVTNPIEVVKIRMQLQGE-LMAANQRIYTNPFQAMGVVFRNEGIRG 78
           G+  +GG A  +++     ++  + R+    +      +R +            ++GI G
Sbjct: 116 GNLASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAG 175

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS--VGINVFAGAASGI 136
           L +G + + +  +   G   G Y+ ++ ++      + ES  + S  +G  V  GA++  
Sbjct: 176 LYRGFLPSVVGIVVYRGLYFGMYDSLKPLL---LTGNLESSFIASFLLGWAVTTGASTA- 231

Query: 137 IGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILR 196
                  PL  V+ R+   S     G+   Y G ++  + I   EGVK LF+G  A ILR
Sbjct: 232 -----SYPLDTVRRRMMMTS-----GQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILR 281

Query: 197 TGAGSSVQLPIYN 209
             AG+ V + +Y+
Sbjct: 282 GVAGAGV-ISLYD 293

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 72/173 (41%), Gaps = 17/173 (9%)

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGE-QTHYTGVWNGLKTIYMTEGVK 184
           IN   G  S  +     +P+  VK  +Q+    +K G     Y G+ +  K    +EGV 
Sbjct: 11  INFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGVI 70

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKN-FLLRNDIMEDGPSLHLTASTISGLGVA--- 240
             +RG  A ++R     ++     +  K  F  R ++  DG +     +  SG G A   
Sbjct: 71  SFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEV--DGYAKWFAGNLASG-GAAGGL 127

Query: 241 --VVMNPWDVILTRI-----YNQKG--DLYKGPIDCLVKTVKIEGITALYKGF 284
             + +   D   TR+       +KG    + G +D   KT+  +GI  LY+GF
Sbjct: 128 SLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

 Score = 34.7 bits (78), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 261 YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQ 304
           Y G +DC  +T   EG+ + ++G  A V R  P   L   F ++
Sbjct: 53  YNGIVDCFKRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDK 96

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 75.9 bits (185), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 124/286 (43%), Gaps = 15/286 (5%)

Query: 11  SAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVV 70
           S +++V    SF AG LA  +  +VT P E  K R+QL  +   A++    NP   +   
Sbjct: 2   SQSKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASR----NPLVLIYNT 57

Query: 71  FRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFA 130
            + +GI  +  G  A  +   A  G R   ++ I+ ++      D ++ ++ S    V A
Sbjct: 58  AKTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLR-----DPKTGEL-SGPRGVIA 111

Query: 131 GAASGIIGAVMG-SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
           G  +G++ +V+  +P   +KT L     +       +  G+      +   +G+ GL+RG
Sbjct: 112 GLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRG 171

Query: 190 IDAAILRTGAGSSVQLPIYNTAKNFLLR-NDIMEDGP---SLHLTASTISGLGVAVVMNP 245
           +    +R  A  +V+L  YN  K  +    +  +D P    L       SG+       P
Sbjct: 172 VLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMP 231

Query: 246 WDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRI 291
            D + TR+ +     Y   I+C     K EG+ A +KG   ++ R+
Sbjct: 232 IDTVKTRMQSLDSKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRL 277

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 87/340 (25%), Positives = 147/340 (43%), Gaps = 50/340 (14%)

Query: 8   IQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQ------------LQG----- 50
           I+  +   V  +  F AGG+       VT P +VVK R+Q            +Q      
Sbjct: 40  IKDDSQPAVKPWVHFVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSST 99

Query: 51  -ELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMN 109
              ++ +   +   F  +G V+R EG R L KGL    +  I         Y   + + +
Sbjct: 100 LHFVSRSLLHFKETFGIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYS 159

Query: 110 KTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTG 169
           +T    QE+       I++ A A +G   + + +P++LVKTRLQ      K G +T Y  
Sbjct: 160 RTLNNGQEAP-----WIHLLAAATAGWATSTVTNPIWLVKTRLQ----LDKAGTKT-YKN 209

Query: 170 VWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHL 229
             + +K++   EGV GL++G+ A+ L +  G  +Q  +Y   K  +    I + G  +H 
Sbjct: 210 SLDCIKSVVKNEGVLGLYKGLSASYLGSVEG-ILQWILYEQMKRIIKERSIEKFG-HIHE 267

Query: 230 TASTIS-------------GLG---VAVVMNPWDVILTRIY---NQKGDL-YKGPIDCLV 269
            A + S             GL     ++V  P +V+ TR+     + G L Y G +    
Sbjct: 268 DAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFR 327

Query: 270 KTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309
             +K EG+ ++Y G    + R  P++I+     E  +KL+
Sbjct: 328 VIIKEEGLVSMYSGLTPHLLRTVPNSIIMFGTWELVIKLL 367

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 126/286 (44%), Gaps = 19/286 (6%)

Query: 13  AQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR 72
           ++KV    SF AG LA  +  ++T P E  K R+QL  +   A++    NP   +    +
Sbjct: 5   SKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASR----NPLVLIYNTAK 60

Query: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGA 132
            +G+  +  G  A  +   A   +R   Y+ IR ++      D+++ ++ S    V AG 
Sbjct: 61  TQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLK-----DKKTGEL-SGPRGVLAGL 114

Query: 133 ASGIIGAVMG-SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGID 191
            +G++ +V+  +P   +KT L     +++   Q +   +     ++   EG +GL+ G+ 
Sbjct: 115 GAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVL 174

Query: 192 AAILRTGAGSSVQLPIYNTAKNFLLRNDIM---EDGP---SLHLTASTISGLGVAVVMNP 245
              +R  A  +V+L  YN  K  +L  D     +D P    L       SG+       P
Sbjct: 175 PVSMRQAANQAVRLGCYNKIK--VLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMP 232

Query: 246 WDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRI 291
            D + TR+ +     Y   ++C     K EG+   +KG   ++ R+
Sbjct: 233 IDTVKTRMQSLTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRL 278

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 123/285 (43%), Gaps = 10/285 (3%)

Query: 11  SAAQKVSKFG-SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELM--AANQRIYTNPFQAM 67
           S  +K S F   F  GG++A ++ T   PIE VK+ +Q Q E++   +  R YT   +  
Sbjct: 2   STDKKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECF 61

Query: 68  GVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN 127
                +EG+    +G  A  I           F + I+A+     +  +E +     G N
Sbjct: 62  KRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMFG---FKKEEGYAKWFAG-N 117

Query: 128 VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF 187
           + +G  +G +  +    L   +TRL + S + K G +  + G+ +  K    ++GV GL+
Sbjct: 118 LASGGLAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLY 177

Query: 188 RGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWD 247
           RG   +++       +   +Y++ K  LL   +     +  L    ++  G +    P D
Sbjct: 178 RGFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAVT-TGASTASYPLD 236

Query: 248 VILTRIYNQKGDL--YKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
            +  R+    G    Y G  D   K V  EGI +L+KG  A + R
Sbjct: 237 TVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILR 281

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 66/139 (47%), Gaps = 17/139 (12%)

Query: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS--VGINVFA 130
           ++G+ GL +G + + +  +   G   G Y+ ++ ++        E+  + S  +G  V  
Sbjct: 170 SDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLL---LTGSLENSFLASFLLGWAVTT 226

Query: 131 GAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGI 190
           GA++         PL  V+ R+   S     G+   Y G ++  + I   EG+K LF+G 
Sbjct: 227 GASTA------SYPLDTVRRRMMMTS-----GQAVKYDGAFDAFRKIVAAEGIKSLFKGC 275

Query: 191 DAAILRTGAGSSVQLPIYN 209
            A ILR  AG+ V + +Y+
Sbjct: 276 GANILRGVAGAGV-ISMYD 293

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 261 YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFESK 315
           Y G ++C  +T   EG+ + ++G  A V R  P   L   F ++ +K +  F+ +
Sbjct: 54  YTGIVECFKRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDK-IKAMFGFKKE 107

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 85/316 (26%), Positives = 138/316 (43%), Gaps = 51/316 (16%)

Query: 35  VTNPIEVVKIRMQL---------QGELMAANQ---RIYTNPFQA----------MGVVFR 72
           VT P ++VK R+Q          Q E +  N    RI     QA          +G V+R
Sbjct: 73  VTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYR 132

Query: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGA 132
            EG R L KGL    +  I         Y   + + +K F   QE+       I++ A A
Sbjct: 133 QEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEA-----PWIHLMAAA 187

Query: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDA 192
            +G   A   +P+++VKTR+Q      K G+   Y   ++ LK+I   EG+ GL+RG+ A
Sbjct: 188 TAGWATATATNPIWMVKTRVQ----LDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSA 243

Query: 193 AILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTIS----------GLGVA-- 240
           + L +  G  +Q  +Y   K+ + +  I + G     T +T            G G+A  
Sbjct: 244 SYLGSVEGI-LQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKF 302

Query: 241 ---VVMNPWDVILTRIYN---QKGDL-YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
              +V  P +V+ TR+     + G + Y G +      +K EG+ ++Y G    + R  P
Sbjct: 303 MASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVP 362

Query: 294 HTILCLTFLEQTMKLV 309
           ++I+     E  +KL+
Sbjct: 363 NSIIMFGTWEVVIKLL 378

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 91/210 (43%), Gaps = 25/210 (11%)

Query: 102 EPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQS--YSNAI 159
           +P+    +K   P  E HK     ++  AG   G+ GAV+  P  LVKTRLQS  Y N  
Sbjct: 34  QPVILEDSKIVQPKLEVHKTVKPWVHFLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMY 93

Query: 160 K-------------------IGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAG 200
           K                   +   TH+    + +  +Y  EG + LF+G+   ++     
Sbjct: 94  KSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPA 153

Query: 201 SSVQLPIYNTAKNFLLRN-DIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKG- 258
            S+    Y T K+   +  +  ++ P +HL A+  +G   A   NP  ++ TR+   K  
Sbjct: 154 RSINFFTYGTTKDIYSKAFNNGQEAPWIHLMAAATAGWATATATNPIWMVKTRVQLDKAG 213

Query: 259 --DLYKGPIDCLVKTVKIEGITALYKGFEA 286
               YK   DCL   ++ EGI  LY+G  A
Sbjct: 214 KTRTYKNSYDCLKSILRNEGIYGLYRGLSA 243

>Scas_669.6
          Length = 373

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 96/214 (44%), Gaps = 37/214 (17%)

Query: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN--------- 73
           +AG L   ++  V  P EV+K R+QLQG +         NPF   G  +R+         
Sbjct: 151 SAGLLGDFVSSFVYVPSEVLKTRLQLQGRV--------NNPFFQSGYNYRSLRTAIRIIV 202

Query: 74  --EGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAG 131
             EG++ L  G  A     +  +  + GFYE  R    K    D   H + S+   +F G
Sbjct: 203 NTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNL-SIPNEIFTG 261

Query: 132 AASGIIGAVMGSPLFLVKTRLQSY------SNAIKIGEQTHYT-----------GVWNGL 174
           A +G +  ++ +P+ ++KTRLQ+       ++A  +G  +  T            ++  L
Sbjct: 262 AIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSL 321

Query: 175 KTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIY 208
           K +Y +EGV G F G+    + T   SS+ L +Y
Sbjct: 322 KLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLY 355

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 96/231 (41%), Gaps = 22/231 (9%)

Query: 39  IEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGI-RGLQKGLVAAYIYQIALNGSR 97
           ++ VK R Q  G  M      Y N   A   +F  EGI RGL  G  AA +         
Sbjct: 72  LDTVKTRQQ--GAPMTPK---YKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIF 126

Query: 98  LGFYEPI-RAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYS 156
            G YE   R ++    + D  SH        + AG     + + +  P  ++KTRLQ   
Sbjct: 127 FGTYEWCKRKMIGDLGFNDTVSH--------LSAGLLGDFVSSFVYVPSEVLKTRLQLQG 178

Query: 157 NAIKIGEQT--HYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNF 214
                  Q+  +Y  +   ++ I  TEGVK LF G  A + R    S++Q   Y   +  
Sbjct: 179 RVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQT 238

Query: 215 ---LLRNDIMEDGPSL--HLTASTISGLGVAVVMNPWDVILTRIYNQKGDL 260
              L + DI +   S+   +    I+G    ++  P DVI TR+  Q+ D+
Sbjct: 239 AFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADI 289

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 78/178 (43%), Gaps = 17/178 (9%)

Query: 148 VKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGV-KGLFRGIDAAILRTGAGSSVQLP 206
           VKTR Q      K      Y  +    +TI++ EG+ +GL+ G  AA+L +   +++   
Sbjct: 75  VKTRQQGAPMTPK------YKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFG 128

Query: 207 IYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRI---------YNQK 257
            Y   K  ++ +    D  S HL+A  +     + V  P +V+ TR+         + Q 
Sbjct: 129 TYEWCKRKMIGDLGFNDTVS-HLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQS 187

Query: 258 GDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFESK 315
           G  Y+     +   V  EG+ AL+ G++A + R  P + L   F E+  +     E K
Sbjct: 188 GYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKK 245

>Kwal_26.7967
          Length = 297

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/309 (21%), Positives = 129/309 (41%), Gaps = 21/309 (6%)

Query: 11  SAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVV 70
           S  ++V    SF AG LA  +  ++T P E  K R+QL  +   A++    NP   + ++
Sbjct: 2   SQKKQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASR----NP---LTLI 54

Query: 71  FRNEGIRGLQK---GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN 127
           +R   ++GL     G  A  +   A  G R   ++ I+ ++      +    +       
Sbjct: 55  YRTAKVQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTGELSGPR------G 108

Query: 128 VFAGAASGIIGAVMG-SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           + AG  +G++ +V+  +P   +KT L     +       +  G+     ++   +G  GL
Sbjct: 109 IVAGLGAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGL 168

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFLLR-NDIMEDGP---SLHLTASTISGLGVAVV 242
           +RG+    +R  A  +V+L  YN  K  +    +  +D P    +       SG+     
Sbjct: 169 YRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYT 228

Query: 243 MNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFL 302
             P D + TR+ +     Y   I+C     + EG+   +KG   ++ R+     +  T  
Sbjct: 229 TMPIDTVKTRMQSLDSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIY 288

Query: 303 EQTMKLVHA 311
           E+ + ++ A
Sbjct: 289 EKVLVVLGA 297

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 42/104 (40%), Gaps = 6/104 (5%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
           +D    +  + +S   +F  G  +  + V  T PI+ VK RMQ      + +   Y++  
Sbjct: 198 QDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQ------SLDSSKYSSTI 251

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVM 108
                VFR EG++   KG        I   G     YE +  V+
Sbjct: 252 NCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLVVL 295

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 72.8 bits (177), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 131/306 (42%), Gaps = 40/306 (13%)

Query: 36  TNPIEVVKIRMQ-------LQGELMAANQRIYTNPF---QAMGV---VFRNEGIRGLQKG 82
           T P +VVK R+Q        + +  A    +Y       + +G+   V+  EG R L KG
Sbjct: 67  TCPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKG 126

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMG 142
           L    +  I         Y   +   ++     QE     +  I+  AGA +G   +   
Sbjct: 127 LGPNLVGVIPARSINFFTYGVTKDTASRLLNDGQE-----APWIHFLAGATAGWATSTAT 181

Query: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           +P++LVKTRLQ    A   G    Y   W+ LK +   EG+ GL++G+ A+ L +   S 
Sbjct: 182 NPIWLVKTRLQLDKAA--DGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGS-VESI 238

Query: 203 VQLPIYNTAKNFLLRN------DIMEDGPSLHLT---------ASTISGLGVAVVMNPWD 247
           +Q  +Y   K+ + +       DI E+  + ++          ++  + L  +++  P +
Sbjct: 239 LQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHE 298

Query: 248 VILTRIYN---QKGDL-YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLE 303
           V+ TR+     + G L Y G        +K EG  ++Y G    + R  P++I+     E
Sbjct: 299 VVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGTWE 358

Query: 304 QTMKLV 309
             +KL+
Sbjct: 359 LVIKLL 364

 Score = 69.7 bits (169), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 90/186 (48%), Gaps = 16/186 (8%)

Query: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK 81
           F AG  A     T TNPI +VK R+QL       ++R Y N +  +  V RNEGI GL K
Sbjct: 167 FLAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRR-YKNSWDCLKGVMRNEGILGLYK 225

Query: 82  GLVAAYIYQIALNGSRLGFYEPIRAVMNK----TFYPDQESHKVQSVGINVF------AG 131
           GL A+Y+  +  +  +   YE ++ ++ +     F    E +K   + +  +      AG
Sbjct: 226 GLSASYLGSVE-SILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAG 284

Query: 132 AASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGID 191
           AA  +  +++  P  +V+TRL+    A K   +  YTG++     I   EG   ++ G+ 
Sbjct: 285 AAK-LFASILTYPHEVVRTRLR---QAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLT 340

Query: 192 AAILRT 197
             ++RT
Sbjct: 341 PHLMRT 346

>Kwal_27.12081
          Length = 369

 Score = 72.8 bits (177), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 83/343 (24%), Positives = 144/343 (41%), Gaps = 50/343 (14%)

Query: 3   KGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQ------------- 49
           KG  ++   +A+ V  +  F AGG        VT P +VVK R+Q               
Sbjct: 38  KGSKQVSSVSAE-VKPWVHFVAGGAGGMAGAIVTCPFDVVKTRLQSDVFQSTYANLSHNK 96

Query: 50  -GELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVM 108
              ++++  R +   F  +  +++ EG R L KGL    +  I         Y   + + 
Sbjct: 97  SSNVVSSGIRHFRETFGIISNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKQIY 156

Query: 109 NKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYT 168
           ++ F   +E     +  I++ + A +G   +   +P++L+KTRLQ      K G    Y 
Sbjct: 157 SRAFNNGEE-----APWIHLISAATAGWATSTATNPIWLIKTRLQ----LDKAGHTRQYK 207

Query: 169 GVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLH 228
             W+ LK I   EG  GL++G+ A+ L +  G  +Q  +Y   K  +    I + G   H
Sbjct: 208 NSWDCLKHIIQKEGFFGLYKGLSASYLGSVEG-ILQWLLYEQMKQMIKMRSIEKFG---H 263

Query: 229 LTA---------------STISGLG---VAVVMNPWDVILTRIYN---QKGDL-YKGPID 266
           ++                S  +GL     ++V  P +V+ TR+     +   L Y G I 
Sbjct: 264 ISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQ 323

Query: 267 CLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309
                +K EG+ ++Y G    + R  P++I+     E  +KL+
Sbjct: 324 SFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWELVIKLL 366

 Score = 65.9 bits (159), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 94/213 (44%), Gaps = 25/213 (11%)

Query: 98  LGFYEPIRAVMNKTFYPDQESHKVQSVG------INVFAGAASGIIGAVMGSPLFLVKTR 151
           LG  E    + N  F P + S +V SV       ++  AG A G+ GA++  P  +VKTR
Sbjct: 20  LGSDEDASNLKNPRFTPRKGSKQVSSVSAEVKPWVHFVAGGAGGMAGAIVTCPFDVVKTR 79

Query: 152 LQS--------------YSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
           LQS               SN +  G + H+   +  +  +Y  EG + LF+G+   ++  
Sbjct: 80  LQSDVFQSTYANLSHNKSSNVVSSGIR-HFRETFGIISNLYKLEGFRSLFKGLGPNLVGV 138

Query: 198 GAGSSVQLPIYNTAKNFLLRN-DIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQ 256
               S+    Y T K    R  +  E+ P +HL ++  +G   +   NP  +I TR+   
Sbjct: 139 IPARSINFFTYGTTKQIYSRAFNNGEEAPWIHLISAATAGWATSTATNPIWLIKTRLQLD 198

Query: 257 KG---DLYKGPIDCLVKTVKIEGITALYKGFEA 286
           K      YK   DCL   ++ EG   LYKG  A
Sbjct: 199 KAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSA 231

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 72.4 bits (176), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 90/211 (42%), Gaps = 25/211 (11%)

Query: 16  VSKFGSFTAG-GLAACIAVTVTNPIEVVKIRMQLQGELMAANQRI----YTNPFQAMGVV 70
           VS   +F AG G     AV V NP+EVVKIR+Q Q   +  N  +    YTN  QA   +
Sbjct: 135 VSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQH--LNPNHDLAKPKYTNAVQAGYTI 192

Query: 71  FRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGI--NV 128
            + EGI  L +G+      Q    G+    Y  +R  +       QE H  +++      
Sbjct: 193 IKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFL-------QEYHGTETLPSWETS 245

Query: 129 FAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTI----YMTEGVK 184
             G  SG IG    +PL  +KTRLQ   +    GE       W  +  I       EG +
Sbjct: 246 CIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESG-----WKRIAHIGTQLLKEEGFR 300

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
            L++GI   ++R   G +V   +Y   +  L
Sbjct: 301 ALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 331

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 117/318 (36%), Gaps = 41/318 (12%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGE-------------------------LMAA 55
           +  AGG A        +P++ +K+RMQ+                               A
Sbjct: 14  NLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDA 73

Query: 56  NQRIYTNPFQAMGV-VFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYP 114
              I    F   G  ++  EG   L KGL A  I  I     R   YE       +T   
Sbjct: 74  TAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLA 128

Query: 115 DQESHKVQSVGINVFAGAASGIIGAVMG-SPLFLVKTRLQS-YSNAIKIGEQTHYTGVWN 172
           D+++  V S      AG  +G+  AV+  +P+ +VK RLQ+ + N      +  YT    
Sbjct: 129 DKQT-GVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQ 187

Query: 173 GLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTA- 231
              TI   EG+  L+RG+     R          +Y+  + FL      E  PS   +  
Sbjct: 188 AGYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCI 247

Query: 232 STISGLGVAVVMNPWDVILTRIYNQKGDLYKGP------IDCLVKTVKIEGITALYKGFE 285
             ISG        P D I TR+   K   +KG            + +K EG  ALYKG  
Sbjct: 248 GLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGIT 307

Query: 286 AQVFRIGPHTILCLTFLE 303
            +V R+ P   +  T  E
Sbjct: 308 PRVMRVAPGQAVTFTVYE 325

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 72.4 bits (176), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 94/205 (45%), Gaps = 20/205 (9%)

Query: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGEL---MAANQRIYTNPFQAMGVVFRNEGIRG 78
            +AG L   I+  V  P EV+K R+QLQG        +   Y+N   A+  V + EG R 
Sbjct: 152 LSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRS 211

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIG 138
           L  G  A     +  +  +  FYE  R +  K    D    ++ S+   +  GA +G + 
Sbjct: 212 LFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGEL-SIPNEILTGACAGGLA 270

Query: 139 AVMGSPLFLVKTRLQSY---SNAIKIGEQTHYTGVWNG------------LKTIYMTEGV 183
            ++ +P+ +VKTR+Q+    S + K    TH   V NG            L+T+Y +EGV
Sbjct: 271 GIITTPMDVVKTRVQTQQPPSQSNKSYSVTH-PHVTNGRPAALSNSISLSLRTVYQSEGV 329

Query: 184 KGLFRGIDAAILRTGAGSSVQLPIY 208
            G F G+    + T   SS+ L +Y
Sbjct: 330 LGFFSGVGPRFVWTSVQSSIMLLLY 354

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 89/198 (44%), Gaps = 17/198 (8%)

Query: 128 VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK-GL 186
           V +G   G IG      L  VKTR Q   N  K      Y  + +  +TI++ EGV+ GL
Sbjct: 57  VVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKK------YRNMISAYRTIWLEEGVRRGL 110

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPW 246
           + G  AA+L +   +++    Y   K  ++ +  + D  + HL+A  +     + V  P 
Sbjct: 111 YGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTIT-HLSAGFLGDFISSFVYVPS 169

Query: 247 DVILTRI---------YNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTIL 297
           +V+ TR+         + Q G  Y    + +   +K EG  +L+ G++A + R  P + L
Sbjct: 170 EVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSAL 229

Query: 298 CLTFLEQTMKLVHAFESK 315
              F E+  +L    E K
Sbjct: 230 QFAFYEKFRQLAFKIEQK 247

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 71.6 bits (174), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 82/321 (25%), Positives = 131/321 (40%), Gaps = 45/321 (14%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
           E+  Q   A+ V    + TAGG+A    V V  P +  K+R+Q             + P 
Sbjct: 15  EEHPQHDNARVVKDLLAGTAGGIAQ---VLVGQPFDTTKVRLQTS-----------STPT 60

Query: 65  QAMGVVFR---NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKV 121
            AM VV +   NEG RG  KG +   I   A    + G  E +     K F+  + +   
Sbjct: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAM-----KRFFHHRNADMS 115

Query: 122 QSVGINVF--AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYM 179
            ++ +  +   G   GI+ + + SP+  V+ RLQ+ + +   G    + G    +K +  
Sbjct: 116 STLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGS---GTNAEFKGPLECIKKLRH 172

Query: 180 TEGVKGLFRGIDAAILRTGAGSSVQLPIYN-------TAKNFLLRNDIMEDGPSLHLTA- 231
               K L RG+   ILR G G      +Y          +  L R DI    P+  L   
Sbjct: 173 N---KALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDI----PAWKLCIF 225

Query: 232 STISGLGVAVVMNPWDVI--LTRIYNQKGDLYKGPIDCLVKTVKIEG-ITALYKGFEAQV 288
             +SG  + +++ P DVI  + +  N +   +   I  + KT+   G I A +KGF   +
Sbjct: 226 GALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285

Query: 289 FRIGPHTILCLTFLEQTMKLV 309
            R  P         E  M+L+
Sbjct: 286 LRAAPANGATFATFELAMRLL 306

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 129/327 (39%), Gaps = 52/327 (15%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
           +D ++K   ++VS   S  AG L+   A T   P++ VKI++Q+      AN  I     
Sbjct: 4   KDHLRKD--EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLIN---- 57

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPI----RAVMNKTFYPDQESHK 120
                + + EGIRG  KG V   I  I   G++ G Y  I    R  ++    P   S  
Sbjct: 58  -----ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYS-- 110

Query: 121 VQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMT 180
                     G+ +G+  ++   P  +++TR  + S    I  +     +W+        
Sbjct: 111 -------CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWS-------H 156

Query: 181 EGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPS----LHLTASTISG 236
           EG+ G F G  ++++  G  +++   +Y + K F      + D       L+  A  ISG
Sbjct: 157 EGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISG 216

Query: 237 LGVAVVMNPWDVILTRIYNQKG------------DLYKGP-----IDCLVKTVKIEGITA 279
               +   P D +  RI  +              D+YK       +   +  V+ EG  +
Sbjct: 217 FTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLS 276

Query: 280 LYKGFEAQVFRIGPHTILCLTFLEQTM 306
           LY+G    + +  P T + L   E  M
Sbjct: 277 LYRGVTMSLIKSVPSTAISLWSYELFM 303

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 115/287 (40%), Gaps = 16/287 (5%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           AGG A  +     +P++ +K+RMQ+    + +  +      +  G ++RNEG     KGL
Sbjct: 16  AGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKA-PGFIKTGGEIYRNEGFLAFYKGL 74

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
            A  I        R   YE  R     T   D+E+ KV S G    AG  +GI  AV+  
Sbjct: 75  GAVVIGITPKMAIRFSSYEFYR-----TLLADKETGKV-STGNTFIAGVGAGITEAVVVV 128

Query: 144 PLFLV-KTRLQS-YSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201
               V K RLQ+ + N ++   +  Y        TI   EG   L+RG+     R     
Sbjct: 129 NPMEVVKIRLQAQHLNPVEGAPK--YKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186

Query: 202 SVQLPIYNTAKNFLLRNDIMEDGPSLHLTA-STISGLGVAVVMNPWDVILTRIYNQKGDL 260
                +Y+  K FL      E  PS   +    ISG        P D I TR+   K   
Sbjct: 187 GANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTK 246

Query: 261 YKGPIDCLV----KTVKIEGITALYKGFEAQVFRIGPHTILCLTFLE 303
               +  +     + ++ EG  ALYKG   +V R+ P   +  T  E
Sbjct: 247 NMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 89/215 (41%), Gaps = 22/215 (10%)

Query: 15  KVSKFGSFTAG-GLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN 73
           KVS   +F AG G     AV V NP+EVVKIR+Q Q          Y N  QA   + + 
Sbjct: 106 KVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKE 165

Query: 74  EGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVM----NKTFYPDQESHKVQSVGINVF 129
           EG   L +G+      Q    G+    Y  ++  +    N+   P  E+  +        
Sbjct: 166 EGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLI-------- 217

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
            G  SG IG    +PL  +KTRLQ   +   +      T +    K +   EG + L++G
Sbjct: 218 -GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIG---KQLIQEEGFRALYKG 273

Query: 190 IDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDG 224
           I   ++R   G +V    Y       +R ++ + G
Sbjct: 274 ITPRVMRVAPGQAVTFTAYE-----FIRKELEKTG 303

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 72/176 (40%), Gaps = 17/176 (9%)

Query: 119 HKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIY 178
            K  +  +N+ AG  +G++  +   PL  +K R+Q Y NA  +G      G       IY
Sbjct: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNA--VGSGVKAPGFIKTGGEIY 62

Query: 179 MTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLG 238
             EG    ++G+ A ++      +++   Y   +  L   +  +    +    + I+G+G
Sbjct: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGK----VSTGNTFIAGVG 118

Query: 239 VAVV---MNPWDVILTRIYNQKGDL--------YKGPIDCLVKTVKIEGITALYKG 283
             +    +    + + +I  Q   L        YK  +      VK EG +ALY+G
Sbjct: 119 AGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRG 174

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 125/275 (45%), Gaps = 26/275 (9%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGI-RGLQKGL 83
           G +A  I   +  P + VK+R+Q Q         +Y   +  +   + +EGI +G  +G 
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQTQ------PAHLYPTTWSCIRSTYTDEGIWKGFYQG- 66

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
           +A+ ++  AL  + L       +    T + D E  +++ +   +++GA +G   + + +
Sbjct: 67  IASPLFGAALENAVL-----FVSFNQCTNFLD-EFTQLKPLTKTIYSGAFAGACASFILT 120

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
           P+ LVK +LQ  + +  + + T +T VW  +K++   +G+ GL++G  +  +R   G +V
Sbjct: 121 PVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAV 180

Query: 204 QLPIYNTAK-NFLLRNDIMEDGPSLHLTASTISGLGVAVVMN----PWDVILTRIYNQKG 258
               Y   K  F   +   ++  +  L    +SG    V+ N    P D + +    +  
Sbjct: 181 WFTTYEIMKMKFASLHPAEKENHTWEL---LVSGASAGVLFNASVFPADTVKSVCQTEHV 237

Query: 259 DLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
            +    ++ L K ++  GIT  Y+G    + R  P
Sbjct: 238 SI----VNALKKVLRTHGITGFYRGLGITLIRAAP 268

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 85/193 (44%), Gaps = 16/193 (8%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRI-YTNPFQAMGVVFRNEGIRGLQKG 82
           +G  A   A  +  P+E+VK ++Q+     + +Q   +T+ +  +  V + +G+ GL +G
Sbjct: 107 SGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQG 166

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMG 142
            ++ ++ +          YE ++         ++E+H  + +     +GA++G++     
Sbjct: 167 QLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELL----VSGASAGVLFNASV 222

Query: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
            P           ++ +K   QT +  + N LK +  T G+ G +RG+   ++R    ++
Sbjct: 223 FP-----------ADTVKSVCQTEHVSIVNALKKVLRTHGITGFYRGLGITLIRAAPANA 271

Query: 203 VQLPIYNTAKNFL 215
                Y T K   
Sbjct: 272 TVFYTYETLKKMF 284

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 68.6 bits (166), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 95/222 (42%), Gaps = 30/222 (13%)

Query: 116 QESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSY-------------SNAIKIG 162
           +E        I   +GA +G +  V+  PL + KTRLQ+              S A   G
Sbjct: 95  REEGHFNDTEITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFG 154

Query: 163 EQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAK----NFLLRN 218
            + +Y+G+W  L TI   E ++GL++GI   +L       +   +Y   K     +   +
Sbjct: 155 GK-YYSGIWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNS 213

Query: 219 DIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGD------LYKGPIDCLVKTV 272
           + +    S  LTA  IS      + NP  V+ TR+  Q G        YK  +D  +K  
Sbjct: 214 EFLSHSMSA-LTAGAIS----TTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIY 268

Query: 273 KIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFES 314
           K+EGI + Y G    +F +  H  +     E+  K++H + S
Sbjct: 269 KVEGIKSFYSGLIPSLFGL-LHVAIHFPVYEKLKKVLHCYPS 309

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 78/316 (24%), Positives = 129/316 (40%), Gaps = 48/316 (15%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQG-ELMAANQR------------IYTNPFQAMGVV 70
           +G LA  +A  +  P++V K R+Q QG +L     R             Y+  +  +  +
Sbjct: 109 SGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTTI 168

Query: 71  FRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQ-ESHKVQSVGINVF 129
            R+E IRGL KG+V   +            YE  +    + F   +  SH + ++     
Sbjct: 169 VRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSAL----- 223

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
               +G I   + +P+++VKTRL   S    I   THY    +    IY  EG+K  + G
Sbjct: 224 ---TAGAISTTLTNPIWVVKTRLMLQSGK-NIKGMTHYKNTLDAFIKIYKVEGIKSFYSG 279

Query: 190 IDAAILRTGAGSSVQLPIYNTAKNFLL--------RNDIMEDGPS-LHLTASTISGLGVA 240
           +  ++       ++  P+Y   K  L         +  +  +G S    T ST   LG  
Sbjct: 280 LIPSLFGL-LHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRL 338

Query: 241 VVMN------------PWDVILTRIYNQKGDLYKGPIDCLVKTVKI-EGITALYKGFEAQ 287
           +V +            P +++ TR+   K D+ K  I  +++T    EGI   Y GF   
Sbjct: 339 IVASCGSKMIASTLTYPHEILRTRL-QLKSDM-KPSIKSIIRTTYAKEGIRGFYSGFLTN 396

Query: 288 VFRIGPHTILCLTFLE 303
           +FR  P + + L   E
Sbjct: 397 MFRTVPASAITLVSFE 412

 Score = 66.2 bits (160), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 104/225 (46%), Gaps = 30/225 (13%)

Query: 17  SKFGSFTAGGLAA-CIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEG 75
           S+F S +   L A  I+ T+TNPI VVK R+ LQ          Y N   A   +++ EG
Sbjct: 213 SEFLSHSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEG 272

Query: 76  IRGLQKGLVAAY--IYQIALNGSRLGFYEPIRAVMN--KTFYPDQESHKV------QSVG 125
           I+    GL+ +   +  +A++      YE ++ V++   +  P+QE+  V      Q+ G
Sbjct: 273 IKSFYSGLIPSLFGLLHVAIH---FPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTG 329

Query: 126 INVF-------AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIY 178
              F       A   S +I + +  P  +++TRLQ  S+            + + ++T Y
Sbjct: 330 STNFQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKSDM--------KPSIKSIIRTTY 381

Query: 179 MTEGVKGLFRGIDAAILRTGAGSSVQLPIYNT-AKNFLLRNDIME 222
             EG++G + G    + RT   S++ L  +    K+F L ND +E
Sbjct: 382 AKEGIRGFYSGFLTNMFRTVPASAITLVSFEYFRKHFKLWNDSIE 426

>Kwal_55.21335
          Length = 317

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 121/271 (44%), Gaps = 22/271 (8%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEG-IRGLQKGL 83
           G +A      +  P++ +K+R+Q Q         ++   +  +   ++ EG ++G  +G 
Sbjct: 52  GSIAGAAGKVIEYPLDTIKVRLQTQPA------HVFPTSWSCIKYTYQKEGFVKGFYQG- 104

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
           VA+ +   AL  + L F    RA   + F    ES  V  +   V +GA +G   + + +
Sbjct: 105 VASPLVGAALENAVL-FVTFNRA---QNFLQQYES--VSPLSQTVLSGAFAGACTSYVLT 158

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
           P+ L+K  LQ  SN    G  T ++ +W  +K I   +G+ GL++G  +  +R  AG +V
Sbjct: 159 PVELIKCTLQ-VSNLE--GATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAV 215

Query: 204 QLPIYNTAKNFLLRNDIMEDGPSLHLTASTIS-GLGVAVVMNPWDVILTRIYNQKGDLYK 262
               Y + K++L R     +  +  L AS  S G+     + P D I +    Q    + 
Sbjct: 216 WFTTYESLKSYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQ----HL 271

Query: 263 GPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
           G +D   + +   G   LY+G    + R  P
Sbjct: 272 GIVDATKRILARSGPAGLYRGLGITLIRAAP 302

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 85/191 (44%), Gaps = 18/191 (9%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G  A      V  P+E++K  +Q+   L  A  R ++  +  +  + +++GI GL +G 
Sbjct: 145 SGAFAGACTSYVLTPVELIKCTLQV-SNLEGATTR-HSKIWPTVKHIVQHKGIGGLWQGQ 202

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
            + +I + A        YE +++ + +    D E+H  + +     +GA++G+      +
Sbjct: 203 SSTFIRECAGGAVWFTTYESLKSYLARR-RNDTENHTWELLA----SGASAGV---AFNA 254

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
            +F   T        IK   QT + G+ +  K I    G  GL+RG+   ++R    +++
Sbjct: 255 SIFPADT--------IKSTAQTQHLGIVDATKRILARSGPAGLYRGLGITLIRAAPANAI 306

Query: 204 QLPIYNTAKNF 214
               Y T  N 
Sbjct: 307 VFYTYETLSNL 317

>Scas_667.22
          Length = 306

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/317 (24%), Positives = 131/317 (41%), Gaps = 38/317 (11%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
           E+  +   A+ +    + TAGG+A    V V  P +  K+R+Q             + P 
Sbjct: 15  ENHPKHDNARVIKDLLAGTAGGIAQ---VLVGQPFDTTKVRLQTS-----------STPT 60

Query: 65  QAMGVV---FRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKV 121
            AM V+    +NEG +G  KG +   I   A    + G  E ++   +    PD  S ++
Sbjct: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSR-NPDSTS-QI 118

Query: 122 QSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTE 181
            S+      G   GI  + + SP+  V+ RLQ+ + +   G    + G    L  I    
Sbjct: 119 LSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGS---GPNVEFKGP---LDCIRKLR 172

Query: 182 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIME-----DGPSLHLTA-STIS 235
              G  RG+   +LR G G      +Y      ++ N+I +     + P+  L     +S
Sbjct: 173 AQGGFMRGLTPTMLREGHGCGTYFLVYEA----MVANEINKGFKRTEVPAWKLCLFGALS 228

Query: 236 GLGVAVVMNPWDVI--LTRIYNQKGDLYKGPIDCLVKTVKIEG-ITALYKGFEAQVFRIG 292
           G  + +++ P DVI  + +  N K   Y   I  + KT+  +G + A +KGF   + R  
Sbjct: 229 GTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAA 288

Query: 293 PHTILCLTFLEQTMKLV 309
           P         E  M+L+
Sbjct: 289 PANGATFATFELAMRLL 305

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 104/249 (41%), Gaps = 32/249 (12%)

Query: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIR-GLQ 80
           F AGG+   I  +  + ++ VK R Q      A N   Y +  QA   +F  EG R GL 
Sbjct: 57  FLAGGVGGIIGDSAMHSLDTVKTRQQ-----GAPNVHKYKHMLQAYRTMFIEEGFRRGLY 111

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140
            G  AA +            YE  +  M   ++ +           + F+   +G +G  
Sbjct: 112 GGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLN-----------DTFSHLTAGFLGDF 160

Query: 141 MGS----PLFLVKTRLQ---SYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAA 193
             S    P  ++KTRLQ    Y+N        +Y  + N + TIY TEGV  LF G  A 
Sbjct: 161 FSSFVYVPSEVLKTRLQLQGCYNNP-HFNSGYNYKSLRNAIATIYRTEGVAALFFGYKAT 219

Query: 194 ILRTGAGSSVQLPIYNTAKN--FLLR-NDIMEDGPSLH---LTASTISGLGVAVVMNPWD 247
           + R    S++Q   Y   +   FLL   DI +   S+    +T +   GL   ++  P D
Sbjct: 220 LARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLA-GILTTPLD 278

Query: 248 VILTRIYNQ 256
           V+ TR+  Q
Sbjct: 279 VVKTRVQTQ 287

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 90/215 (41%), Gaps = 31/215 (14%)

Query: 19  FGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF-----------QAM 67
           F   TAG L    +  V  P EV+K R+QLQG         Y NP             A+
Sbjct: 149 FSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQG--------CYNNPHFNSGYNYKSLRNAI 200

Query: 68  GVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN 127
             ++R EG+  L  G  A     +  +  +  FYE  R         D   H + S+   
Sbjct: 201 ATIYRTEGVAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDL-SISNE 259

Query: 128 VFAGAASGIIGAVMGSPLFLVKTRLQS-YSNAIKIGEQTHYTGV----------WNGLKT 176
           +  GA +G +  ++ +PL +VKTR+Q+   + I I   T    V          +  L+T
Sbjct: 260 IVTGACAGGLAGILTTPLDVVKTRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRT 319

Query: 177 IYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTA 211
           +Y +EG  G F G+    + T   SS+ L +Y  A
Sbjct: 320 VYTSEGFFGFFSGVGPRFVWTSVQSSIMLLLYQMA 354

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 87/196 (44%), Gaps = 17/196 (8%)

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK-GLFR 188
           AG   GIIG      L  VKTR Q   N  K      Y  +    +T+++ EG + GL+ 
Sbjct: 59  AGGVGGIIGDSAMHSLDTVKTRQQGAPNVHK------YKHMLQAYRTMFIEEGFRRGLYG 112

Query: 189 GIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDV 248
           G  AA+L +   +++    Y   K  ++ +  + D  S HLTA  +     + V  P +V
Sbjct: 113 GYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFS-HLTAGFLGDFFSSFVYVPSEV 171

Query: 249 ILTRI-----YNQ----KGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCL 299
           + TR+     YN      G  YK   + +    + EG+ AL+ G++A + R  P + L  
Sbjct: 172 LKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFSALQF 231

Query: 300 TFLEQTMKLVHAFESK 315
            F E+  +     E K
Sbjct: 232 AFYEKFRQWAFLLEGK 247

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 136/302 (45%), Gaps = 39/302 (12%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQ----------RIYTNPFQAMGVVFRN 73
           +G  A  I    T+P+++VK+R+QL    +A N+          RI  +  Q     F  
Sbjct: 14  SGLTAGTITTVSTHPLDLVKVRLQL----LATNKKPQGYYDVVKRIVKDSKQHS---FFR 66

Query: 74  EGIRGLQKGL----VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF 129
           E  RGL   L    VA  +Y      S+   ++     + K F     + K  +  + + 
Sbjct: 67  ETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDV-KRFNNTMNNDKEMTSLMYLL 125

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
           A A SG+  +V+ +P++++KTR+ S S      +   Y    +G+K +Y  EG+ G +RG
Sbjct: 126 AAAMSGVATSVLTNPIWVIKTRIMSTS----FVDSRSYRSTVDGIKKLYRIEGLAGFWRG 181

Query: 190 IDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSL----HLTASTISGLGVAVVMNP 245
           +  ++     G ++   +Y+T K        ++    L    ++T +++S +     + P
Sbjct: 182 LVPSLFGVSQG-AIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYP 240

Query: 246 WDVILTRIYNQKGDLYKGP-----IDCLVKTVKI-EGITALYKGFEAQVFRIGPHTILCL 299
             ++ + + + +      P     +  L+ T+ + +G+T LYKG  A + R  P T  C+
Sbjct: 241 LQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPST--CI 298

Query: 300 TF 301
           TF
Sbjct: 299 TF 300

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 91/192 (47%), Gaps = 7/192 (3%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           A  ++      +TNPI V+K R+         + R Y +    +  ++R EG+ G  +GL
Sbjct: 126 AAAMSGVATSVLTNPIWVIKTRIM---STSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGL 182

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
           V + ++ ++        Y+ ++       + D++        I +   + S ++      
Sbjct: 183 VPS-LFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITI--TSLSKMVSVTAVY 239

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
           PL L+K+ LQS+  +  I  +T +  VW  + TIY+ +GV GL++G+ A ++R    + +
Sbjct: 240 PLQLLKSNLQSFEVSTVINPKTSHR-VWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCI 298

Query: 204 QLPIYNTAKNFL 215
              +Y   +++L
Sbjct: 299 TFCVYENFRHWL 310

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 88/202 (43%), Gaps = 21/202 (10%)

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
           +G  +G I  V   PL LVK RLQ  +   K   Q +Y  V   +K        +  +RG
Sbjct: 14  SGLTAGTITTVSTHPLDLVKVRLQLLATNKK--PQGYYDVVKRIVKDSKQHSFFRETYRG 71

Query: 190 IDAAILRTGAGSSVQLPIYNTAKNFLLR---------NDIMEDGPS----LHLTASTISG 236
           +   +L       +   +Y  +K+++ +         N+ M +       ++L A+ +SG
Sbjct: 72  LGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAAMSG 131

Query: 237 LGVAVVMNPWDVILTRIYNQ---KGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
           +  +V+ NP  VI TRI +        Y+  +D + K  +IEG+   ++G    +F +  
Sbjct: 132 VATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVPSLFGVSQ 191

Query: 294 HTILCLTFLEQTMKLVHAFESK 315
             I    +   T+K  H F +K
Sbjct: 192 GAIYFTVY--DTLKY-HYFAAK 210

 Score = 35.0 bits (79), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 45/104 (43%), Gaps = 5/104 (4%)

Query: 2   AKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYT 61
           AK  DK      +K+S     T   L+  ++VT   P++++K  +Q        N +   
Sbjct: 209 AKHVDK-----KKKLSNLEYITITSLSKMVSVTAVYPLQLLKSNLQSFEVSTVINPKTSH 263

Query: 62  NPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIR 105
             ++ +  ++  +G+ GL KGL+A  I  +         YE  R
Sbjct: 264 RVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCVYENFR 307

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 64.7 bits (156), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 117/289 (40%), Gaps = 28/289 (9%)

Query: 28  AACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK------ 81
           A  + + V +P++ +  R      LM+ + +I T+  Q   V+FR+       K      
Sbjct: 20  AGILEIGVFHPVDTISKR------LMSNHTKI-TSGAQLNSVIFRDHAAEAFGKRVFTLF 72

Query: 82  -GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIG-- 138
            GL  A +Y+I     + G        +NK F  D +S      G  + +  A  +IG  
Sbjct: 73  PGLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSATAGSLIGIG 132

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
            ++  PL ++K + Q+   A K            G   I   EG+  L+RG      R  
Sbjct: 133 EIVLLPLDVLKIKRQTNPEAFK----------GRGFLKILKDEGIFNLYRGWGWTAARNA 182

Query: 199 AGSSVQLPIYNTAKNFLL-RNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQK 257
            GS         AK ++L   D  +   S +  +S +      +V  P DVI TRI N+ 
Sbjct: 183 PGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNRN 242

Query: 258 GDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTM 306
            D  +     +  T+K EG TA +KG   ++   GP  +     L Q++
Sbjct: 243 FDNPESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFA-LAQSL 290

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 131/306 (42%), Gaps = 22/306 (7%)

Query: 1   MAKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIY 60
           M + E+ IQ     K   F +F AGG+   ++ TV +P+E VKI +Q+Q    A N  + 
Sbjct: 1   MGQPENYIQ--TVYKNDGFIAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGL- 57

Query: 61  TNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHK 120
                A+  V++ EG++GL +G     +     +  +   YE  +    + F+  Q  H+
Sbjct: 58  ---VHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCK---TRVFHVGQSGHE 111

Query: 121 VQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQ-SYSNAIKIGEQTHYT-----GVWNGL 174
                  +  GA  G    ++  PL LV+TRL    +N  K+     +      G+   L
Sbjct: 112 QLRSWERLVGGALGGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELL 171

Query: 175 KTIYMTE-GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTAST 233
           + I+  E G++G +RG+    L      ++   +Y   K  +  +       +  L    
Sbjct: 172 RRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGA 231

Query: 234 ISGLGVAVVMNPWDV------ILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQ 287
           +SG     V+ P+D+      +LT   ++ G  Y    D L    + EG+   YKG  A 
Sbjct: 232 VSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTAN 291

Query: 288 VFRIGP 293
           + ++ P
Sbjct: 292 LVKVVP 297

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 86/186 (46%), Gaps = 21/186 (11%)

Query: 35  VTNPIEVVKIRMQLQGELMAANQR-----IYTNP--FQAMGVVFRNEG-IRGLQKGLVAA 86
           VT P+++V+ R+ +Q   +A   R     I   P   + +  +FR EG +RG  +G+   
Sbjct: 132 VTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191

Query: 87  YIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLF 146
            +  +         YE ++A++      D ++  V +  + +  GA SG I   +  P  
Sbjct: 192 SLGVVPFVALNFALYERLKALIPH----DYDAGSVAAAKLAI--GAVSGGIAQTVVYPFD 245

Query: 147 LVKTRLQSYSNAIKIGEQT---HYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
           L++ R Q     + +G+      Y  V + L TI   EG++G ++G+ A +++     +V
Sbjct: 246 LLRRRFQ----VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301

Query: 204 QLPIYN 209
           Q  +Y 
Sbjct: 302 QWFVYE 307

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 85/213 (39%), Gaps = 35/213 (16%)

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTG-VWNGLKTIYMTEGVK 184
           I   AG   G +   + SP+  VK  LQ  S+       T Y G + + +K +Y  EGVK
Sbjct: 18  IAFVAGGVGGAVSRTVVSPVERVKILLQVQSST------TAYNGGLVHAVKQVYKEEGVK 71

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLH--------LTASTISG 236
           GLFRG     LR    S+VQ  +Y   K       +   G S H        L    + G
Sbjct: 72  GLFRGNGINCLRIFPYSAVQYAVYEFCK-----TRVFHVGQSGHEQLRSWERLVGGALGG 126

Query: 237 LGVAVVMNPWDVILTRIYNQKGDLYK-------------GPIDCLVKTVKIE-GITALYK 282
               +V  P D++ TR+  Q  +L K             G ++ L +  + E G+   Y+
Sbjct: 127 GASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYR 186

Query: 283 GFEAQVFRIGPHTILCLTFLEQTMKLV-HAFES 314
           G       + P   L     E+   L+ H +++
Sbjct: 187 GVYPTSLGVVPFVALNFALYERLKALIPHDYDA 219

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 8/89 (8%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQL----QGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           G ++  IA TV  P ++++ R Q+    Q EL       Y +   A+  + R EG+RG  
Sbjct: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFR----YASVADALWTIGRQEGLRGYY 285

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMN 109
           KGL A  +  +     +   YE I   M+
Sbjct: 286 KGLTANLVKVVPAMAVQWFVYELISENMH 314

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 113/278 (40%), Gaps = 36/278 (12%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGI-RGLQKGL 83
           G +A  +   +  P + VK+R+Q Q   M      +   +  +   + NEG+ RG  +G+
Sbjct: 13  GSIAGAVGKVIEYPFDTVKVRLQTQPAHM------FPTTWSCIKFTYDNEGLWRGFYQGI 66

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSV----GINVFAGAASGIIGA 139
                      GS L       AV+  +F   +    V+S+       V+AGA +G   +
Sbjct: 67  -----------GSPLAGAALENAVLFVSFNQAKRLLDVESLLSPLSKTVWAGAFAGACAS 115

Query: 140 VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199
            + +P+ L+K +LQ  SN      +T +T +   +K++    G  GL++G     +R   
Sbjct: 116 FVLTPVELIKCKLQ-VSNLSTT--KTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESG 172

Query: 200 GSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTIS-GLGVAVVMNPWDVILTRIYNQKG 258
           G +     Y   KN+L      E   +  L AS  S GL     + P D I       K 
Sbjct: 173 GGAAWFTTYEVVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTI-------KS 225

Query: 259 DLYKGPIDCLVKTVKI---EGITALYKGFEAQVFRIGP 293
            +    ID    T KI   +GI   Y+G    + R  P
Sbjct: 226 TMQTDHIDLSSATRKIYARQGIAGFYRGLGITLIRAVP 263

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 73/187 (39%), Gaps = 18/187 (9%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           AG  A   A  V  P+E++K ++Q+    ++  +  +T     +  V    G  GL +G 
Sbjct: 106 AGAFAGACASFVLTPVELIKCKLQVSN--LSTTKTSHTKILPTIKSVLSERGFLGLWQGQ 163

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
              +I +   +G    ++     V N   Y        Q+    + A  AS   G    +
Sbjct: 164 SGTFIRE---SGGGAAWFTTYEVVKN---YLASRRQAEQNTTWELLASGASA--GLAFNA 215

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
            +F   T        IK   QT +  + +  + IY  +G+ G +RG+   ++R    ++ 
Sbjct: 216 SIFPADT--------IKSTMQTDHIDLSSATRKIYARQGIAGFYRGLGITLIRAVPANAA 267

Query: 204 QLPIYNT 210
               Y T
Sbjct: 268 IFYTYET 274

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 88/194 (45%), Gaps = 13/194 (6%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
            D  Q   ++  S+   F +G  +      V +P + +K+R+Q      + +   +  P 
Sbjct: 47  SDIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ-----TSQDSTRFKGPL 101

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSV 124
             +   F  +GIRG   G     +  I ++   LG     R ++ K  Y ++E   +   
Sbjct: 102 DCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGC 161

Query: 125 GINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK 184
              + +G  +G   + + +P+ L K +LQ   +A    + T YTG  + +K +Y + GV+
Sbjct: 162 ---IISGVMAGWSVSFIAAPVELAKAKLQVQYDA----KTTKYTGPVDVIKKVYSSNGVR 214

Query: 185 GLFRGIDAA-ILRT 197
           GL++G+ +  I RT
Sbjct: 215 GLYKGLTSTLIFRT 228

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 82/190 (43%), Gaps = 21/190 (11%)

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
           +G  SGI    +G P   +K RLQ+  ++      T + G  + +   +  +G++G + G
Sbjct: 66  SGMFSGIAKNAVGHPFDTIKVRLQTSQDS------TRFKGPLDCVYKTFTQQGIRGFYLG 119

Query: 190 IDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGL----GVAVVMNP 245
               ++      SV L   +  +  LL+  +  +   L L+   ISG+     V+ +  P
Sbjct: 120 FTPPLVGWILMDSVMLGCLHNYR-MLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAP 178

Query: 246 WDVILTRI---YNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQ-------VFRIGPHT 295
            ++   ++   Y+ K   Y GP+D + K     G+  LYKG  +        VF  G + 
Sbjct: 179 VELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSYE 238

Query: 296 ILCLTFLEQT 305
           +L   F E T
Sbjct: 239 LLTRWFKEHT 248

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 80/191 (41%), Gaps = 29/191 (15%)

Query: 14  QKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN 73
           +K+   G   +G +A      +  P+E+ K ++Q+Q +   A    YT P   +  V+ +
Sbjct: 154 EKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYD---AKTTKYTGPVDVIKKVYSS 210

Query: 74  EGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAA 133
            G+RGL KGL +  I++     +   F+     ++ + F   +E   +    IN ++G  
Sbjct: 211 NGVRGLYKGLTSTLIFR-----TNFVFWWGSYELLTRWF---KEHTNMSDTAINFWSGGF 262

Query: 134 SGIIG-AVMGSPLFLVKTRLQSYSNAIK--IGEQTHYTGVWNGL----KTIYMTEGVKGL 186
           S   G      P           S+ IK  +     Y G +       K I+ T G +G 
Sbjct: 263 SASFGFWTTAYP-----------SDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGF 311

Query: 187 FRGIDAAILRT 197
           F+G   + LR+
Sbjct: 312 FKGFVPSFLRS 322

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 217 RNDIMEDGPS------LHLTASTISGLGVAVVMNPWDVILTRIY-NQKGDLYKGPIDCLV 269
           ++DI +  PS      +   +   SG+    V +P+D I  R+  +Q    +KGP+DC+ 
Sbjct: 46  KSDIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVY 105

Query: 270 KTVKIEGITALYKGF 284
           KT   +GI   Y GF
Sbjct: 106 KTFTQQGIRGFYLGF 120

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 87/183 (47%), Gaps = 25/183 (13%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +F AGG+A  ++ TV +P E VKI +Q+Q    A N  I      A+G V++ EG+ GL 
Sbjct: 14  AFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGI----INAVGQVYKEEGVAGLF 69

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVM-----NKTFYPDQESHKVQSVGIN-VFAGAAS 134
           +G          LN  R+  Y  ++ V+        F+ D    K Q +    + AGA  
Sbjct: 70  RG--------NGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALC 121

Query: 135 GIIGAVMGSPLFLVKTRLQ-SYSNAIKIGEQ-----THYTGVWNGL-KTIYMTEGVKGLF 187
           G +  +   PL LV+TRL    +N  K+ +          GVW  L KT     G++GL+
Sbjct: 122 GGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLY 181

Query: 188 RGI 190
           RGI
Sbjct: 182 RGI 184

 Score = 55.8 bits (133), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 74/180 (41%), Gaps = 23/180 (12%)

Query: 122 QSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTE 181
           Q   I   AG  +G +   + SP   VK  LQ  S+        +  G+ N +  +Y  E
Sbjct: 9   QESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSST-----SAYNHGIINAVGQVYKEE 63

Query: 182 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSL----HLTASTISGL 237
           GV GLFRG     +R    S+VQ  +Y   K  +   D       L     L+A  + G 
Sbjct: 64  GVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGG 123

Query: 238 GVAVVMNPWDVILTRIYNQKGDLYK-------------GPIDCLVKTVKIE-GITALYKG 283
              +   P D++ TR+  Q  +L K             G  + LVKT K E GI  LY+G
Sbjct: 124 MSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRG 183

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 129/293 (44%), Gaps = 28/293 (9%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G  A  I   VT+P++++K+R+QL    +  +   Y N  Q   ++    G + L K  
Sbjct: 18  SGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSS--YYN--QVQRIIKDGSGTQQLLKEA 73

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN---------VFAGAAS 134
                  I  N    G Y  +        Y       +Q+  +N         + +  AS
Sbjct: 74  YRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGAS 133

Query: 135 GIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAI 194
           G+  A++ +P++++KTR+ S  ++        YT + N +  IY  EG+K  +RG+  ++
Sbjct: 134 GLATALLTNPMWVIKTRIMSTKSS------QGYTSILNAITRIYTEEGLKTFWRGLVPSL 187

Query: 195 LRTGAGSSVQLPIYNTAKNFLL--RNDIMEDGPSLHLTASTISGLGVAVVMN--PWDVIL 250
                G ++   IY+T K   L  RNDI E   +   T   IS   +  V +  P  ++ 
Sbjct: 188 FGVTQG-ALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLLK 246

Query: 251 TRIYNQKGDLYKGP-IDCLVKTV-KIEGITALYKGFEAQVFRIGPHTILCLTF 301
           T +   + +  +   ++ L++++    GI   YKG  A + R  P T  C+TF
Sbjct: 247 TNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPST--CITF 297

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 81/175 (46%), Gaps = 15/175 (8%)

Query: 128 VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGV-KGL 186
           + +G  +G I  ++  PL L+K RLQ    AI +   ++Y  V   +K    T+ + K  
Sbjct: 16  IISGLTAGTITTIVTHPLDLIKLRLQL--AAIDLKPSSYYNQVQRIIKDGSGTQQLLKEA 73

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFL--------LRNDIMED---GPSLHLTASTIS 235
           +RG+   I+       +   +Y  +K+ +        L+N  M D     S++L ++  S
Sbjct: 74  YRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGAS 133

Query: 236 GLGVAVVMNPWDVILTRIYNQKGDL-YKGPIDCLVKTVKIEGITALYKGFEAQVF 289
           GL  A++ NP  VI TRI + K    Y   ++ + +    EG+   ++G    +F
Sbjct: 134 GLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSLF 188

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 94/192 (48%), Gaps = 20/192 (10%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           A GLA  +   +TNP+ V+K R+     +   + + YT+   A+  ++  EG++   +GL
Sbjct: 132 ASGLATAL---LTNPMWVIKTRI-----MSTKSSQGYTSILNAITRIYTEEGLKTFWRGL 183

Query: 84  VAAYIYQIALNGSRLGFYEPIRA--VMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVM 141
           V + ++ +         Y+ ++   + ++    ++  + V+++GI     + S +I    
Sbjct: 184 VPS-LFGVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGI----ISLSKMISVSS 238

Query: 142 GSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201
             PL L+KT LQ++       E    + + + +++I+ T G+ G ++G+ A ++R    +
Sbjct: 239 VYPLQLLKTNLQTFRT-----EHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPST 293

Query: 202 SVQLPIYNTAKN 213
            +   +Y   K+
Sbjct: 294 CITFGVYEHFKH 305

>Kwal_33.15446
          Length = 305

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/320 (20%), Positives = 119/320 (37%), Gaps = 29/320 (9%)

Query: 1   MAKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIY 60
           M+   D       +  S+   F +G  +      V +P + +K+R+Q      + +   +
Sbjct: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQ-----TSQDTGRF 55

Query: 61  TNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHK 120
             P   +    R +GIRG   G     +  I ++   LG     R ++ K  Y  +E   
Sbjct: 56  KGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLP 115

Query: 121 VQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMT 180
           +      + +G  +G   + + +P+ L K +LQ   +A    + T Y G  + +K +Y  
Sbjct: 116 LSGC---ILSGVLAGWSVSFIAAPVELAKAKLQVQYDA----QTTRYRGPLDVIKKVYAA 168

Query: 181 EGVKGLFRG-IDAAILRT----GAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTIS 235
           +G++G+++G +   I RT      GS      Y     +   N  + D           +
Sbjct: 169 DGIRGMYKGLVSTLIFRTHFVYWWGS------YELLTRWFKANTNLSDTAINFWAGGFSA 222

Query: 236 GLGVAVVMNPWDVILTRIYNQKGDLYKGPI----DCLVKTVKIEGITALYKGFEAQVFRI 291
             G      P DVI   I     D Y G +    +      +  GI   +KGF     R 
Sbjct: 223 SFGFWTTAYPSDVIKQVILCN--DKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRS 280

Query: 292 GPHTILCLTFLEQTMKLVHA 311
            P     L   E  +++  A
Sbjct: 281 FPANAAALASFEFVLRVSGA 300

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 116/284 (40%), Gaps = 27/284 (9%)

Query: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK 81
           F +G  A    + V  P++VVK RMQLQ      +   Y      +G + + EG   L K
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71

Query: 82  GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVM 141
           G+ +  + +     ++    +  + +    +  D+ + +     I++ +G+ +G+  A +
Sbjct: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQ-----ISILSGSLAGVTEACV 126

Query: 142 GSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201
             P  LVK RLQ  ++      +  +       KTI  T G+  L+ G+++ + R    +
Sbjct: 127 IVPFELVKIRLQDVNSKFNGPMEVVF-------KTIRET-GILSLYNGLESTMWRNAFWN 178

Query: 202 SVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISG-LGVAVVMNPWDVILTRIYNQKGDL 260
                +    +  L +     +  +  L A TI G    +       V+ +RI  Q G  
Sbjct: 179 GGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRI--QSGAT 236

Query: 261 -----------YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
                      Y      L K    EG TALYKGF  ++ R+GP
Sbjct: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 92/216 (42%), Gaps = 26/216 (12%)

Query: 4   GEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNP 63
           G DK+     Q++S      AG   AC+ V    P E+VKIR+Q        N + +  P
Sbjct: 103 GVDKL----TQQISILSGSLAGVTEACVIV----PFELVKIRLQ------DVNSK-FNGP 147

Query: 64  FQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS 123
            + +    R  GI  L  GL +        NG   G    IRA++     P  +++  ++
Sbjct: 148 MEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL-----PKAKTNTEKT 202

Query: 124 VGINVFAGAASGIIG-AVMGSPLFLVKTRLQSYSNAIKIGEQT---HYTGVWNGLKTIYM 179
              ++ AG   G    +   + L +VK+R+QS +    + + T    Y   W  L  IY 
Sbjct: 203 TN-DLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTT-LADGTVVPKYNWTWPSLFKIYS 260

Query: 180 TEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
            EG   L++G    ILR G G  + L ++N    F 
Sbjct: 261 EEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296

>Kwal_47.18216
          Length = 333

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 78/315 (24%), Positives = 114/315 (36%), Gaps = 39/315 (12%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +  AGG A        +P++ +K+RMQ+        QR       A  +  + EG   L 
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQ-EGFLALY 71

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140
           KGL A  I  I     R   YE  R     T   D+++  V S G    AG  +GI  AV
Sbjct: 72  KGLGAVVIGIIPKMAIRFTSYEFFR-----TLLADRQTGVV-STGNTFVAGVGAGITEAV 125

Query: 141 MG-SPLFLVKTRLQS--------------------------YSNAIKIGEQTHYTGVWNG 173
           M  +P+ +VK RLQ+                           +    +     Y      
Sbjct: 126 MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQA 185

Query: 174 LKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTA-S 232
              I   EG + L+RG+     R          +Y+T K+ L      +  PS   +   
Sbjct: 186 AYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIG 245

Query: 233 TISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLV----KTVKIEGITALYKGFEAQV 288
            ISG        P D I TR+   K          ++    + ++ EG  ALYKG   +V
Sbjct: 246 LISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRV 305

Query: 289 FRIGPHTILCLTFLE 303
            R+ P   +  T  E
Sbjct: 306 MRVAPGQAVTFTVYE 320

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 94/231 (40%), Gaps = 42/231 (18%)

Query: 16  VSKFGSFTAG-GLAACIAVTVTNPIEVVKIRMQLQ------------------------- 49
           VS   +F AG G     AV V NP+EVVKIR+Q Q                         
Sbjct: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSA 166

Query: 50  ---GELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRA 106
               E +AA  + Y N  QA  V+ + EG R L +G+      Q    G+    Y  +++
Sbjct: 167 TTATENVAATPK-YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKS 225

Query: 107 VMNKTFYPDQESHKVQSVGI--NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQ 164
            +       QE H+   +        G  SG +G    +PL  +KTRLQ   +  K    
Sbjct: 226 RL-------QEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSK---D 275

Query: 165 THYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
           + ++ +    + +   EG + L++GI   ++R   G +V   +Y   +  L
Sbjct: 276 SGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185
           IN+ AG  +G+  A+   PL  +K R+Q YS A + G++    G     + I   EG   
Sbjct: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRAR--GFIGTARDISTQEGFLA 69

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTAST-ISGLGVAV--- 241
           L++G+ A ++    G   ++ I  T+  F  R  + +    +  T +T ++G+G  +   
Sbjct: 70  LYKGLGAVVI----GIIPKMAIRFTSYEF-FRTLLADRQTGVVSTGNTFVAGVGAGITEA 124

Query: 242 --VMNPWDVILTRIYNQ 256
             V+NP +V+  R+  Q
Sbjct: 125 VMVVNPMEVVKIRLQAQ 141

 Score = 35.0 bits (79), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 225 PSLHLTASTISGLGVAVVMNPWDVILTR--IYN---QKGDLYKGPIDCLVKTVKIEGITA 279
           P+++L A   +GL  A+  +P D I  R  IY+   ++G   +G I         EG  A
Sbjct: 10  PAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLA 69

Query: 280 LYKGFEAQVFRIGPHTILCLTFLE 303
           LYKG  A V  I P   +  T  E
Sbjct: 70  LYKGLGAVVIGIIPKMAIRFTSYE 93

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 62.4 bits (150), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 113/283 (39%), Gaps = 40/283 (14%)

Query: 51  ELMAANQRI-YTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMN 109
           EL   N  + +    +A   +   EGI  L +G+    +  I  N      YE IR V  
Sbjct: 92  ELHCKNSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDVSP 151

Query: 110 -KTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYT 168
             + YP             +F GA + +  A   +PL LVKT+LQS      I   +  T
Sbjct: 152 IASTYPTLNP---------LFCGAIARVFAATSIAPLELVKTKLQS------IPRSSKST 196

Query: 169 GVWNGLKTIY--------MTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDI 220
             W  +K +         M    + LF+G++  + R    S++    Y   K  L  +  
Sbjct: 197 KTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDST 256

Query: 221 M---EDGPSLHLTAS----TISGLGVAVVMNPWDVILTR----IYNQK----GDLYKGPI 265
               +D   +H   S     ISG+  A+  +P+DV  TR    + N      G+  +   
Sbjct: 257 RFASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMF 316

Query: 266 DCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKL 308
             L    + EG+ ALY G  A+V +I P   + ++  E + K+
Sbjct: 317 KFLETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEISKKV 359

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 87/201 (43%), Gaps = 19/201 (9%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQ--------LQGELMAANQRIYTNPFQAMGVVFRNEG 75
            G +A   A T   P+E+VK ++Q         +  +M  +  +     Q M +V  +  
Sbjct: 164 CGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKD--LLNETRQEMKMVGPS-- 219

Query: 76  IRGLQKGLVAAYIYQIALNGSRLGFYEPI--RAVMNKTFYPDQESHKVQSVGINVFA-GA 132
            R L KGL       +  +      YE    R  ++ T +  ++++ V    IN FA G 
Sbjct: 220 -RALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVH--FINSFASGC 276

Query: 133 ASGIIGAVMGSPLFLVKTRLQ-SYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGID 191
            SG+I A+   P  + KTR Q S  N            ++  L+TI+ TEG+  L+ G+ 
Sbjct: 277 ISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLA 336

Query: 192 AAILRTGAGSSVQLPIYNTAK 212
           A +++     ++ +  Y  +K
Sbjct: 337 ARVIKIRPSCAIMISSYEISK 357

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 76/312 (24%), Positives = 125/312 (40%), Gaps = 49/312 (15%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           AG +     V V  P +  K+R+Q                 + +  + +NEG+    KG 
Sbjct: 40  AGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT--------LEVLRNLVKNEGVFAFYKGA 91

Query: 84  VAAYI-------YQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF------- 129
           +   +        Q  +N +   F++   A  N    P+  S  V     N         
Sbjct: 92  LTPLLGVGICVSVQFGVNEAMKRFFQNYNASKN----PNMSSQDVDLSRSNTLPLSQYYV 147

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
            G   G++ + + SP+  ++ RLQ+ ++    G    + G W+ +K +   +   GL RG
Sbjct: 148 CGLTGGVVNSFLASPIEQIRIRLQTQTSN---GGDREFKGPWDCIKKL---KAQGGLMRG 201

Query: 190 IDAAILRTGAGSSVQLPIYNT--AKNF---LLRNDIMEDGPSLHLTA-STISGLGVAVVM 243
           +   ++R G G      +Y    A+     L RN+I    P   L      SG  + + +
Sbjct: 202 LFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEI----PPWKLCLFGAFSGTMLWLTV 257

Query: 244 NPWDVILTRIYNQ--KGDLYKGPIDCLVKTVKI-EGITALYKGFEAQVFRIGPHTILCLT 300
            P DV+ + I N   +   YK  I  + KT+   EGI A +KGF   + R  P  +   T
Sbjct: 258 YPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP--VNGAT 315

Query: 301 FLEQTMKLVHAF 312
           FL  T +LV  F
Sbjct: 316 FL--TFELVMRF 325

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 79/186 (42%), Gaps = 32/186 (17%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           ++FAG   GI   ++G P    K RLQ+ +      E          L+ +   EGV   
Sbjct: 37  DIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTTLEV---------LRNLVKNEGVFAF 87

Query: 187 FRGIDAAILRTGAGSSVQLPI----------YNTAKN-FLLRNDI-MEDGPSLHLTASTI 234
           ++G    +L  G   SVQ  +          YN +KN  +   D+ +    +L L+   +
Sbjct: 88  YKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYV 147

Query: 235 SGLGVAVV----MNPWDVILTRIYNQK---GDL-YKGPIDCLVKTVKIEGITALYKGFEA 286
            GL   VV     +P + I  R+  Q    GD  +KGP DC +K +K +G   L +G   
Sbjct: 148 CGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDC-IKKLKAQG--GLMRGLFP 204

Query: 287 QVFRIG 292
            + R G
Sbjct: 205 TMIRAG 210

 Score = 34.7 bits (78), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 48/222 (21%), Positives = 93/222 (41%), Gaps = 29/222 (13%)

Query: 1   MAKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIY 60
           M+  +  + +S    +S++  +  G     +   + +PIE ++IR+Q Q        R +
Sbjct: 127 MSSQDVDLSRSNTLPLSQY--YVCGLTGGVVNSFLASPIEQIRIRLQTQTS--NGGDREF 182

Query: 61  TNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHK 120
             P+  +  + + +G  GL +GL    I      G+    YE   A++ +        ++
Sbjct: 183 KGPWDCIKKL-KAQG--GLMRGLFPTMIRAGHGLGTYFLVYE---ALVAREIGTGLTRNE 236

Query: 121 VQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQS-------YSNAIKIGEQTHYTGVWNG 173
           +    + +F GA SG +  +   PL +VK+ +Q+       Y N+I       Y      
Sbjct: 237 IPPWKLCLF-GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSI------SYVA---- 285

Query: 174 LKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
            KTIY  EG++  F+G    ++R+   +      +     FL
Sbjct: 286 -KTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFL 326

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/311 (22%), Positives = 123/311 (39%), Gaps = 27/311 (8%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
           ED   +   + V    + TAGG+A    V +  P +  K+R+Q          ++ T+  
Sbjct: 15  EDHPGQDNGRVVKDLLAGTAGGIAQ---VLIGQPFDTTKVRLQ--------TSKVPTSAA 63

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQ-S 123
           + +  + +NEG +G  KG +   +   A    + G  E     M + F+     H    S
Sbjct: 64  EVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNE----AMKRFFHARNVDHNATLS 119

Query: 124 VGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGV 183
           +      G   G+  + + SP+  V+ RLQ+ + +   G Q  + G  + +K +      
Sbjct: 120 LSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGS---GAQAEFKGPIDCIKKL---RSQ 173

Query: 184 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDI--MEDGPSLHLTASTISGLGVAV 241
           KGL RG+   +LR G G      +Y    +  +   +   E  P        +SG  + +
Sbjct: 174 KGLMRGLIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWL 233

Query: 242 VMNPWDVILTRIYNQ---KGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILC 298
           ++ P DV+ + +      K    K  I         EG+ A +KGF   + R  P     
Sbjct: 234 MVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGT 293

Query: 299 LTFLEQTMKLV 309
               E  M+L+
Sbjct: 294 FATFELAMRLL 304

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 81/189 (42%), Gaps = 24/189 (12%)

Query: 115 DQESHKVQSVG---INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVW 171
           D E H  Q  G    ++ AG A GI   ++G P    K RLQ+        E        
Sbjct: 13  DLEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPTSAAEV------- 65

Query: 172 NGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTA 231
             +K +   EG KG ++G    ++  GA  S+Q  +    K F    ++ +   +L L+ 
Sbjct: 66  --VKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNV-DHNATLSLSQ 122

Query: 232 STISGL--GV--AVVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITALYKG 283
             + GL  G+  + + +P + +  R+  Q G      +KGPIDC+ K    +G   L +G
Sbjct: 123 YYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKG---LMRG 179

Query: 284 FEAQVFRIG 292
               + R G
Sbjct: 180 LIPTMLREG 188

>Kwal_27.11626
          Length = 299

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 119/296 (40%), Gaps = 31/296 (10%)

Query: 28  AACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK------ 81
           A  + + V +P++ V  R      LM+ + +I ++  Q   V+FR      L K      
Sbjct: 19  AGILEIGVFHPVDTVSKR------LMSNHTKISSSA-QLNSVIFREHAGEALGKRLFTLF 71

Query: 82  -GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIG-- 138
            GL  A  Y+I     + G        +NK F  D ++   +  G  + +  A  +IG  
Sbjct: 72  PGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKALRSATAGSLIGIG 131

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
            ++  PL ++K + Q+   + K            G   I   EG  GL+RG      R  
Sbjct: 132 EIVLLPLDVLKIKRQTNPESFK----------GRGFIKILKDEGF-GLYRGWGWTAARNA 180

Query: 199 AGSSVQLPIYNTAKNFLL-RNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQK 257
            GS         AK ++L   D      S +  +S +      +V  P DVI TRI N+ 
Sbjct: 181 PGSFALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRH 240

Query: 258 GDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFE 313
            D  +     +  T+K EGITA +KG   ++   GP  +      +    L+ AF+
Sbjct: 241 FDNPESGFRIVQNTLKNEGITAFFKGLTPKLLTTGPKLVFSFALAQS---LIPAFD 293

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 96/213 (45%), Gaps = 24/213 (11%)

Query: 14  QKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQ---LQGELMAANQRIYTNPFQAMGVV 70
           + +SKF ++ AGGLA   A     PI+ +K R+Q   L  +L   N       FQ    +
Sbjct: 343 KDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLL-----FQTAKDM 397

Query: 71  FRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIR----AVMNKTFYPDQESHKVQSVGI 126
           FR  G+R   +G+    +         LG +  ++    A   KT    Q+   + ++ +
Sbjct: 398 FREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVV 457

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMT----EG 182
            +  GA SG +GA +  P+ L++TRLQ+       G   H   V+NG K + +     EG
Sbjct: 458 -LPMGAFSGTVGASVVYPINLLRTRLQAQ------GTYAH-PYVYNGFKDVLLKTLEREG 509

Query: 183 VKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
            +GLF+G+   + +     S+    Y   K F+
Sbjct: 510 YQGLFKGLVPTLAKVCPAVSISYLCYENLKKFM 542

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/322 (22%), Positives = 134/322 (41%), Gaps = 37/322 (11%)

Query: 19  FGSFTAGGLAACIAVTVTNPIEVVKI----RMQLQG-------ELMAAN-----QRIYTN 62
           FG F AGG++  I+ T T P + +K+    R  L         +L+A N      +I + 
Sbjct: 228 FGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSP 287

Query: 63  PFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQ 122
             +A+  ++R  GI+    G     I     +  + G +E  + +M K         K  
Sbjct: 288 LAKAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKL--EGCRDTKDL 345

Query: 123 SVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEG 182
           S      AG  +G+       P+  +K R+Q      K+        ++   K ++   G
Sbjct: 346 SKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNL---LFQTAKDMFREGG 402

Query: 183 VKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRN-----DIMEDGPSLH----LTAST 233
           ++  +RG+   I+     +++ L  ++  K + +       ++ +D  +L     L    
Sbjct: 403 LRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGA 462

Query: 234 ISGLGVAVVMNPWDVILTRIYNQ----KGDLYKGPIDCLVKTVKIEGITALYKGFEAQVF 289
            SG   A V+ P +++ TR+  Q       +Y G  D L+KT++ EG   L+KG    + 
Sbjct: 463 FSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLA 522

Query: 290 RIGPH---TILCLTFLEQTMKL 308
           ++ P    + LC   L++ M L
Sbjct: 523 KVCPAVSISYLCYENLKKFMNL 544

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 135/291 (46%), Gaps = 38/291 (13%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAM---GVVFRNEGIRGLQ 80
           +G  A  +   + +P+++ K+R+QL   + +  ++ Y N +  +    +    E  RGL 
Sbjct: 14  SGLTAGSVTTLIVHPLDLFKVRLQLL--ITSTTKKGYRNLWSEIVGSDLSLTRELYRGLT 71

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQ-----SVGINVFAGAASG 135
             LV         N    G Y     V     Y    +H+++     S  + + A A+SG
Sbjct: 72  VNLVG--------NTIAWGLYFASYRVAKD--YLINYNHRIRNDKDLSSWMYLSASASSG 121

Query: 136 IIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAIL 195
           ++  V+ +PL+++KTR+ S +N+     +         L+ +   +GV+GL++G+  A++
Sbjct: 122 MLTTVLTNPLWVIKTRMMSKANSDLTSMKV--------LRDLIKNDGVQGLWKGLVPALV 173

Query: 196 RTGAGSSVQLPIYNTAKN-FLLRNDIMEDGPSLHLTA-STISGLGVAVVMNPWDVILTRI 253
               G ++    Y+T K+  +L+N   ++  +L   A +++S +     + P+ ++ + +
Sbjct: 174 GVSQG-ALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNL 232

Query: 254 YN---QKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTF 301
            +    + D    P+  ++ +    G+   YKG  A + R  P T  C+TF
Sbjct: 233 QSFQASENDFKLLPLSKMIYSR--SGLLGFYKGLSANLLRSVPST--CITF 279

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 96/205 (46%), Gaps = 24/205 (11%)

Query: 14  QKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN 73
           + +S +   +A   +  +   +TNP+ V+K RM     +  AN  +     + +  + +N
Sbjct: 106 KDLSSWMYLSASASSGMLTTVLTNPLWVIKTRM-----MSKANSDL--TSMKVLRDLIKN 158

Query: 74  EGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAA 133
           +G++GL KGLV A +  ++        Y+ ++   +K    +++S ++ ++   +   + 
Sbjct: 159 DGVQGLWKGLVPALV-GVSQGALHFTCYDTLK---HKLVLKNRDSDEITNLE-TIAVTSV 213

Query: 134 SGIIGAVMGSPLFLVKTRLQSY---SNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGI 190
           S ++      P  L+K+ LQS+    N  K+   +         K IY   G+ G ++G+
Sbjct: 214 SKMLSTSAVYPFQLLKSNLQSFQASENDFKLLPLS---------KMIYSRSGLLGFYKGL 264

Query: 191 DAAILRTGAGSSVQLPIYNTAKNFL 215
            A +LR+   + +   IY   K+FL
Sbjct: 265 SANLLRSVPSTCITFCIYENFKSFL 289

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 80/167 (47%), Gaps = 20/167 (11%)

Query: 128 VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGL--KTIYMTEGVKG 185
           V +G  +G +  ++  PL L K RLQ     I    +  Y  +W+ +    + +T   + 
Sbjct: 12  VISGLTAGSVTTLIVHPLDLFKVRLQL---LITSTTKKGYRNLWSEIVGSDLSLT---RE 65

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLL------RNDIMEDGPS-LHLTASTISGLG 238
           L+RG+   ++       +    Y  AK++L+      RND  +D  S ++L+AS  SG+ 
Sbjct: 66  LYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRND--KDLSSWMYLSASASSGML 123

Query: 239 VAVVMNPWDVILTRIYNQ-KGDLYKGPIDCLVKTVKIEGITALYKGF 284
             V+ NP  VI TR+ ++   DL    +  L   +K +G+  L+KG 
Sbjct: 124 TTVLTNPLWVIKTRMMSKANSDL--TSMKVLRDLIKNDGVQGLWKGL 168

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 117/286 (40%), Gaps = 52/286 (18%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           S  +G  A      V  PI+ +K R+Q                  A G  FRN G RG+ 
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQ------------------AKGGFFRNGGYRGVY 49

Query: 81  KGLVAAYIYQIALNGSRLGF--YEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIG 138
           +GL +A +   +  G+ L F  Y+  +A     F     S  V  V  ++F+ +   I  
Sbjct: 50  RGLGSAVV--ASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAA 107

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG----LFRGIDAAI 194
            ++  P  +VK R Q+++        +H +  W  L+ I   E  +G    L+RG    I
Sbjct: 108 CMVRVPAEVVKQRSQTHA--------SHSS--WETLREILKNENGEGVRRNLYRGWSTTI 157

Query: 195 LRTGAGSSVQLPIYNTAKNF---LLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILT 251
           +R    + +Q P+Y   K     L  +D +E  P       +I+G   A    P D + T
Sbjct: 158 MREIPFTCIQFPLYEYMKKVWAELDESDRVE--PWKGAVCGSIAGGIAAATTTPLDFLKT 215

Query: 252 RIYNQKGDLYKGPIDCLVKTV-KIEGITALYKGFEAQVFRIGPHTI 296
           R+   K  +   P+  LV T+ K EG    + G       +GP T+
Sbjct: 216 RLMLCKKSI---PLGTLVSTIYKEEGFKVFFSG-------VGPRTM 251

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 85/206 (41%), Gaps = 22/206 (10%)

Query: 13  AQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR 72
           A  V+   S + G +AAC+   V  P EVVK R Q              + ++ +  + +
Sbjct: 91  ADVVTHMFSSSMGEIAACM---VRVPAEVVKQRSQTHAS---------HSSWETLREILK 138

Query: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGA 132
           NE   G+++ L   +   I           P+   M K +    ES +V+     V  G+
Sbjct: 139 NENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYEYMKKVWAELDESDRVEPWKGAV-CGS 197

Query: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDA 192
            +G I A   +PL  +KTRL     +I +G           + TIY  EG K  F G+  
Sbjct: 198 IAGGIAAATTTPLDFLKTRLMLCKKSIPLGTL---------VSTIYKEEGFKVFFSGVGP 248

Query: 193 AILRTGAGSSVQLPIYNTAKNFLLRN 218
             +   AG ++ L IY T  + L  N
Sbjct: 249 RTMWISAGGAIFLGIYETVHSLLSTN 274

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 88/195 (45%), Gaps = 31/195 (15%)

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185
           I++ +GAA+G    ++  P+  +KTRLQ+     + G                   G +G
Sbjct: 7   ISLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFRNG-------------------GYRG 47

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAK-------NFLLRNDIMEDGPSLHLTASTISGLG 238
           ++RG+ +A++ +  G+S+    Y+T K         LL +  + D  + H+ +S++  + 
Sbjct: 48  VYRGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVT-HMFSSSMGEIA 106

Query: 239 VAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITA-LYKGFEAQVFRIGPHTIL 297
             +V  P +V+  R            +  ++K    EG+   LY+G+   + R  P T  
Sbjct: 107 ACMVRVPAEVVKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFT-- 164

Query: 298 CLTF-LEQTMKLVHA 311
           C+ F L + MK V A
Sbjct: 165 CIQFPLYEYMKKVWA 179

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 121/294 (41%), Gaps = 23/294 (7%)

Query: 12  AAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVF 71
           + +  S+   F AG  +     TV +P + VK+R+Q   ++ +     +  P   +    
Sbjct: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTS-QVGSGAGIQFKGPLDCVYKTL 61

Query: 72  RNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAG 131
           +N+GIRGL  G        I ++ + LG     R +++K  YP+ +   +      + +G
Sbjct: 62  KNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC---IISG 118

Query: 132 AASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWN--------GLKTIYMTEGV 183
             +G   + + +P+ L K +LQ   +A    + T YTG  +        G+ T  +  GV
Sbjct: 119 VMAGWTVSFIAAPVELAKAKLQVQYDA----KTTKYTGPIDVVQKVFKQGMATNGILGGV 174

Query: 184 KGLFRG-IDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISG-LGVAV 241
           + L++G I   I R+          Y     +  +N  +   P+++  A  +S   G   
Sbjct: 175 RSLYKGLISTLIFRSNF--VFWWGSYELITQWFQKNTNLS-APAINFWAGGLSASFGFWT 231

Query: 242 VMNPWDVILTRIY-NQKGD-LYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
              P DV+   +  N K D  +K     +    +  GI   +KGF     R  P
Sbjct: 232 SAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285

>Scas_562.12
          Length = 300

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 119/297 (40%), Gaps = 30/297 (10%)

Query: 28  AACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK------ 81
           A  + + V +P++ +  R      LM+ + +I  N  +   V+FR      L K      
Sbjct: 20  AGILEIGVFHPVDTISKR------LMSNHTKI-GNSHELNRVIFREHFSEPLGKRLFTLF 72

Query: 82  -GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIG-- 138
            GL  A  Y++     + G        +NK +  D +S   +  G  + +  A  +IG  
Sbjct: 73  PGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIGIG 132

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
            ++  PL ++K + Q+   A K            G   I   EG+  L+RG      R  
Sbjct: 133 EIVLLPLDVLKIKRQTNPEAFK----------GRGFVKILKDEGIFNLYRGWGWTAARNA 182

Query: 199 AGSSVQLPIYNTAKNFLL-RNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQK 257
            GS         AK ++L   D  +   S +  +S +      +V  P DVI TRI N+ 
Sbjct: 183 PGSFALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRS 242

Query: 258 GDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFES 314
            D  +  +  +  T K EGITA +KG   ++   GP  +      +    L+  F+S
Sbjct: 243 FDNPETGLTIVKNTFKNEGITAFFKGLTPKLLTTGPKLVFSFALAQS---LIPKFDS 296

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 90/187 (48%), Gaps = 18/187 (9%)

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK-GLFRGIDAAILRT 197
           +VM S L  VKTR Q     +K      Y  + +  +T+ + EGV+ GL+ G  AA+L +
Sbjct: 69  SVMHS-LDTVKTRQQGAPGEVK------YRHMISAYRTLALEEGVRRGLYGGYGAAMLGS 121

Query: 198 GAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRI---- 253
              ++V    Y   K  ++    + +  S HL A  +  L  +VV  P +V+ TR+    
Sbjct: 122 FPSAAVFFGTYEWVKRQMINEWQIHETYS-HLAAGFLGDLFSSVVYVPSEVLKTRLQLQG 180

Query: 254 -YN----QKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKL 308
            YN    Q G  Y+G  D +   V+ EG++AL+ G++A + R  P + L   F E+  K 
Sbjct: 181 CYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKW 240

Query: 309 VHAFESK 315
               E K
Sbjct: 241 AFLLERK 247

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 87/215 (40%), Gaps = 16/215 (7%)

Query: 19  FGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGV------VFR 72
           +    AG L    +  V  P EV+K R+QLQG     N R + + +   G+      + R
Sbjct: 149 YSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQG---CYNNRHFQSGYNYRGLSDAVRTIVR 205

Query: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGA 132
            EG+  L  G  A     +  +  +  FYE  R           + H   S    V  GA
Sbjct: 206 TEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERKPVDGH--LSFTAEVVTGA 263

Query: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNG-----LKTIYMTEGVKGLF 187
           ++G +  ++ +PL +VKTR+Q+                 NG     L  +   EG+ G F
Sbjct: 264 SAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAF 323

Query: 188 RGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIME 222
            G+    + T   SS+ L +Y TA   L R+   E
Sbjct: 324 SGVGPRFIWTSIQSSIMLLLYQTALRTLARSPRAE 358

>Scas_328.1
          Length = 227

 Score = 58.9 bits (141), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 71/151 (47%), Gaps = 9/151 (5%)

Query: 145 LFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQ 204
           L L K  + S + +IK G    + G+ +  K    T+GV GL+RG   +++       + 
Sbjct: 57  LRLCKNEIGSDAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLY 116

Query: 205 LPIYNTAKNFLLRNDIMEDG--PSLHL-TASTISGLGVAVVMNPWDVILTRIYNQKGDL- 260
             +Y++ K  LL     E+   PS  L  A TIS    +    P D +  R+    G   
Sbjct: 117 FGLYDSLKPVLLTGSF-ENAFLPSFLLGWAVTISA---STTSYPLDTVRRRMMMTSGQAV 172

Query: 261 -YKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
            YKG IDC  + V  EG+ +L+KG  A +FR
Sbjct: 173 KYKGAIDCFQQIVSQEGVYSLFKGCGANIFR 203

 Score = 36.6 bits (83), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 53/136 (38%), Gaps = 22/136 (16%)

Query: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVM-----NKTFYPDQESHKVQSVGIN 127
            +G+ GL +G + + +  +   G   G Y+ ++ V+        F P            +
Sbjct: 92  TDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSFENAFLP------------S 139

Query: 128 VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF 187
              G A  I  +    PL  V+ R+   S     G+   Y G  +  + I   EGV  LF
Sbjct: 140 FLLGWAVTISASTTSYPLDTVRRRMMMTS-----GQAVKYKGAIDCFQQIVSQEGVYSLF 194

Query: 188 RGIDAAILRTGAGSSV 203
           +G  A I R  A + V
Sbjct: 195 KGCGANIFRGVAAAGV 210

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 123/304 (40%), Gaps = 46/304 (15%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLV 84
           GGLA+  A+    P++++K R+Q   +  A++ R      +    ++R      L+  + 
Sbjct: 18  GGLASVCAL---QPLDLLKTRLQ---QAQASSLRSVLREVRTTRELWRGTLPSALRTSIG 71

Query: 85  AAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSP 144
           +A +Y   LN SR        A    +  P  +S++      N+  GA S     ++  P
Sbjct: 72  SA-LYLSLLNYSRSALARGSEARTRSSLLPRLQSYQ------NLLTGALSRAAVGLVTMP 124

Query: 145 LFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQ 204
           + ++K R +S   A        Y G+    + I+ +EG +G F+G  A  LR    + + 
Sbjct: 125 ITVIKVRYESTLYA--------YNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLY 176

Query: 205 LPIYNTAKNFLLR------------------NDIMEDGPSLHLTASTISGLGVAVVMNPW 246
           + +Y  AK  L R                     M +G S  L+AS  + L       P+
Sbjct: 177 VLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTA-----PF 231

Query: 247 DVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTM 306
           D I TR+  Q   +  G +  L   V  E    L+ G   ++ R      +     E+ +
Sbjct: 232 DTIKTRMQLQSHPV--GFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELL 289

Query: 307 KLVH 310
           KL+H
Sbjct: 290 KLLH 293

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 81/200 (40%), Gaps = 22/200 (11%)

Query: 118 SHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTI 177
           S K   V  ++ +G   G+       PL L+KTRLQ          Q   + + + L+ +
Sbjct: 2   SEKAGGVPAHLVSGFFGGLASVCALQPLDLLKTRLQ----------QAQASSLRSVLREV 51

Query: 178 YMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSL--------HL 229
             T   + L+RG   + LRT  GS++ L + N +++ L R        SL        +L
Sbjct: 52  RTT---RELWRGTLPSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNL 108

Query: 230 TASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVF 289
               +S   V +V  P  VI  R Y      Y G  +      + EG    +KG  A   
Sbjct: 109 LTGALSRAAVGLVTMPITVIKVR-YESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTL 167

Query: 290 RIGPHTILCLTFLEQTMKLV 309
           R  P+  L +   EQ  +++
Sbjct: 168 RDAPYAGLYVLLYEQAKEML 187

>Scas_632.9
          Length = 292

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 62/291 (21%), Positives = 114/291 (39%), Gaps = 21/291 (7%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
           +  I+KS+ Q          G +A      +  P + VK+R+Q QG        I+   +
Sbjct: 6   DHPIEKSSVQNA--LSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGS------HIFPTTW 57

Query: 65  QAMGVVFRNEGI-RGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS 123
             +   + NEG+ RG  +G+ +        N +    Y     V+ K          V  
Sbjct: 58  SCIKYTYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKF-------TNVSP 110

Query: 124 VGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGV 183
           +   + +GA +G   + + +P+ L+K +LQ  +    +  Q  +T +   L  +   +G+
Sbjct: 111 LSNILLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGI 170

Query: 184 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLL-RNDIMEDGPSLHLTASTISGLGVAVV 242
            GL++G  +  +R   G       Y   K  L  R    E+     L +   +GL     
Sbjct: 171 LGLWQGQSSTFIRESLGGVAWFATYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFNAS 230

Query: 243 MNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
           + P D + + +  +   L    I+ + K +   GIT  Y+G    + R  P
Sbjct: 231 IFPADTVKSMMQTEHITL----INAVKKVLTTYGITGFYRGLGITLIRAVP 277

>Kwal_27.12599
          Length = 304

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 117/295 (39%), Gaps = 31/295 (10%)

Query: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVV---FRNEGIRGL 79
           TAGG+A    V V  P +  K+R+Q             T P  A+ VV    +NEG+RG 
Sbjct: 32  TAGGMAQ---VLVGQPFDTTKVRLQTS-----------TTPTTAVEVVKKLVKNEGLRGF 77

Query: 80  QKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGA 139
            KG +   +   A    + G  E ++     +     + HK  ++      G   G+  +
Sbjct: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRFFRGS---SADPHKTLTLPQYYICGFVGGVANS 134

Query: 140 VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199
            + SP+  V+ RLQ+ + +  + E   + G    L  I        L RG+   ILR   
Sbjct: 135 FLASPIEHVRIRLQTQTASGTVAE---FKGP---LDCINKLRANGALMRGLSPTILREAQ 188

Query: 200 GSSVQLPIYNT-AKNFLLRNDIMEDGPSLHLTA-STISGLGVAVVMNPWDVI--LTRIYN 255
           G +     Y     N + +     D P+  L     +SG+ + + + P DVI  L +  N
Sbjct: 189 GCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDN 248

Query: 256 QKGDLYKGPIDCLVKTVKIE-GITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309
            K  +    I  + + V  + G  + +KGF   + R  P         E  M+ +
Sbjct: 249 LKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAMRFL 303

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 79/184 (42%), Gaps = 21/184 (11%)

Query: 115 DQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGL 174
           DQ+ H    V  ++ AG A G+   ++G P    K RLQ+          T  T     +
Sbjct: 15  DQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT---------STTPTTAVEVV 65

Query: 175 KTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTI 234
           K +   EG++G ++G    ++  GA  S Q  +    K F  R    +   +L L    I
Sbjct: 66  KKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRF-FRGSSADPHKTLTLPQYYI 124

Query: 235 SGL--GVA--VVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITALYKGFEA 286
            G   GVA   + +P + +  R+  Q        +KGP+DC+ K ++  G  AL +G   
Sbjct: 125 CGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSP 181

Query: 287 QVFR 290
            + R
Sbjct: 182 TILR 185

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 103/243 (42%), Gaps = 23/243 (9%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQ---LQGELMAANQRIYTNPFQAMGVVFRNEGIR 77
           SF AGG+    AV   +P +++K+R Q       + A    I     Q  G +F N  ++
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNS-VK 96

Query: 78  GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGII 137
           G  KG++   +    +       Y+  + ++  TF   Q      ++G    AG  S I 
Sbjct: 97  GFYKGVIPPLLGVTPIFAVSFWGYDVGKKLV--TFNNKQGGSNELTMGQMAAAGFISAIP 154

Query: 138 GAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
             ++ +P   VK  LQ+ S    I             KTI    G+  LF+G  A + R 
Sbjct: 155 TTLVTAPTERVKVVLQTSSKGSFI----------QAAKTIVKEGGIASLFKGSLATLARD 204

Query: 198 GAGSSVQLPIYNTAKNFL----LRNDIMEDGPSLHLT---ASTISGLGVAVVMNPWDVIL 250
           G GS++    Y  +KN+L     R D  +D P   L    A  I+G+ + + + P D I 
Sbjct: 205 GPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIK 264

Query: 251 TRI 253
           T++
Sbjct: 265 TKL 267

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 80/184 (43%), Gaps = 27/184 (14%)

Query: 20  GSFTAGGLAACIAVT-VTNPIEVVKIRMQL--QGELMAANQRIYTNPFQAMGVVFRNEGI 76
           G   A G  + I  T VT P E VK+ +Q   +G  +           QA   + +  GI
Sbjct: 142 GQMAAAGFISAIPTTLVTAPTERVKVVLQTSSKGSFI-----------QAAKTIVKEGGI 190

Query: 77  RGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGI-NV-FAGAAS 134
             L KG +A        +      YE  +  +N +  P Q++ K + V I NV  AG  +
Sbjct: 191 ASLFKGSLATLARDGPGSALYFASYEISKNYLN-SRQPRQDAGKDEPVNILNVCLAGGIA 249

Query: 135 GIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEG-VKGLFRGIDAA 193
           G+   +   P+  +KT+LQ+ S    +   T         K IY+  G +KG F G+  A
Sbjct: 250 GMSMWLAVFPIDTIKTKLQASSTRQNMLSAT---------KEIYLQRGGIKGFFPGLGPA 300

Query: 194 ILRT 197
           +LR+
Sbjct: 301 LLRS 304

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 80/206 (38%), Gaps = 30/206 (14%)

Query: 114 PDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQ---------SYSNAIKIGEQ 164
           P  +S+ V+    +  AG   G+     G P  L+K R Q         + +N IK  + 
Sbjct: 25  PPIKSNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKT 84

Query: 165 THYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDG 224
                    +K    T  VKG ++G+   +L      +V    Y+  K  +  N+  + G
Sbjct: 85  Q--------VKGTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNN--KQG 134

Query: 225 PSLHLT------ASTISGLGVAVVMNPWDVILTRIY-NQKGDLYKGPIDCLVKTVKIEGI 277
            S  LT      A  IS +   +V  P + +   +  + KG      I      VK  GI
Sbjct: 135 GSNELTMGQMAAAGFISAIPTTLVTAPTERVKVVLQTSSKGSF----IQAAKTIVKEGGI 190

Query: 278 TALYKGFEAQVFRIGPHTILCLTFLE 303
            +L+KG  A + R GP + L     E
Sbjct: 191 ASLFKGSLATLARDGPGSALYFASYE 216

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 130/318 (40%), Gaps = 53/318 (16%)

Query: 35  VTNPIEVVKIRMQLQGELMAANQRIY------TNP------FQA----------MGVVFR 72
           VT P ++VK R+Q    L A   +        T P       QA          +G V++
Sbjct: 69  VTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYK 128

Query: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGA 132
            EG R L KGL    +  I         Y   + +  K F   QE+       I++ A A
Sbjct: 129 QEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPM-----IHLMAAA 183

Query: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQT--HYTGVWNGLKTIYMTEGVKGLFRGI 190
            +G   A   +P++L+KTR+Q      K G+ +   Y   W+ LK++   EG  GL++G+
Sbjct: 184 TAGWATATATNPIWLIKTRVQ----LDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGL 239

Query: 191 DAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTAST---------------IS 235
            A+ L +  G  +Q  +Y   K  +    I + G     T ST               ++
Sbjct: 240 SASYLGSVEG-ILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLA 298

Query: 236 GLGVAVVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITALYKGFEAQVFRI 291
               ++   P +V+ TR+     +     Y G +      +K EG+ ++Y G    + R 
Sbjct: 299 KFVASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRT 358

Query: 292 GPHTILCLTFLEQTMKLV 309
            P++I+     E  ++L+
Sbjct: 359 VPNSIIMFGTWEIVIRLL 376

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 85/197 (43%), Gaps = 27/197 (13%)

Query: 117 ESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQS-------YSNAIKIGE------ 163
           E+H      ++  AG   G+ GAV+  P  LVKTRLQS        S A+ I +      
Sbjct: 45  ENHPTVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPK 104

Query: 164 --------QTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
                    TH+      +  +Y  EG + LF+G+   ++      S+    Y T K+  
Sbjct: 105 SINYVIQAGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMY 164

Query: 216 LRN-DIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKG-----DLYKGPIDCLV 269
            +  +  ++ P +HL A+  +G   A   NP  +I TR+   K        YK   DCL 
Sbjct: 165 AKAFNNGQETPMIHLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLK 224

Query: 270 KTVKIEGITALYKGFEA 286
             ++ EG T LYKG  A
Sbjct: 225 SVIRNEGFTGLYKGLSA 241

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/311 (24%), Positives = 131/311 (42%), Gaps = 35/311 (11%)

Query: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQ 65
           DK Q   A+ +   GS +AG     + + V +P++ +  R      LM+ + +I T+  +
Sbjct: 5   DKKQSGLARLL---GSASAG----IMEIAVFHPVDTISKR------LMSNHTKI-TSGQE 50

Query: 66  AMGVVFRNEGIRGLQK-------GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQES 118
              V+FR+     L K       GL  A  Y++     + G        +NK +  D ++
Sbjct: 51  LNRVIFRDHFSEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDN 110

Query: 119 HKVQSVGINVFAGAASGIIG--AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKT 176
              +  G  + + AA  +IG   ++  PL ++K + Q+   + K            G   
Sbjct: 111 LFGEKTGKAMRSAAAGSLIGIGEIVLLPLDVLKIKRQTNPESFK----------GRGFIK 160

Query: 177 IYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLL-RNDIMEDGPSLHLTASTIS 235
           I   EG+  L+RG      R   GS         AK ++L   D  +   S +  +S + 
Sbjct: 161 ILRDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVG 220

Query: 236 GLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHT 295
                +V  P DVI TRI N+  D  +  +  +  T+K EG+TA +KG   ++   GP  
Sbjct: 221 ACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKL 280

Query: 296 ILCLTFLEQTM 306
           +     L Q++
Sbjct: 281 VFSFA-LAQSL 290

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 118/289 (40%), Gaps = 29/289 (10%)

Query: 28  AACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK------ 81
           A  + + V +P++ +  R      LM+ + +I ++  Q   V+FR      L K      
Sbjct: 19  AGILEIGVFHPVDTISKR------LMSNHTKIGSSS-QLNSVIFREHAAEPLSKRVFTLF 71

Query: 82  -GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIG-- 138
            GL  A  Y+I     + G        +N+ F  D ++   +  G  + +  A  +IG  
Sbjct: 72  PGLGYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGEKTGKALRSATAGSMIGIG 131

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
            ++  PL ++K + Q+   A K            G   I   EG+ GL+RG      R  
Sbjct: 132 EIVLLPLDVLKIKRQTNPEAFK----------GRGFVKILKDEGL-GLYRGWGWTAARNA 180

Query: 199 AGSSVQLPIYNTAKNFLL-RNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQK 257
            GS         AK ++L   D  +   S +  +S +      ++  P DVI TRI N+ 
Sbjct: 181 PGSFALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKTRIQNKN 240

Query: 258 GDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTM 306
            +  +     +  T+K EG +A +KG   ++   GP  +     L QT+
Sbjct: 241 FENPESGFTIVKNTLKNEGFSAFFKGLTPKLLTTGPKLVFSFA-LAQTL 288

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 121/303 (39%), Gaps = 39/303 (12%)

Query: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKG 82
           T+GG+A    V V  P ++ K+RMQ       A + I          + +NEG+    KG
Sbjct: 31  TSGGIAQ---VLVGQPFDITKVRMQTSSGSPTAIEVIKN--------LVKNEGLLAFYKG 79

Query: 83  LVAAYIYQIALNGSRLGFYEPI-RAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVM 141
            +   I   A    + G  E + R  +    Y DQ    +Q       +G+A+    A +
Sbjct: 80  TLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSAN----AFL 135

Query: 142 GSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201
            +P+  V+ RLQ  + A+   E   Y G  + +K +      K L RG  A ++RT  G 
Sbjct: 136 ATPIEHVRIRLQLQTKALAKAE---YRGSLDCMKKLLKQ---KALMRGFTATLMRTSHGF 189

Query: 202 SVQLPIY-----NTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQ 256
            V    Y     N  KN +LR DI    P         SG     +  P+DV+ + +   
Sbjct: 190 GVYFLTYEALIMNQNKNGVLRKDI---PPWKVCVFGAFSGAFFWAMTYPFDVVKSIM--- 243

Query: 257 KGDLYKGPIDC-----LVKTVK-IEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVH 310
           + D    P+       + K++    G  A  KGF   + R  P         E TM+L+ 
Sbjct: 244 QADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVTMRLLE 303

Query: 311 AFE 313
           + +
Sbjct: 304 SLD 306

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 79/174 (45%), Gaps = 25/174 (14%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYS---NAIKIGEQTHYTGVWNGLKTIYMTEGV 183
           ++ +G + GI   ++G P  + K R+Q+ S    AI++            +K +   EG+
Sbjct: 26  DIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPTAIEV------------IKNLVKNEGL 73

Query: 184 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLR-NDIMEDGPSL--HLTASTISGLGVA 240
              ++G    ++  GA  S Q  +    K + LR N   +   SL  + T   +SG   A
Sbjct: 74  LAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSANA 133

Query: 241 VVMNPWDVILTRIYNQKGDL----YKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
            +  P + +  R+  Q   L    Y+G +DC+ K +K +   AL +GF A + R
Sbjct: 134 FLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQK---ALMRGFTATLMR 184

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 76/184 (41%), Gaps = 13/184 (7%)

Query: 14  QKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN 73
           Q +S    +T G ++      +  PIE V+IR+QLQ + +A  +  Y      M  + + 
Sbjct: 114 QHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAE--YRGSLDCMKKLLKQ 171

Query: 74  EGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAA 133
              + L +G  A  +      G     YE +    NK     ++   +    + VF GA 
Sbjct: 172 ---KALMRGFTATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKD---IPPWKVCVF-GAF 224

Query: 134 SGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAA 193
           SG     M  P  +VK+ +Q    A ++    H   V+   K+I+ T G     +G    
Sbjct: 225 SGAFFWAMTYPFDVVKSIMQ----ADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPT 280

Query: 194 ILRT 197
           +LR+
Sbjct: 281 MLRS 284

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 7/70 (10%)

Query: 219 DIMEDGPSLH-----LTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVK 273
           D + D P        + + T  G+   +V  P+D+   R+    G      I+ +   VK
Sbjct: 12  DDLSDAPEFRKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGS--PTAIEVIKNLVK 69

Query: 274 IEGITALYKG 283
            EG+ A YKG
Sbjct: 70  NEGLLAFYKG 79

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 87/198 (43%), Gaps = 22/198 (11%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G +A   A  + NP + VK R+QL       N R++    Q    +++NEG        
Sbjct: 126 SGTIATIAADALMNPFDTVKQRLQLD-----TNLRVWNVTKQ----IYQNEGF----AAF 172

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
             +Y   +A+N     F   I    +K F P    + +    I+   G  SG   A + +
Sbjct: 173 YYSYPTTLAMNIPFAAFNFMIYESASKFFNPQNSYNPL----IHCLCGGISGATCAALTT 228

Query: 144 PLFLVKTRLQ---SYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAG 200
           PL  +KT LQ   S + +I+I +  +  G     + I    G KG +RG+   I+     
Sbjct: 229 PLDCIKTVLQVRGSETVSIEIMKDANTFG--RASRAILEVHGWKGFWRGLKPRIVANIPA 286

Query: 201 SSVQLPIYNTAKNFLLRN 218
           +++    Y  AK+FL++N
Sbjct: 287 TAISWTAYECAKHFLMKN 304

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 86/229 (37%), Gaps = 23/229 (10%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           AG  A  +  ++  PI+ +K R+Q  G     N+   T     +  +   EG   L KG+
Sbjct: 29  AGAFAGIMEHSLMFPIDALKTRVQAAG----LNKAASTGMISQISKISTMEGSMALWKGV 84

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYP-DQESHKVQSVGINVFAGAASGIIGAVMG 142
            +  +     +    G YE  +A   +   P D ++H+     +   +G  + I    + 
Sbjct: 85  QSVILGAGPAHAVYFGTYEFCKA---RLISPEDMQTHQPMKTAL---SGTIATIAADALM 138

Query: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           +P   VK RLQ  +N            VWN  K IY  EG    +      +      ++
Sbjct: 139 NPFDTVKQRLQLDTN----------LRVWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAA 188

Query: 203 VQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILT 251
               IY +A  F   N      P +H     ISG   A +  P D I T
Sbjct: 189 FNFMIYESASKFF--NPQNSYNPLIHCLCGGISGATCAALTTPLDCIKT 235

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 59/127 (46%), Gaps = 6/127 (4%)

Query: 128 VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF 187
           + AGA +GI+   +  P+  +KTR+Q+         +   TG+ + +  I   EG   L+
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQAAG-----LNKAASTGMISQISKISTMEGSMALW 81

Query: 188 RGIDAAILRTGAGSSVQLPIYNTAKNFLLR-NDIMEDGPSLHLTASTISGLGVAVVMNPW 246
           +G+ + IL  G   +V    Y   K  L+   D+    P     + TI+ +    +MNP+
Sbjct: 82  KGVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTALSGTIATIAADALMNPF 141

Query: 247 DVILTRI 253
           D +  R+
Sbjct: 142 DTVKQRL 148

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 6/70 (8%)

Query: 228 HLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYK----GPIDCLVKTVKIEGITALYKG 283
            L A   +G+    +M P D + TR+  Q   L K    G I  + K   +EG  AL+KG
Sbjct: 26  QLLAGAFAGIMEHSLMFPIDALKTRV--QAAGLNKAASTGMISQISKISTMEGSMALWKG 83

Query: 284 FEAQVFRIGP 293
            ++ +   GP
Sbjct: 84  VQSVILGAGP 93

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 132/325 (40%), Gaps = 43/325 (13%)

Query: 19  FGSFTAGGLAACIAVTVTNPIEVVKI----RMQLQGELMAANQRIY-TNP---------- 63
           FG F AGG +  I+ T T P + +K+    R  L   L+ +  ++   NP          
Sbjct: 196 FGFFIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSP 255

Query: 64  -FQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQ 122
             +A   ++R  GIR    G     I     +  + G +E  + +M    + +   H  +
Sbjct: 256 LIKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMA---HLEGVHHTSE 312

Query: 123 SVGINVF-AGAASGIIGAVMGSPLFLVKTRLQS--YSNAIKIGEQTHYTGVWNGLKTIYM 179
               + + AG   G++      P+  +K R+Q      A+K  E    T      + +Y 
Sbjct: 313 LSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTA-----RQMYR 367

Query: 180 TEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKN-FLLRNDIMEDGPSLHLTAST----- 233
             G+K  +RG+   ++     +++ L  ++  K  ++ R   M   P   +T S      
Sbjct: 368 DGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLP 427

Query: 234 ---ISGLGVAVVMNPWDVILTRIYNQ----KGDLYKGPIDCLVKTVKIEGITALYKGFEA 286
               SG   A V+ P +++ TR+  Q        Y G  D L KTV+ EG   L+KG   
Sbjct: 428 MGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVP 487

Query: 287 QVFRIGPH---TILCLTFLEQTMKL 308
            + ++ P    + LC    ++ MKL
Sbjct: 488 NLAKVCPAVSISYLCYENFKRLMKL 512

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 94/214 (43%), Gaps = 28/214 (13%)

Query: 15  KVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQ--GELMAANQRIYTNPFQAMGVVFR 72
           ++SKF ++ AGG+   +A     PI+ +K R+Q       +  N+ + +   Q    ++R
Sbjct: 312 ELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQ----MYR 367

Query: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESH----KVQSVGINV 128
           + G++   +G+    +         LG +  +     K +Y  +++      V  V I+ 
Sbjct: 368 DGGLKLFYRGVTVGVMGIFPYAALDLGTFSAL-----KKWYIARQAKMTGVPVDQVTISN 422

Query: 129 F----AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTH---YTGVWNGLKTIYMTE 181
           F     GA SG +GA +  P+ L++TRLQ+       G   H   YTG  + L      E
Sbjct: 423 FIVLPMGAFSGTVGATVVYPINLLRTRLQAQ------GTYAHPHTYTGFRDVLWKTVQRE 476

Query: 182 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
           G +GLF+G+   + +     S+    Y   K  +
Sbjct: 477 GYQGLFKGLVPNLAKVCPAVSISYLCYENFKRLM 510

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 65/131 (49%), Gaps = 3/131 (2%)

Query: 163 EQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIME 222
           E+   T ++  ++ +  T G    F+G    I R    S+V+   Y T K  +  N  + 
Sbjct: 186 EKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMISPNKPLS 245

Query: 223 DGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQ-KGDLYKGPIDCLVKTVKIEGITALY 281
           +  +  +     S   V  +  P DV+ TR+ ++    LY+  ++C+ +T   EG+T+L+
Sbjct: 246 EYYAFGI--GVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLW 303

Query: 282 KGFEAQVFRIG 292
           KG+  ++F++G
Sbjct: 304 KGWVPRLFKVG 314

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 11  SAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVV 70
           S  + +S++ +F  G  ++C  V +T PI+VVK RMQ +         +Y N    +   
Sbjct: 239 SPNKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSK-----YTWSLYRNSLNCVYRT 293

Query: 71  FRNEGIRGLQKGLVAAYIYQIALNGS-RLGFYEPIRAVM 108
           F  EG+  L KG V   ++++ L+G    G Y+ +  +M
Sbjct: 294 FIEEGLTSLWKGWVPR-LFKVGLSGGVSFGVYQYVDNLM 331

>Scas_662.12
          Length = 308

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 81/178 (45%), Gaps = 12/178 (6%)

Query: 119 HKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIY 178
           H++  +   + +G ++G +  ++  PL L+K RLQ  +       Q  YT + N L    
Sbjct: 2   HELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNS 61

Query: 179 MTEG--------VKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIME-DGPSLHL 229
              G        +K  +RG+   +L      S+   IYN+ K+++ +N+ +  +  ++ L
Sbjct: 62  KKMGSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIFL 121

Query: 230 TASTISGLGVAVVMNPWDVILTRIYN---QKGDLYKGPIDCLVKTVKIEGITALYKGF 284
           T+  ISG+   ++ NP  VI TRI +      D YK         +  EG  A++ G 
Sbjct: 122 TSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGL 179

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 130/302 (43%), Gaps = 40/302 (13%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAA-NQRIYT-------NPFQAMGV---VFR 72
           +G  A  +   + +P++++K+R+QL        +Q+ YT       N  + MG    ++ 
Sbjct: 13  SGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPIYN 72

Query: 73  --NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFA 130
              E  RGL   L+         N      Y  I        + +   H   +  I + +
Sbjct: 73  LIKESYRGLPINLLG--------NAVAWSLYFTIYNSTKDYMFQNNYLHN-NNTTIFLTS 123

Query: 131 GAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGI 190
           G  SGI   ++ +PL+++KTR+ S S       +  Y  + +G K++   EG K ++ G+
Sbjct: 124 GLISGISTTLLTNPLWVIKTRIMSTSRH----HKDSYKSIRHGFKSLLTKEGPKAIWMGL 179

Query: 191 DAAILRTGAGSSVQLPIYNTAK-NFLLR-NDIMEDGPSLHLTASTISGLG-VAVVMN--P 245
             ++L    G+ +   IY+  K +F +  N   +D  + +L    IS L  +  VM+  P
Sbjct: 180 LPSLLGVSQGA-IYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYP 238

Query: 246 WDVILTRIYNQKGDLYKGP------IDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCL 299
           + ++ + +   +      P      I  + K  +  GI  LYKG  A + R  P T  C+
Sbjct: 239 FQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPST--CI 296

Query: 300 TF 301
           TF
Sbjct: 297 TF 298

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 93/199 (46%), Gaps = 15/199 (7%)

Query: 22  FTAGGLAACIAVTV-TNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN----EGI 76
           F   GL + I+ T+ TNP+ V+K R+        +  R + + ++++   F++    EG 
Sbjct: 120 FLTSGLISGISTTLLTNPLWVIKTRIM-------STSRHHKDSYKSIRHGFKSLLTKEGP 172

Query: 77  RGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGI 136
           + +  GL+ + +  ++        Y+ ++   N      ++ +   ++ I V   + S +
Sbjct: 173 KAIWMGLLPSLL-GVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKI-VLISSLSKM 230

Query: 137 IGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILR 196
           +  +   P  L+K+ LQ++ +      Q  Y  +   ++ IY   G+KGL++G+ A +LR
Sbjct: 231 LSVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFI-TLIRKIYRDNGIKGLYKGLSANLLR 289

Query: 197 TGAGSSVQLPIYNTAKNFL 215
               + +   IY   K+ L
Sbjct: 290 AIPSTCITFCIYENFKSKL 308

>Scas_379.2
          Length = 301

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 78/194 (40%), Gaps = 18/194 (9%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G +A   A  + NP + +K RMQL            T  +     +++NEG        
Sbjct: 124 SGTVATIAADALMNPFDTLKQRMQLNTN---------TTVWNVTKQIYKNEGF----SAF 170

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
             +Y   +A+N     F   I     K F P  + + +    ++  +G  SG   A + +
Sbjct: 171 YYSYPTTLAMNIPFAAFNFMIYESATKFFNPTNDYNPL----VHCLSGGLSGATCAAITT 226

Query: 144 PLFLVKTRLQSY-SNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           PL  +KT LQ   S ++ +             K IY   G KG +RG+   +      ++
Sbjct: 227 PLDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATA 286

Query: 203 VQLPIYNTAKNFLL 216
           +    Y  AK+FLL
Sbjct: 287 IAWTAYECAKHFLL 300

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/288 (20%), Positives = 106/288 (36%), Gaps = 31/288 (10%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           AG  A  +  +V  PI+ +K R+Q      + + +  +N    M  +   EG   L KG+
Sbjct: 29  AGAFAGIMEHSVMFPIDALKTRIQ------STSAKSTSNMLSQMAKISTAEGSLALWKGV 82

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
            +  +     +      YE       K +  D++  +         +G  + I    + +
Sbjct: 83  QSVILGAGPAHAVYFATYE-----YTKKYLIDEKDMQTHQPLKTALSGTVATIAADALMN 137

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
           P   +K R+Q  +N          T VWN  K IY  EG    +      +      ++ 
Sbjct: 138 PFDTLKQRMQLNTN----------TTVWNVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAF 187

Query: 204 QLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKG 263
              IY +A  F   N   +  P +H  +  +SG   A +  P D I T +  +  +    
Sbjct: 188 NFMIYESATKFF--NPTNDYNPLVHCLSGGLSGATCAAITTPLDCIKTVLQVRGSESVSL 245

Query: 264 PI----DCLVKTVK----IEGITALYKGFEAQVFRIGPHTILCLTFLE 303
            +    +   K  K    + G    ++G + +VF   P T +  T  E
Sbjct: 246 QVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYE 293

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 72/166 (43%), Gaps = 27/166 (16%)

Query: 128 VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF 187
           + AGA +GI+   +  P+  +KTR+QS S      + T  + + + +  I   EG   L+
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQSTS-----AKST--SNMLSQMAKISTAEGSLALW 79

Query: 188 RGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTAS-TISGLGVAVVMNPW 246
           +G+ + IL  G   +V    Y   K +L+    M+    L    S T++ +    +MNP+
Sbjct: 80  KGVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTVATIAADALMNPF 139

Query: 247 DVILTR--------IYNQKGDLYKGPIDCLVKTVKIEGITALYKGF 284
           D +  R        ++N    +YK            EG +A Y  +
Sbjct: 140 DTLKQRMQLNTNTTVWNVTKQIYKN-----------EGFSAFYYSY 174

 Score = 32.0 bits (71), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 2/82 (2%)

Query: 222 EDGPSLH-LTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITAL 280
           +  P  H L A   +G+    VM P D + TRI +         +  + K    EG  AL
Sbjct: 19  DSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLAL 78

Query: 281 YKGFEAQVFRIGP-HTILCLTF 301
           +KG ++ +   GP H +   T+
Sbjct: 79  WKGVQSVILGAGPAHAVYFATY 100

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/282 (23%), Positives = 112/282 (39%), Gaps = 15/282 (5%)

Query: 28  AACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAY 87
           A  + + V +P++ +  R+      +A+  ++ +  F+          +  L  GL  A 
Sbjct: 20  AGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSVIFRDFASEPLGRRLLSLFPGLGYAA 79

Query: 88  IYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIG--AVMGSPL 145
            Y+I     + G        +NK F  D +    +  G  + +  A  +IG   ++  PL
Sbjct: 80  AYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAGSLIGIGEIVLLPL 139

Query: 146 FLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQL 205
            ++K + Q+   + K            G   I   EG  GL+RG      R   GS    
Sbjct: 140 DVLKIKRQTNPESFK----------GRGFLKIIKDEGF-GLYRGWGWTAARNAPGSFALF 188

Query: 206 PIYNTAKNFLL-RNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGP 264
                AK ++L   D  +   S +  +S +      +V  P DVI TRI N+  D  +  
Sbjct: 189 GGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESG 248

Query: 265 IDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTM 306
              +  T+K EG TA +KG   ++   GP  +     L QT+
Sbjct: 249 FKIIKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFA-LAQTL 289

>Kwal_23.3042
          Length = 542

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 79/329 (24%), Positives = 138/329 (41%), Gaps = 51/329 (15%)

Query: 19  FGSFTAGGLAACIAVTVTNPIEVVKI----RMQLQGELMAANQRIYT-NP---------- 63
           FG F AGG++  ++ T T P + +K+    R  L    + +   I   NP          
Sbjct: 225 FGFFIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSP 284

Query: 64  -FQAMGVVFRNEGIRGLQ--KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHK 120
             +A   ++R  GIR      GL A  ++    +  + G +E  + +M       Q    
Sbjct: 285 LVKAATTLYRQGGIRAFYVGNGLNAMKVF--PESAIKFGSFELAKRLMA------QLEGV 336

Query: 121 VQSVGINVFAGAASGIIGAVMGS----PLFLVKTRLQSYS-NAIKIGEQTHYTGVWNGLK 175
             + G++ F+   +G +G VM      P+  +K R+Q    N    G Q     + +  K
Sbjct: 337 QDTAGLSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQL----LISTAK 392

Query: 176 TIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKN-FLLRNDIMEDGPSLHLTASTI 234
            +Y   G++  +RGI   I+     +++ L  ++  K  ++ R   +   P   +T S +
Sbjct: 393 DMYKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNM 452

Query: 235 --------SGLGVAVVMNPWDVILTRIYNQ----KGDLYKGPIDCLVKTVKIEGITALYK 282
                   SG   A  + P +++ TR+  Q        Y G  D L+KTV+ EG   L+K
Sbjct: 453 FVLLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFK 512

Query: 283 GFEAQVFRIGPH---TILCLTFLEQTMKL 308
           G    + ++ P    + LC   L++ MKL
Sbjct: 513 GLVPNLAKVCPAVSISYLCYENLKRGMKL 541

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 89/216 (41%), Gaps = 26/216 (12%)

Query: 8   IQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQ---LQGELMAANQRIYTNPF 64
           +Q +A   +S+F ++ AGGL   +A     PI+ +K R+Q   L  E       I T   
Sbjct: 336 VQDTAG--LSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLIST--- 390

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESH----- 119
                +++  G+R   +G+    +         LG +  +     K +Y  +++      
Sbjct: 391 --AKDMYKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSAL-----KKWYIARQARLTGLP 443

Query: 120 KVQSVGINVFA---GAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKT 176
           + Q    N+F    GA SG +GA    P+ L++TRLQ+            Y G  + L  
Sbjct: 444 EDQVTMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQGT---FAHPHRYNGFRDVLLK 500

Query: 177 IYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAK 212
               EG +GLF+G+   + +     S+    Y   K
Sbjct: 501 TVQREGYQGLFKGLVPNLAKVCPAVSISYLCYENLK 536

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 85/195 (43%), Gaps = 16/195 (8%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGI-RGLQKGL 83
           GG+A  +   V  P + VK+R+Q Q      +  ++   +  +   ++ EG+ RG  +G+
Sbjct: 15  GGVAGSLGKLVEYPFDTVKVRLQTQ------SAALFPTTWSCVSHTYKQEGLWRGFYQGM 68

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
            +        +      +   +AV+    Y      KV      VFAGA +G   + + +
Sbjct: 69  ASPVFGAFLEHAVLFVSFNRAQAVLENC-YSCGPLEKV------VFAGAIAGACTSYVLT 121

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
           P+ LVK +LQ  SN   +     YT V   L+ I    G+ GL++G     +R  AG +V
Sbjct: 122 PVELVKCKLQ-VSNLTGV-SGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAV 179

Query: 204 QLPIYNTAKNFLLRN 218
               Y   K +L R 
Sbjct: 180 WFTAYEVLKGWLARR 194

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 36/189 (19%), Positives = 73/189 (38%), Gaps = 21/189 (11%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           AG +A      V  P+E+VK ++Q+      +  R YT     +  + +  G+ GL +G 
Sbjct: 108 AGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPR-YTAVLPTLRAIVKQNGLGGLWQGQ 166

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
              +I + A        YE ++  + +                    G+    +  ++ S
Sbjct: 167 SGTFIRESAGGAVWFTAYEVLKGWLARR------------------RGSTENTVWELLAS 208

Query: 144 PLFLVKTRLQSY--SNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201
                     S   ++ +K   QT + G+   ++T+    G  G +RG+   +LR    +
Sbjct: 209 GAGAGAAFHASIFPADTVKSTMQTEHLGLGPAVRTVLKKHGPTGFYRGVGITLLRALPAN 268

Query: 202 SVQLPIYNT 210
           +V   +Y +
Sbjct: 269 AVIFYVYES 277

>Kwal_33.14050
          Length = 314

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 61/291 (20%), Positives = 113/291 (38%), Gaps = 26/291 (8%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQ-LQGELMAANQ--RIYTNPFQAMGVVFRNEGIRGLQ 80
           AG  A  +  ++  PI+ +K RMQ L   + +AN   ++ +N  Q +  +   EG   L 
Sbjct: 22  AGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMALW 81

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140
           KG+ +  +     +      YE     M K++  D +  +         +G A+ +   +
Sbjct: 82  KGVQSVILGAGPAHAVYFATYE-----MCKSYLIDPQDFQTHQPLKTAASGIAATVAADL 136

Query: 141 MGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAG 200
           + +P   +K R+Q     ++   +     +W+    IY  EG+   F      I      
Sbjct: 137 LMNPFDTIKQRMQ-----LRTFSKDR---MWSVASRIYRNEGLAAFFYSYPTTIAMNIPF 188

Query: 201 SSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGDL 260
           ++    IY +A  F   N      P +H     ISG   A +  P D I T +  +  + 
Sbjct: 189 AAFNFAIYESATKFF--NPENTYNPLIHCLCGGISGATCAAITTPLDCIKTVLQVRGSES 246

Query: 261 YKGPI----DCLVKTV----KIEGITALYKGFEAQVFRIGPHTILCLTFLE 303
              P+    D   +      K+ G +  ++G + ++    P T +  T  E
Sbjct: 247 VVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAYE 297

>Kwal_47.19228
          Length = 281

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 59/120 (49%), Gaps = 3/120 (2%)

Query: 174 LKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTAST 233
           ++ IY + G++G  +G    I+R  + S+V+   Y + K  +  N  + +  +  L    
Sbjct: 135 VQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEYYAFAL--GF 192

Query: 234 ISGLGVAVVMNPWDVILTRIYNQ-KGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIG 292
           IS   V  V  P DVI TR+ ++     YK  ++C  +    EG T  +KG+  ++ ++G
Sbjct: 193 ISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMKVG 252

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 7/111 (6%)

Query: 11  SAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVV 70
           S  + ++++ +F  G +++C  V VT PI+V+K RM  Q +   +N   Y N       +
Sbjct: 177 SPNKPLNEYYAFALGFISSCAVVAVTQPIDVIKTRM--QSKYTWSN---YKNSLNCAYRI 231

Query: 71  FRNEGIRGLQKGLVAAYIYQIALNGS-RLGFYEPIRAVMNKTFYPDQESHK 120
           F  EG     KG  A  + ++ L+G    G Y+ +  +M       + SH+
Sbjct: 232 FVEEGFTKFWKGW-APRLMKVGLSGGVSFGVYQYVDNLMKAVNGQQEMSHE 281

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 65/153 (42%), Gaps = 28/153 (18%)

Query: 70  VFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF 129
           ++R+ GIRG  +G +   I Q + +  R   Y  ++ +++    P++         +N +
Sbjct: 138 IYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMIS----PNKP--------LNEY 185

Query: 130 AGAASGIIGAV----MGSPLFLVKTRLQS---YSNAIKIGEQTHYTGVWNGLKTIYMTEG 182
              A G I +     +  P+ ++KTR+QS   +SN         Y    N    I++ EG
Sbjct: 186 YAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSN---------YKNSLNCAYRIFVEEG 236

Query: 183 VKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
               ++G    +++ G    V   +Y    N +
Sbjct: 237 FTKFWKGWAPRLMKVGLSGGVSFGVYQYVDNLM 269

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 56.6 bits (135), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 63/131 (48%), Gaps = 3/131 (2%)

Query: 163 EQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIME 222
           E+   +  ++ +K IY+T G++G  +G    I R    S+V+   Y + K  +  N  + 
Sbjct: 263 EEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKPLN 322

Query: 223 DGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGDL-YKGPIDCLVKTVKIEGITALY 281
           +  +  L    IS   V  V  P DVI TR+ ++     YK  ++C  +    EGI   +
Sbjct: 323 EYYAFVL--GFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFW 380

Query: 282 KGFEAQVFRIG 292
           KG+  ++ ++G
Sbjct: 381 KGWAPRLMKVG 391

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 54/111 (48%), Gaps = 7/111 (6%)

Query: 11  SAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVV 70
           S  + ++++ +F  G +++C  V VT PI+V+K RM  Q +   AN   Y N       +
Sbjct: 316 SPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRM--QSKYAWAN---YKNSLNCAYRI 370

Query: 71  FRNEGIRGLQKGLVAAYIYQIALNGS-RLGFYEPIRAVMNKTFYPDQESHK 120
           F  EGI    KG  A  + ++ L+G    G Y+ +  ++    +  Q  H+
Sbjct: 371 FVEEGIPKFWKGW-APRLMKVGLSGGVSFGVYQYVENLIKLMAHEKQLGHE 420

>Scas_687.15*
          Length = 328

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 64/126 (50%), Gaps = 3/126 (2%)

Query: 168 TGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSL 227
           + +++ +K IY+T G++G  +G    + R  + S+V+   Y T K  +     + +  + 
Sbjct: 178 SNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQPLNEVYAF 237

Query: 228 HLTASTISGLGVAVVMNPWDVILTRIYNQKGD-LYKGPIDCLVKTVKIEGITALYKGFEA 286
            +     S   V  +  P DV+ TR+ ++     YK  ++C  +    EG+ +L+KG+  
Sbjct: 238 GI--GLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMVSLWKGWLP 295

Query: 287 QVFRIG 292
           ++F++G
Sbjct: 296 RLFKVG 301

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 11  SAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVV 70
           S  Q +++  +F  G  ++C  V +T PI+VVK RMQ +          Y N       V
Sbjct: 226 SPTQPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSK-----TAHYFYKNSLNCAYRV 280

Query: 71  FRNEGIRGLQKGLVAAYIYQIALNG 95
           F  EG+  L KG +   ++++ L+G
Sbjct: 281 FVEEGMVSLWKGWLPR-LFKVGLSG 304

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 57/141 (40%), Gaps = 19/141 (13%)

Query: 120 KVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYM 179
           K   V I + AG+A+ +    +  P   +KT           G Q H   V  G K    
Sbjct: 4   KQTDVPIQILAGSAAAVFETTLTYPFEFLKT-----------GFQLHRRTV--GAKPFEA 50

Query: 180 TEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL----LRNDIMEDGPSLHLTASTIS 235
              +K  F G  A  L     +SV+   ++ A   L    L  D +  GP L L A  ++
Sbjct: 51  LRPIKVYFAGCTALNLSAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRL-LLAGILT 109

Query: 236 GLGVAVVMNPWD-VILTRIYN 255
           G   ++ + P++ V +T I N
Sbjct: 110 GAVESLCIIPFENVKVTMIEN 130

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 113/278 (40%), Gaps = 40/278 (14%)

Query: 60  YTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESH 119
           + + ++A   +   EG+  L +GL    +  I  N      YE  R         D    
Sbjct: 97  FNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFR---------DHSPM 147

Query: 120 KVQSVGIN-VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIK-IGEQTHYTGVWNGLKTI 177
           +     +N +F GA + ++ A   +PL L+KTRLQS   + K    Q  +  +    +  
Sbjct: 148 RDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNE 207

Query: 178 YMTEGVKGLFRGIDAAILRTGAGSSVQLPIYN-TAKNFLLRNDIMEDGPSLHLTAS---- 232
             + G K LF+G++  + R    S++    Y    KNF +  D  E     +L+ +    
Sbjct: 208 IRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWI--DFSEQCLRWNLSPNWDFF 265

Query: 233 -------TISGLGVAVVMNPWDVILTRIY-------NQKGDLY--------KGPIDCLVK 270
                  ++SG   A++ +P+DV  TR+         Q+  L         +G    L  
Sbjct: 266 INSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYN 325

Query: 271 TVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKL 308
             + EG  ALY G   +V +I P   + ++  E + +L
Sbjct: 326 IKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRL 363

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 81/210 (38%), Gaps = 22/210 (10%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQL--QGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK 81
            G  A  +A T   P+E++K R+Q   +       Q ++ +  +      R+ G + L K
Sbjct: 159 CGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFK 218

Query: 82  GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQ-------SVGINVF-AGAA 133
           GL       +  +    G YE       K F+ D     ++          IN F  G+ 
Sbjct: 219 GLEITLWRDVPFSAIYWGSYE----FYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSV 274

Query: 134 SGIIGAVMGSPLFLVKTRLQ--------SYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185
           SG   A++  P  + KTR+Q          +  +   ++    G++  L  I  TEG   
Sbjct: 275 SGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGA 334

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
           L+ G+   +++     ++ +  Y  +K   
Sbjct: 335 LYTGLIPRVMKIAPSCAIMISTYELSKRLF 364

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 82/198 (41%), Gaps = 13/198 (6%)

Query: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK 81
           +  G  + C    +  PIE V+IR+QLQ + +A  +  Y      M  + +      L +
Sbjct: 122 YVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAE--YQGSLDCMRKLLKQGA---LMR 176

Query: 82  GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVM 141
           G  A  +      G     YE + A  +K   P ++   +    + +F GA SG     M
Sbjct: 177 GFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKD---IAPWKVCIF-GAFSGACYWAM 232

Query: 142 GSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201
             P+ +VK+ +QS     ++    H T VW   K+IY T G +   +G   A+LR+   +
Sbjct: 233 AYPIDVVKSIMQSD----RLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVN 288

Query: 202 SVQLPIYNTAKNFLLRND 219
                 +      L R D
Sbjct: 289 GATFATFEMTMRLLERVD 306

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 77/174 (44%), Gaps = 25/174 (14%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           ++ +G A GI   ++G P  + K R+Q+ +     G  T    V + +K     EG+ G 
Sbjct: 26  DILSGTAGGIAQVLVGQPFDITKVRMQTSA-----GSATAVDVVTSLIK----NEGILGF 76

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLT------ASTISGLGVA 240
           ++G  A ++  GA  S Q  +    K    R   M   PS  L+          SG   A
Sbjct: 77  YKGTLAPLVGVGACVSCQFGVNEAMKRRFRR---MNGDPSKPLSLKQYYVCGVASGCANA 133

Query: 241 VVMNPWDVILTRIYNQKGDL----YKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
            +  P + +  R+  Q   L    Y+G +DC+ K +K +G  AL +GF A + R
Sbjct: 134 FLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLK-QG--ALMRGFTATLMR 184

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 8/91 (8%)

Query: 12  AAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVF 71
           A  KV  FG+F+     A     +  PI+VVK  MQ    +   +    TN +Q    ++
Sbjct: 214 APWKVCIFGAFSGACYWA-----MAYPIDVVKSIMQSDRLVSPVHG---TNVWQVAKSIY 265

Query: 72  RNEGIRGLQKGLVAAYIYQIALNGSRLGFYE 102
              G R   KG + A +  + +NG+    +E
Sbjct: 266 TTRGKRAFIKGFMPAMLRSLPVNGATFATFE 296

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 3/79 (3%)

Query: 229 LTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQV 288
           + + T  G+   +V  P+D+   R+    G      +D +   +K EGI   YKG  A +
Sbjct: 27  ILSGTAGGIAQVLVGQPFDITKVRMQTSAGS--ATAVDVVTSLIKNEGILGFYKGTLAPL 84

Query: 289 FRIGPHTILCLTFLEQTMK 307
             +G   + C   + + MK
Sbjct: 85  VGVGA-CVSCQFGVNEAMK 102

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 77/326 (23%), Positives = 139/326 (42%), Gaps = 45/326 (13%)

Query: 19  FGSFTAGGLAACIAVTVTNPIEVVKI----RMQLQGELMAANQRIYT-NPF--------- 64
           FG F AGG++  I+ T T P + +K+    R  L   L+ + + +   NP          
Sbjct: 201 FGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSP 260

Query: 65  --QAMGVVFRNEGIRGLQ--KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHK 120
             +A+  ++R  GI+      GL A  ++  +    + G +E  + +M K    + +  K
Sbjct: 261 LVKAIISLYRQGGIKSFYVGNGLNALKVFPES--SIKFGSFEITKKLMTKV--ENCKDTK 316

Query: 121 VQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYS-NAIKIGEQTHYTGVWNGLKTIYM 179
             S      AG  +G+       P+  +K R+Q    NA   G +     +    K +Y 
Sbjct: 317 DLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKL----MIQTAKEMYT 372

Query: 180 TEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLL---------RNDIMEDGPSLHLT 230
             G+K  +RG+   +L     +++ L  ++  K + +         + + +E    + L 
Sbjct: 373 EGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLP 432

Query: 231 ASTISGLGVAVVMNPWDVILTRIYNQKGDL-----YKGPIDCLVKTVKIEGITALYKGFE 285
               SG   A V+ P +++ TR+  Q G       Y G  D L+KT++ EG   L+KG  
Sbjct: 433 MGAFSGTFGATVVYPINLLRTRLQAQ-GTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLV 491

Query: 286 AQVFRIGPH---TILCLTFLEQTMKL 308
             + ++ P    + LC   L++ MKL
Sbjct: 492 PTLAKVCPAVSISYLCYENLKKLMKL 517

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 85/208 (40%), Gaps = 14/208 (6%)

Query: 14  QKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQ---LQGELMAANQRIYTNPFQAMGVV 70
           + +SK  +F AGGLA   A     PI+ +K RMQ   L  EL      I     Q    +
Sbjct: 316 KDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMI-----QTAKEM 370

Query: 71  FRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRA--VMNKTFYPDQESHKVQSVGINV 128
           +   G++   +G+    +         LG +  ++   + +K    +++   V+   + V
Sbjct: 371 YTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVV 430

Query: 129 FA-GAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF 187
              GA SG  GA +  P+ L++TRLQ+            Y G  + L      EG  GLF
Sbjct: 431 LPMGAFSGTFGATVVYPINLLRTRLQAQGT---FAHPYRYDGFRDVLLKTIQREGYPGLF 487

Query: 188 RGIDAAILRTGAGSSVQLPIYNTAKNFL 215
           +G+   + +     S+    Y   K  +
Sbjct: 488 KGLVPTLAKVCPAVSISYLCYENLKKLM 515

>Kwal_23.3529
          Length = 395

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 87/187 (46%), Gaps = 18/187 (9%)

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK-GLFRGIDAAILRT 197
           +VM S L  VKTR Q   NA K      Y  + +  + I+M EG++ GL+ G  AA+L +
Sbjct: 101 SVMHS-LDTVKTRQQGAPNAPK------YRNMISAYQKIFMEEGIRRGLYGGYTAAMLGS 153

Query: 198 GAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRI---- 253
              +++    Y   K  L+ +  + +  S HLTA     L  +VV  P +V+ TR+    
Sbjct: 154 FPSAAIFFGTYELTKRKLIDDWGVNETLS-HLTAGLSGDLVSSVVYVPSEVLKTRLQLQG 212

Query: 254 -YN----QKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKL 308
            YN      G  Y+   D +   V++EG   L+ G++A + R  P +     F E+  + 
Sbjct: 213 CYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQW 272

Query: 309 VHAFESK 315
               E K
Sbjct: 273 AFTLEGK 279

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 88/214 (41%), Gaps = 33/214 (15%)

Query: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN--------- 73
           TAG     ++  V  P EV+K R+QLQG         Y NP    G  +RN         
Sbjct: 185 TAGLSGDLVSSVVYVPSEVLKTRLQLQG--------CYNNPHFHSGYNYRNLRDAITAIV 236

Query: 74  --EGIRGLQKGLVAAYIYQIALNGSRLGFYEPIR----AVMNKTFYPDQESHKVQSVGIN 127
             EG + L  G  A     +  +  +  FYE  R     +  KT  P Q+   +  +   
Sbjct: 237 RLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLEGKT--PSQDLSLLNELLTG 294

Query: 128 VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWN----GLKTIYMTEGV 183
             AG  +GII     +P+ ++KTR+Q+   +    + T    + N    GL  +Y +EG 
Sbjct: 295 AAAGGLAGIIT----TPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGT 350

Query: 184 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLR 217
            G F G+    + T   SS+ L +Y      L R
Sbjct: 351 LGFFSGVGPRFIWTSIQSSIMLLLYQVTLKSLDR 384

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 105/259 (40%), Gaps = 23/259 (8%)

Query: 34  TVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIR-GLQKGLVAAYIYQIA 92
           +V + ++ VK R Q      A N   Y N   A   +F  EGIR GL  G  AA +    
Sbjct: 101 SVMHSLDTVKTRQQ-----GAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFP 155

Query: 93  LNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRL 152
                 G YE    +  +    D   ++  S   ++ AG +  ++ +V+  P  ++KTRL
Sbjct: 156 SAAIFFGTYE----LTKRKLIDDWGVNETLS---HLTAGLSGDLVSSVVYVPSEVLKTRL 208

Query: 153 Q---SYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYN 209
           Q    Y+N        +Y  + + +  I   EG + LF G  A + R    S+ Q   Y 
Sbjct: 209 QLQGCYNNP-HFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYE 267

Query: 210 TAKN--FLLRNDIMEDGPSL--HLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPI 265
             +   F L         SL   L     +G    ++  P DVI TRI  Q         
Sbjct: 268 KFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDS 327

Query: 266 DCLVKTVK--IEGITALYK 282
             LV+     I+G+TA+Y+
Sbjct: 328 TRLVRIENSLIKGLTAVYR 346

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 10  KSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQ-----RIYTNPF 64
           K+ +Q +S       G  A  +A  +T P++V+K R+Q Q     A+      RI  +  
Sbjct: 279 KTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLI 338

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIY 89
           + +  V+R+EG  G   G+   +I+
Sbjct: 339 KGLTAVYRSEGTLGFFSGVGPRFIW 363

>Scas_718.5
          Length = 324

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 122/298 (40%), Gaps = 32/298 (10%)

Query: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKG 82
           T GG++  I   V  P +  K+RMQ   + + A           +  + +NEG+    KG
Sbjct: 47  TCGGISQVI---VGQPFDTTKVRMQTSAKSVGA--------LDIIRKLVKNEGVWAFYKG 95

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNK--TFYPDQESHKVQSVGINVFAGAASGIIGAV 140
            +   +   A    + G  E ++    +  T    Q       +G     G   G++ + 
Sbjct: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSF 155

Query: 141 MGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAG 200
           + SP+  V+ RLQ+ +     G +  + G  + ++ +      K L RG+   +LR G G
Sbjct: 156 LASPIEHVRIRLQTQTGN---GNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHG 209

Query: 201 SSVQLPIYNTAKNFLLRNDIMEDGPSLHLTA------STISGLGVAVVMNPWDVILTRIY 254
               L  Y      L+ N+I +      + +       ++SG+ + + + P DV+ + I 
Sbjct: 210 ----LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ 265

Query: 255 NQ--KGDLYKGPIDCLVKTV-KIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309
               +   +K  +  ++  + + +GI+A +KGF   + R  P         E  M+L+
Sbjct: 266 TDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 81/185 (43%), Gaps = 27/185 (14%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           ++ AG   GI   ++G P    K R+Q+ + ++         G  + ++ +   EGV   
Sbjct: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV---------GALDIIRKLVKNEGVWAF 92

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFLL-----RNDIMEDGPSLHLTASTISGLGVAV 241
           ++G    I+  GA  SVQ  +    K F       R     DG +L L    I GL   V
Sbjct: 93  YKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDG-TLQLGQYYICGLTGGV 151

Query: 242 V----MNPWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
           V     +P + +  R+  Q G+     +KGP+DC+ K VK +   +L +G    + R G 
Sbjct: 152 VNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAG- 207

Query: 294 HTILC 298
           H + C
Sbjct: 208 HGLGC 212

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 76/180 (42%), Gaps = 4/180 (2%)

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
           AGA +GI+   +  P+  +KTR+Q+ S           + +   +  I  TEG   L++G
Sbjct: 23  AGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKG 82

Query: 190 IDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTAS-TISGLGVAVVMNPWDV 248
           + + +L  G   +V    Y   K+ L+  +  +    L    S T++ +    +MNP+D 
Sbjct: 83  VQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPLKTALSGTLATVAADALMNPFDT 142

Query: 249 ILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKL 308
           I  R+     D       C V+  + EGI A +  +   +    P   L     E + K+
Sbjct: 143 IKQRLQLHPSD---SMTKCAVRMYQREGIAAFFYSYPTTIAMNIPFAALNFVIYESSTKI 199

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 77/200 (38%), Gaps = 26/200 (13%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G LA   A  + NP + +K R+QL             +P  +M        +R  Q+  
Sbjct: 125 SGTLATVAADALMNPFDTIKQRLQL-------------HPSDSMTKC----AVRMYQREG 167

Query: 84  VAAYIYQ----IALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGA 139
           +AA+ Y     IA+N         I     K F P    +      I+   G  SG   A
Sbjct: 168 IAAFFYSYPTTIAMNIPFAALNFVIYESSTKIFNPSNNYNP----WIHCLCGGISGATCA 223

Query: 140 VMGSPLFLVKTRLQSY-SNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
            + +PL  VKT LQ   +++++                I+ T G  G FRG+   I+   
Sbjct: 224 AITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNM 283

Query: 199 AGSSVQLPIYNTAKNFLLRN 218
             +++    Y  AK+ L  N
Sbjct: 284 PATAISWTSYEFAKHLLFTN 303

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 58/290 (20%), Positives = 104/290 (35%), Gaps = 28/290 (9%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQ-LQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKG 82
           AG  A  +  ++  PI+ +K RMQ +     +A  R+ +N    +  +   EG   L KG
Sbjct: 23  AGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKG 82

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMG 142
           + +  +     +      YE     M K+   D E  +         +G  + +    + 
Sbjct: 83  VQSVVLGAGPAHAVYFATYE-----MCKSRLIDPEDRQTHQPLKTALSGTLATVAADALM 137

Query: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           +P   +K RLQ + +            +      +Y  EG+   F      I      ++
Sbjct: 138 NPFDTIKQRLQLHPS----------DSMTKCAVRMYQREGIAAFFYSYPTTIAMNIPFAA 187

Query: 203 VQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGD--- 259
           +   IY ++      N      P +H     ISG   A +  P D + T +  +  D   
Sbjct: 188 LNFVIYESSTKIF--NPSNNYNPWIHCLCGGISGATCAAITTPLDCVKTVLQIRGADSVQ 245

Query: 260 --LYKGPIDCLVKTV----KIEGITALYKGFEAQVFRIGPHTILCLTFLE 303
             L+K   D   K      K  G +  ++G + ++    P T +  T  E
Sbjct: 246 SQLFKE-ADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYE 294

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 127/282 (45%), Gaps = 37/282 (13%)

Query: 52  LMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIR--AVMN 109
           L   NQ+ +    +A   + + EG+  L +G+    +  I  N      YE +R  + +N
Sbjct: 103 LNCRNQK-FNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPLN 161

Query: 110 KTFYPDQESHKVQSVGIN-VFAGAASGIIGAVMGSPLFLVKTRLQSY-SNAIKIGEQTHY 167
              YP           IN +  GA +  + A   +PL L+KT+LQS  S+++K G    Y
Sbjct: 162 G-LYPT----------INPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMY 210

Query: 168 TGVWNGLKTIYMTEGV-KGLFRGIDAAILRTGAGSSV---QLPIYNTAKNFLLRNDIMED 223
             ++N +K+     GV + +F+G++  + R    S++       Y T   +L  +   ++
Sbjct: 211 RDLFNEIKSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKN 270

Query: 224 GPS-LHLTAST----ISGLGVAVVMNPWDVILTR-----IYNQK---GDLYKGPIDCLVK 270
             +  H T S     ISG   A+  +P+DV  TR     + ++K    +L  G  + +  
Sbjct: 271 SSNWFHFTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFG 330

Query: 271 TV----KIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKL 308
            +    K EGI ALY G   +V +I P   + ++  E T +L
Sbjct: 331 FLNYIRKTEGIGALYTGLAPRVAKIAPSCAIMISSYELTKRL 372

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 12/55 (21%), Positives = 24/55 (43%)

Query: 246 WDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLT 300
           W+    +  N +   + G ++   K  K EG+T L++G    +    P  ++  T
Sbjct: 95  WESTCFQNLNCRNQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFT 149

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 81/319 (25%), Positives = 127/319 (39%), Gaps = 52/319 (16%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGE----------LMAANQRIYTNPFQAMGVV 70
           +  AGG+    AV   +P +++K+R Q              L  A      N      + 
Sbjct: 24  ALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTSLF 83

Query: 71  FRNEGIRGLQKGLVAAYI-----YQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVG 125
           F+N  ++G  KG++   I     + ++  G  +G     R V  K     Q S    +  
Sbjct: 84  FKNS-VKGFYKGVIPPLIGVTPIFAVSFWGYDIG----KRLVTWK-----QASDAPLTTA 133

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVW-NGLKTIYMTEGVK 184
               AG  S I   ++ +P   +K  LQ+ S          + G +    K I  T GVK
Sbjct: 134 QMATAGFISAIPTTLVTAPTERIKVVLQTNS---------EFKGSFIKAAKHIVSTGGVK 184

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLT----ASTISGLGVA 240
            LF G  A + R G GS++    Y  +K FL ++   +D   ++L     A  I+G+ + 
Sbjct: 185 SLFNGSLATLARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMW 244

Query: 241 VVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIE----GITALYKGFEAQVFRIGPHTI 296
           +V+ P D I TR+      +   PI  +  T  I     GI   + G    + R  P   
Sbjct: 245 LVVFPIDTIKTRL-----QVATTPISMVQATKDIYIQRGGIKGFFPGLGPALLRSFPAN- 298

Query: 297 LCLTFLEQTMKLVHAFESK 315
              TFL   ++L HAF  K
Sbjct: 299 -AATFLG--VELTHAFFKK 314

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 87/197 (44%), Gaps = 41/197 (20%)

Query: 16  VSKFGSFTAGGLAACIA--------VTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAM 67
           ++ FG+   GG++  +A         T    +E+ K +    G   ++        + A 
Sbjct: 102 LNNFGAGIMGGVSGGVAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSS--------WAAF 153

Query: 68  GVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFY----EPIRAVMNKTFYPDQESHKVQS 123
             ++  EGIRG+ KG+ A  I Q+   GSR GF     E +R    KT  PD +   ++ 
Sbjct: 154 KEIYNKEGIRGINKGVNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGKT-NPDDKLTALE- 211

Query: 124 VGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSN------AIKIGEQTHYTGVWNGLKTI 177
               +FA A  G + A    P+ +++  +QS +N       + +G+   Y         I
Sbjct: 212 ---KIFASAIGGGLSA-WNQPIEVIRVEMQSKTNDPNRPKDLTVGKAFRY---------I 258

Query: 178 YMTEGVKGLFRGIDAAI 194
           Y + GVKGL+RG+   I
Sbjct: 259 YQSNGVKGLYRGVTPRI 275

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 115/279 (41%), Gaps = 42/279 (15%)

Query: 26  GLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVA 85
           GL  C   T+  P+EVVK         MAAN++     FQA+  ++   G+ G  +GL+ 
Sbjct: 23  GLNMCEVTTLGQPLEVVKT-------TMAANRQF--TFFQAINHIWSRGGVFGFYQGLIP 73

Query: 86  AYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF-AGAASGIIGAV---- 140
               + +  G+ L             F   +  +  + +G+N F AG   G+ G V    
Sbjct: 74  WAWIEASTKGAVL------------LFVSAEAEYHFKKLGLNNFGAGIMGGVSGGVAQAY 121

Query: 141 --MGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILR-- 196
             MG    +    +  + +A    +Q+     W   K IY  EG++G+ +G++A  +R  
Sbjct: 122 LTMGFCTCMKTVEITKHKSAAAGAKQSS----WAAFKEIYNKEGIRGINKGVNAVAIRQM 177

Query: 197 TGAGSSVQLP--IYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIY 254
           T  GS       +    + F  + +  +   +L    ++  G G++    P +VI   + 
Sbjct: 178 TNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAIGGGLSAWNQPIEVIRVEMQ 237

Query: 255 NQKGDLYKGPIDCLVKTV-----KIEGITALYKGFEAQV 288
           ++  D  + P D  V        +  G+  LY+G   ++
Sbjct: 238 SKTNDPNR-PKDLTVGKAFRYIYQSNGVKGLYRGVTPRI 275

>Scas_645.9
          Length = 391

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 115/289 (39%), Gaps = 44/289 (15%)

Query: 51  ELMAANQRIYTN-PFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIR---- 105
           EL   N  +  N   +A   +++ EGI  L +G+    +  I  N      YE +R    
Sbjct: 119 ELNCKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDNSP 178

Query: 106 -AVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQ 164
            A  + TF P             +  GA + I+ A   +PL L+KT+LQS     K    
Sbjct: 179 LATSSPTFNP-------------LMCGAIARILAASTVAPLELLKTKLQSIPRVSK--ST 223

Query: 165 THYTGVWNGLKTIYMTEGVKG----LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDI 220
           T +  V   LK       + G    LF+G++  + R    S++    Y   K  L   D 
Sbjct: 224 TSWMMVKELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWM-DT 282

Query: 221 MEDGPSL-----HLTASTISGLGVAVVMNPWDVILTR-----IYNQKGDLYKGP------ 264
            +   +L          +ISG   A+V +P+DV  TR     + N    + K P      
Sbjct: 283 SKSHSNLTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTK 342

Query: 265 --IDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHA 311
                L    K+EG  ALY G   ++ +I P   + ++  E + +L +A
Sbjct: 343 NMFKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFNA 391

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 82/190 (43%), Gaps = 32/190 (16%)

Query: 115 DQES-HKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQ---SYSNAIKIGEQTHYTGV 170
           D ES H    V  ++ AG A GI   ++G P    K RLQ   + +NA+K+         
Sbjct: 13  DLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKV--------- 63

Query: 171 WNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLT 230
              +K +   EG  G ++G    ++  GA  S+Q  +    K F       ++  S HL+
Sbjct: 64  ---IKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFF---HTFDEAASQHLS 117

Query: 231 ASTISGLGVA------VVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITAL 280
                  GVA       + +P + I  R+  Q G      +KGPIDC +K +++ G   L
Sbjct: 118 LLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDC-IKKLRVNG--QL 174

Query: 281 YKGFEAQVFR 290
            +G    + R
Sbjct: 175 MRGLTPTMLR 184

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 120/293 (40%), Gaps = 27/293 (9%)

Query: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKG 82
           TAGG+A    V V  P +  K+R+Q             TN  + +  + +NEG  G  KG
Sbjct: 31  TAGGIAQ---VLVGQPFDTTKVRLQ--------TSETSTNAVKVIKDLIKNEGPMGFYKG 79

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMG 142
            +   +   A    + G  E ++   + TF  D+ + +  S+      G A G   + + 
Sbjct: 80  TLTPLVGVGACVSLQFGVNEAMKRFFH-TF--DEAASQHLSLLQYYICGVAGGFTNSFLA 136

Query: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG-LFRGIDAAILRTGAGS 201
           SP+  ++ RLQ+ + +   G    + G  + +K +     V G L RG+   +LR   G 
Sbjct: 137 SPIEHIRIRLQTQTGS---GATAEFKGPIDCIKKLR----VNGQLMRGLTPTMLRESHGC 189

Query: 202 SVQLPIYNTAKNFLLRNDIM-EDGPSLHLTA-STISGLGVAVVMNPWDVILTRIYNQKGD 259
            V    Y       +++ I  +D P+  L      SG  +  ++ P DVI + +      
Sbjct: 190 GVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLK 249

Query: 260 LYKGPIDCLV---KTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309
             K   + L      +  +G++ L+KGF   + R  P         E  M+L+
Sbjct: 250 TPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFETAMRLL 302

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 80/182 (43%), Gaps = 22/182 (12%)

Query: 119 HKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIY 178
           H  +    +VF+G   G+   ++G P  ++K RLQ+       G  T     W  +  + 
Sbjct: 19  HGFRKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMP-----GNAT----AWEAITDLV 69

Query: 179 MTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL----LRNDIMEDGPSL--HLTAS 232
             EG  G ++G  A ++  GA  S Q  I    K +         I ++  SL  + T  
Sbjct: 70  KYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCG 129

Query: 233 TISGLGVAVVMNPWDVILTRIYNQKGDL----YKGPIDCLVKTVKIEGITALYKGFEAQV 288
            +SG   A++  P + +  R+  QK  L    YK  +DC  K +K +G  +L +GF A +
Sbjct: 130 FVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLK-QG--SLMRGFTATL 186

Query: 289 FR 290
            R
Sbjct: 187 MR 188

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 119/300 (39%), Gaps = 38/300 (12%)

Query: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKG 82
           T GG+A    V V  P +++K+R+Q     M  N       ++A+  + + EG  G  KG
Sbjct: 32  TVGGVAQ---VLVGQPFDIIKVRLQT----MPGN----ATAWEAITDLVKYEGFMGFYKG 80

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQ----SVGINVFAGAASGIIG 138
            +A  +   A    + G    I   M + F     S  +     S+G     G  SG   
Sbjct: 81  TMAPLVGVGACVSCQFG----INEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSAN 136

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
           A++ +P+  V+ RLQ    A+   E   Y    +  + + + +G   L RG  A ++RT 
Sbjct: 137 ALLATPIEHVRIRLQLQKEALANAE---YKSTLDCTEKL-LKQG--SLMRGFTATLMRTS 190

Query: 199 AGSSVQLPIYNT------AKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTR 252
            G  +    Y T      A  F  R DI      +      +SG     +  P+DV+ + 
Sbjct: 191 HGFGIYFLTYETLIASQLAHGF-RREDISAWKACMF---GALSGAFFWAMTYPFDVVKSV 246

Query: 253 IYNQK--GDLYKGPIDCLVKTVKIE-GITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309
           +   K     Y   +  + K +  E G+ A  KGF   + R  P         E TM+++
Sbjct: 247 MQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQML 306

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 72/180 (40%), Gaps = 21/180 (11%)

Query: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK 81
           +T G ++      +  PIE V+IR+QLQ E +A  +  Y +       + +       Q 
Sbjct: 126 YTCGFVSGSANALLATPIEHVRIRLQLQKEALANAE--YKSTLDCTEKLLK-------QG 176

Query: 82  GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFA----GAASGII 137
            L+  +   +       G Y     +  +T    Q +H  +   I+ +     GA SG  
Sbjct: 177 SLMRGFTATLMRTSHGFGIY----FLTYETLIASQLAHGFRREDISAWKACMFGALSGAF 232

Query: 138 GAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
              M  P  +VK+ +Q    A K+    + T V    K IY   G++   +G    +LR+
Sbjct: 233 FWAMTYPFDVVKSVMQ----ADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRS 288

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 38/89 (42%), Gaps = 3/89 (3%)

Query: 14  QKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN 73
           + +S + +   G L+      +T P +VVK  MQ        N    TN  Q    ++R 
Sbjct: 215 EDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADK---LVNPAYGTNVVQVAKNIYRE 271

Query: 74  EGIRGLQKGLVAAYIYQIALNGSRLGFYE 102
            G+R   KG +   +  + +NG+    +E
Sbjct: 272 RGLRAFTKGFMPTMLRSLPVNGATFAAFE 300

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 66/149 (44%), Gaps = 16/149 (10%)

Query: 173 GLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL-LRNDIMEDGPSLHLTA 231
            +K +Y T G     +G  A I R  A +S+Q   Y   K  L  RND           +
Sbjct: 146 AVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARND---------KAS 196

Query: 232 STISGLGVAVVM----NPWDVILTRIYNQKGDL-YKGPIDCLVKTVKIEGITALYKGFEA 286
           S I+GL  +  +     P DV+ TR+ +Q     YK  ++C+ +    EG+   +KG   
Sbjct: 197 SVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGSIF 256

Query: 287 QVFRIGPHTILCLTFLEQTMKLVHAFESK 315
           +  ++G    L  T  EQ + L+  F S+
Sbjct: 257 RFMKVGISGGLTFTVYEQ-VSLLLGFSSR 284

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 6/83 (7%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           +V  G A+      M  P+ +VKTR+ S  NA     +T Y    N +  I++ EG+   
Sbjct: 197 SVITGLATSFTLVAMTQPIDVVKTRMMS-QNA-----KTEYKNTLNCMYRIFVQEGMATF 250

Query: 187 FRGIDAAILRTGAGSSVQLPIYN 209
           ++G     ++ G    +   +Y 
Sbjct: 251 WKGSIFRFMKVGISGGLTFTVYE 273

 Score = 31.2 bits (69), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 8/65 (12%)

Query: 26  GLAACIA-VTVTNPIEVVKIRMQLQGELMAANQRI-YTNPFQAMGVVFRNEGIRGLQKGL 83
           GLA     V +T PI+VVK RM      M+ N +  Y N    M  +F  EG+    KG 
Sbjct: 201 GLATSFTLVAMTQPIDVVKTRM------MSQNAKTEYKNTLNCMYRIFVQEGMATFWKGS 254

Query: 84  VAAYI 88
           +  ++
Sbjct: 255 IFRFM 259

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 93/230 (40%), Gaps = 25/230 (10%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYT--NPFQAMGVVFRNEGIRGLQK 81
           AG  A  +  +V  PI+ +K R+Q      +AN +  +  N    +  +  +EG   L K
Sbjct: 39  AGAFAGIMEHSVMFPIDALKTRIQ------SANAKSLSAKNMLSQISHISTSEGTLALWK 92

Query: 82  GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVM 141
           G+ +  +     +    G YE  +  +  +   D ++H      I   +GA +      +
Sbjct: 93  GVQSVILGAGPAHAVYFGTYEFCKKNLIDS--SDTQTHHPFKTAI---SGACATTASDAL 147

Query: 142 GSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201
            +P   +K R+Q  ++A           VW   K IY +EG+   +      ++     +
Sbjct: 148 MNPFDTIKQRIQLNTSA----------SVWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFA 197

Query: 202 SVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILT 251
           +    IY ++  FL  N   E  P +H    +ISG   A +  P D I T
Sbjct: 198 AFNFVIYESSTKFL--NPSNEYNPLIHCLCGSISGSTCAAITTPLDCIKT 245

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 83/215 (38%), Gaps = 22/215 (10%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
           ++ I  S  Q    F +  +G  A   +  + NP + +K R+QL               +
Sbjct: 117 KNLIDSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTSASV---------W 167

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSV 124
           Q    ++++EG+           +  I         YE     +N    P  E + +   
Sbjct: 168 QTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFLN----PSNEYNPL--- 220

Query: 125 GINVFAGAASGIIGAVMGSPLFLVKTRLQ---SYSNAIKIGEQTHYTGVWNGLKTIYMTE 181
            I+   G+ SG   A + +PL  +KT LQ   S + +++I  +            IY   
Sbjct: 221 -IHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFS--KAASAIYQVY 277

Query: 182 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLL 216
           G KG +RG    I+     +++    Y  AK+FL+
Sbjct: 278 GWKGFWRGWKPRIVANMPATAISWTAYECAKHFLM 312

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 93/223 (41%), Gaps = 20/223 (8%)

Query: 94  NGSRLGFYEPIRAVMNKTFYPDQESHKVQS-VGINVFAGAASGIIGAVMGSPLFLVKTRL 152
           N S      PI A+      PD E+    + +   + AGA +GI+   +  P+  +KTR+
Sbjct: 4   NSSSNNSTRPIPAIPMD--LPDYEALPTHAPLYHQLIAGAFAGIMEHSVMFPIDALKTRI 61

Query: 153 QSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAK 212
           QS +NA  +  +     + + +  I  +EG   L++G+ + IL  G   +V    Y   K
Sbjct: 62  QS-ANAKSLSAK----NMLSQISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCK 116

Query: 213 NFLLRNDIMEDGPSLHLTASTISGLGVAV----VMNPWDVILTRI-YNQKGDLYKGPIDC 267
             L+ +    D  + H   + ISG         +MNP+D I  RI  N    +++     
Sbjct: 117 KNLIDS---SDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTSASVWQT---- 169

Query: 268 LVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVH 310
             +  + EG+ A Y  +   +    P         E + K ++
Sbjct: 170 TKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFLN 212

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 73/306 (23%), Positives = 119/306 (38%), Gaps = 29/306 (9%)

Query: 11  SAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVV 70
           S  QK S          A  + + V +P++ +  R      LM+ + +I TN  Q   VV
Sbjct: 2   SNDQKQSGLARVVGSASAGILEIGVFHPVDTISKR------LMSNHTKI-TNAQQLNDVV 54

Query: 71  FRNEGIR-------GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS 123
           FR    +        L  GL  A  Y+I     + G        +NK F  D +    + 
Sbjct: 55  FREHASKPFGQRLFTLFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEK 114

Query: 124 VGINVFAGAASGIIG--AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTE 181
            G  + +  A  +IG   ++  PL ++K + Q+   + +            G   I   E
Sbjct: 115 TGKALRSATAGSLIGIGEIVLLPLDVLKIKRQTNPESFR----------GRGFLRILRDE 164

Query: 182 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLL-RNDIMEDGPSLHLTASTISGLGVA 240
           G+ GL+RG      R   GS         AK ++L   D  +     +  +S        
Sbjct: 165 GM-GLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASL 223

Query: 241 VVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLT 300
           +V  P DVI TRI ++  +  +     +  T+K EG TA +KG   ++   GP  +    
Sbjct: 224 IVSAPLDVIKTRIQSRNFESAESGFTIVKNTLKNEGATAFFKGLTPKLLTTGPKLVFSFA 283

Query: 301 FLEQTM 306
            + QT+
Sbjct: 284 -IAQTL 288

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 125/281 (44%), Gaps = 33/281 (11%)

Query: 31  IAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQ 90
           +++ +T P+  +  RMQ+  +      R   +  +A+  ++R EG+ G   GL +A +Y 
Sbjct: 29  LSMALTMPLVTLATRMQVSEQDKEPGTR-SKSKLEAVREIYRKEGVVGFYYGLESA-MYG 86

Query: 91  IALNG-SRLGFYE-PIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLV 148
           +A N  +   FYE   RA M       + S ++ +    + + A +G + A+  +P+++V
Sbjct: 87  MAANSLNYYYFYELAARATMRV-----RGSRRLNT-SEAILSSAVAGSMTAIASNPIWVV 140

Query: 149 KTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIY 208
            TR+      +   EQ+        L  I   +GV  LF G+  A++   +   +Q  ++
Sbjct: 141 NTRM-----TVAKSEQSTLA----VLLDIVRKDGVTALFNGLRPALMLV-SNPIIQYTVF 190

Query: 209 NTAKNFLLR---NDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKG----DLY 261
              KN +L+   +D++   PS       +  L       P+  + TR++  KG    D  
Sbjct: 191 EQLKNVVLKWSGSDVLL--PSWAFLLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQ 248

Query: 262 KGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFL 302
           +     +V  VK EGI  LY G   ++      +IL   FL
Sbjct: 249 QSMWSLMVDIVKKEGIQGLYHGIGVKL----TQSILTAAFL 285

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 74/172 (43%), Gaps = 16/172 (9%)

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGV-----WNGLKTIYMTEGVKGLFRGIDAAILRTG 198
           PL  + TR+Q       + EQ    G         ++ IY  EGV G + G+++A+    
Sbjct: 36  PLVTLATRMQ-------VSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMA 88

Query: 199 AGSSVQLPIYNTAKNFLLR-NDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQK 257
           A S      Y  A    +R         S  + +S ++G   A+  NP  V+ TR+   K
Sbjct: 89  ANSLNYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAK 148

Query: 258 GDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309
            +  +  +  L+  V+ +G+TAL+ G    +  +  + I+  T  EQ   +V
Sbjct: 149 SE--QSTLAVLLDIVRKDGVTALFNGLRPALMLVS-NPIIQYTVFEQLKNVV 197

>Kwal_33.12988
          Length = 303

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 80/322 (24%), Positives = 130/322 (40%), Gaps = 46/322 (14%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
           +D   KS  ++  K    TAG       V V  P ++ K+R+Q             + P 
Sbjct: 12  DDLTDKSDIRRTLK--DITAGTTGGIAQVLVGQPFDITKVRLQTS-----------STPT 58

Query: 65  QAMGVV---FRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKV 121
            A+ VV    +NEG+RG  KG     I       S+ G  E ++   +K        +  
Sbjct: 59  TALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHK-------RNNF 111

Query: 122 QSVGINV----FAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTI 177
           QS  + +      G  SG   A + +P+  V+  LQ  + +    E   Y G  + +K +
Sbjct: 112 QSTSLRLPEYYACGFVSGCANAFLATPIEHVRILLQVQTKSRADAE---YQGAMDCIKKL 168

Query: 178 YMTEGVKGLFRGIDAAILRTGAG-----SSVQLPIYNTAKNFLLRNDIMEDGPSLHLTA- 231
            + EG   L RG    ILRT  G     +S +  I +  +  + R DI    P+  L   
Sbjct: 169 -LKEG--KLMRGFTPTILRTSHGFGVYFTSYEAMICSEQRKGIARKDI----PAWKLCLY 221

Query: 232 STISGLGVAVVMNPWDVILTRIYNQK--GDLYKGPIDCLVKTVKIE-GITALYKGFEAQV 288
              SG  +  ++ P+DVI + + + K    +Y   +  + K +  E G  A  KGF   +
Sbjct: 222 GAFSGSLLWAMVYPFDVIKSVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTM 281

Query: 289 FRIGPHTILCLTFLEQTMKLVH 310
            R  P      T  E  M++++
Sbjct: 282 LRSLPVNGATFTAFEMAMRILN 303

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/302 (21%), Positives = 119/302 (39%), Gaps = 39/302 (12%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           AG +     V V  P +  K+R+Q     +   + +          + RNEG     KG+
Sbjct: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQN--------LLRNEGALAFYKGM 83

Query: 84  VAAYI-------YQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGI 136
           +   +        Q  +N S   F+    A  ++    D + H    +      G   G+
Sbjct: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNA--DRV---DPQKHVPLPLHQYYLCGLTGGV 138

Query: 137 IGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILR 196
           + + + +P+  V+ RLQ+ ++    G +  + G ++ +K +      K L RG+   ++R
Sbjct: 139 VNSFLAAPIEHVRIRLQTQTSQ---GNERQFKGPFDCIKKL---AKAKALMRGLLPTMIR 192

Query: 197 TGAGSSVQLPIYNT--AKNF---LLRNDIMEDGPSLHLTA-STISGLGVAVVMNPWDVIL 250
            G G       Y     K F     RN I    P+  L +   +SG  + + + P DV+ 
Sbjct: 193 AGHGLGTYFAAYEALVVKEFEKGTPRNQI----PAWKLCSFGALSGTILWLTVYPVDVVK 248

Query: 251 TRIYNQ--KGDLYKGPIDCLVKTV-KIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMK 307
           + +     +   YK  I    + + K  GI A +KGF   + R  P         E TM+
Sbjct: 249 SVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMTMR 308

Query: 308 LV 309
           ++
Sbjct: 309 VL 310

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 71/178 (39%), Gaps = 24/178 (13%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           ++FAG   G+   ++G P    K RLQ+    I         GV   ++ +   EG    
Sbjct: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------GVIEVVQNLLRNEGALAF 79

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLH----LTASTISGLGVAVV 242
           ++G+   +L  G   SVQ  +  + K F    +     P  H    L    + GL   VV
Sbjct: 80  YKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVV 139

Query: 243 MN----PWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITALYKGFEAQVFRIG 292
            +    P + +  R+  Q        +KGP DC+ K  K +   AL +G    + R G
Sbjct: 140 NSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAG 194

>Scas_558.2
          Length = 289

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 84/200 (42%), Gaps = 30/200 (15%)

Query: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEG----IRG 78
           + G LAAC+   V  P EV+K R Q+             + +Q    + +NE     IR 
Sbjct: 107 SMGELAACL---VRVPAEVIKQRTQVHST---------NSSWQTFRTILKNENQEGIIRN 154

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIG 138
           L +G     + +I     +   YE ++       Y ++  H     G     G+ +G I 
Sbjct: 155 LYRGWSTTIMREIPFTCIQFPLYEFMKK--EWALYDNEVGHLKPWKG--AICGSIAGGIA 210

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
           A   +PL  +KTRL    ++I I            ++ IY  EG K  F GI    +   
Sbjct: 211 AATTTPLDFLKTRLMLNKDSIPIKSL---------IRNIYKEEGFKIFFSGIYPRTMWIS 261

Query: 199 AGSSVQLPIYNTAKNFLLRN 218
           AG ++ L +Y T  +F+L++
Sbjct: 262 AGGAIFLGVYETM-HFMLQS 280

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/278 (20%), Positives = 108/278 (38%), Gaps = 49/278 (17%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           S  +G  A      V  PI+ +K R+Q +G                    F+N G  G+ 
Sbjct: 9   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGF------------------FQNGGYHGIY 50

Query: 81  KGL--------VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGA 132
           +GL         +A ++ +  +  ++     +  V+N +    +  H V ++ +++ A +
Sbjct: 51  RGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSS--GTRSPHSVDTI-VHMIASS 107

Query: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEG----VKGLFR 188
              +   ++  P  ++K R Q +S              W   +TI   E     ++ L+R
Sbjct: 108 MGELAACLVRVPAEVIKQRTQVHST----------NSSWQTFRTILKNENQEGIIRNLYR 157

Query: 189 GIDAAILRTGAGSSVQLPIYNTAKN--FLLRNDIMEDGPSLHLTASTISGLGVAVVMNPW 246
           G    I+R    + +Q P+Y   K    L  N++    P       +I+G   A    P 
Sbjct: 158 GWSTTIMREIPFTCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPL 217

Query: 247 DVILTRIYNQKGDLYKGPIDCLVKTV-KIEGITALYKG 283
           D + TR+   K  +   PI  L++ + K EG    + G
Sbjct: 218 DFLKTRLMLNKDSI---PIKSLIRNIYKEEGFKIFFSG 252

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 83/195 (42%), Gaps = 34/195 (17%)

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185
           +++ +GAA+G    ++  P+  +KTRLQ+     + G                   G  G
Sbjct: 8   MSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFQNG-------------------GYHG 48

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFL------LRNDIMEDGPS-----LHLTASTI 234
           ++RG+ +A++ +   +S+    Y++ K  +      + N      P      +H+ AS++
Sbjct: 49  IYRGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSM 108

Query: 235 SGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITA-LYKGFEAQVFRIGP 293
             L   +V  P +VI  R      +        ++K    EGI   LY+G+   + R  P
Sbjct: 109 GELAACLVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIP 168

Query: 294 HTILCLTF-LEQTMK 307
            T  C+ F L + MK
Sbjct: 169 FT--CIQFPLYEFMK 181

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 65/322 (20%), Positives = 134/322 (41%), Gaps = 37/322 (11%)

Query: 19  FGSFTAGGLAACIAVTVTNPIEVVKI----RMQLQGELMAANQRIYT-NP---------- 63
           FG F AGG +  ++ T T P + +K+    R  L   L+ +   +   NP          
Sbjct: 200 FGFFIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSP 259

Query: 64  -FQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQ 122
             +A   ++R  G+R    G     +     +  + G +E  + +M +     +++ ++ 
Sbjct: 260 LIKAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMAR-LENVKDTSELS 318

Query: 123 SVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEG 182
            +   + AG   G+       P+  +K R+Q       + + +    +    K +Y   G
Sbjct: 319 RLSTYI-AGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSI---LLQTAKEMYQQGG 374

Query: 183 VKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDG-PSLHLTASTI------- 234
           ++  +RG+   ++     +++ L  ++  K + ++ +  + G P   +  S +       
Sbjct: 375 IRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGA 434

Query: 235 -SGLGVAVVMNPWDVILTRIYNQ----KGDLYKGPIDCLVKTVKIEGITALYKGFEAQVF 289
            SG   A ++ P +++ TR+  Q        Y G  D L KT++ EG   L+KG    + 
Sbjct: 435 FSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLA 494

Query: 290 RIGPH---TILCLTFLEQTMKL 308
           ++ P    + LC   L++ MKL
Sbjct: 495 KVCPAVSISYLCYENLKRLMKL 516

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 95/213 (44%), Gaps = 26/213 (12%)

Query: 15  KVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNE 74
           ++S+  ++ AGGL    A     PI+ +K R+Q     +  N +  +   Q    +++  
Sbjct: 316 ELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAP--LNTNLKKSSILLQTAKEMYQQG 373

Query: 75  GIR----GLQKGLVAAYIYQIALNGSRLGFYEP-----IRAVMNKTFYPDQESHKVQSVG 125
           GIR    G+  G++  + Y  AL+   LG +       I+    KT  P+ E   + S  
Sbjct: 374 GIRLFYRGVHIGVMGIFPYA-ALD---LGTFSALKKWYIKKEAKKTGLPEDEV--IISNL 427

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTH---YTGVWNGLKTIYMTEG 182
           I +  GA SG +GA +  P+ L++TRLQ+       G   H   Y G  + LK     EG
Sbjct: 428 IVLPMGAFSGTVGATLVYPINLLRTRLQAQ------GTYAHPHTYNGFSDVLKKTIQREG 481

Query: 183 VKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
            +GLF+G+   + +     S+    Y   K  +
Sbjct: 482 YQGLFKGLVPNLAKVCPAVSISYLCYENLKRLM 514

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 59/286 (20%), Positives = 116/286 (40%), Gaps = 33/286 (11%)

Query: 19  FGSFTAGGLAACIAV-TVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIR 77
           + + T GG+ AC    +   P+++VK R+Q+       N ++Y +       + R+EG+ 
Sbjct: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQV-------NPQLYRSNLDGWKTIVRSEGLS 67

Query: 78  GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGII 137
            +  G+ A +I        + G YE  +   +    P+  +H+     + + A A++  +
Sbjct: 68  KVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPE-TAHR-HRTAVYLCASASAEFL 125

Query: 138 GAVMGSPLFLVKTRLQSYSNAIKIGEQT----HYTGVWNGLKTIYMTEGVKGLFRGIDAA 193
             ++  P             AIK+ +QT           G   I   EG+ GL++GI   
Sbjct: 126 ADILLCPW-----------EAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPL 174

Query: 194 ILRTGAGSSVQLPIYNTAKNFL---LRNDIMEDGPSLHLTASTI----SGLGVAVVMNPW 246
             R    +  +   +      +   L     E  PS  +  S +    +G+  AVV +P 
Sbjct: 175 WCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPA 234

Query: 247 DVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIG 292
           DV+++++ N      +  ++   +     G   L+ G   ++F IG
Sbjct: 235 DVMVSKV-NADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIG 279

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           +PL LVK RLQ       +  Q + + + +G KTI  +EG+  +F G+ A  +      +
Sbjct: 34  TPLDLVKCRLQ-------VNPQLYRSNL-DGWKTIVRSEGLSKVFTGVGATFIGYSLQGA 85

Query: 203 VQLPIYN----TAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKG 258
            +   Y     T  N L          +++L AS  +     +++ PW+ I  +      
Sbjct: 86  CKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIP 145

Query: 259 DLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHA 311
              K  ++   K    EG++ LYKG      R  P+T+   T  E+ +++++A
Sbjct: 146 PFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYA 198

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 79/195 (40%), Gaps = 15/195 (7%)

Query: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK 81
             A   A  +A  +  P E +K++ Q        N        +    +   EG+ GL K
Sbjct: 116 LCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNF------LEGWSKITAAEGLSGLYK 169

Query: 82  GLVAAYIYQIALNGSRLGFYEPI-RAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140
           G+   +  QI     +   +E I   +  K     QE    Q +G++   G  +GI+ AV
Sbjct: 170 GITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAV 229

Query: 141 MGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAG 200
           +  P  ++ +++ +     K GE      +    K IY   G  GL+ G+   I   G  
Sbjct: 230 VSHPADVMVSKVNADR---KQGES-----MVEASKRIYSRIGFGGLWNGLPVRIFMIGTL 281

Query: 201 SSVQLPIYNTAKNFL 215
           +S Q  IY++ K ++
Sbjct: 282 TSFQWLIYDSFKAYI 296

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 59/276 (21%), Positives = 109/276 (39%), Gaps = 25/276 (9%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGI-RGLQKGL 83
           G +A      +  P + VK+R+Q Q    A+N  ++   +  +   ++NEGI RG  +G+
Sbjct: 20  GSIAGACGKVIEFPFDTVKVRLQTQ----ASN--VFPTTWSCIKFTYQNEGIARGFFQGI 73

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
            +  +     N +    Y      + K          V  +G  + +G  +G   +++ +
Sbjct: 74  ASPLVGACLENATLFVSYNQCSKFLEK-------HTNVFPLGQILISGGVAGSCASLVLT 126

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
           P+ LVK +LQ  +N      +T +T V   +K I    G+ GL++G     +R   G   
Sbjct: 127 PVELVKCKLQ-VANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVA 185

Query: 204 QLPIYNTAKNFLLRNDIMEDGPSLH------LTASTISGLGVAVVMNPWDVILTRIYNQK 257
               Y   K  L     ++D           L +   +GL     + P D + + +  + 
Sbjct: 186 WFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTEH 245

Query: 258 GDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
             L     + + K     G+   Y+G    +FR  P
Sbjct: 246 ISL----TNAVKKIFGKFGLKGFYRGLGITLFRAVP 277

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/187 (20%), Positives = 79/187 (42%), Gaps = 11/187 (5%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +GG+A   A  V  P+E+VK ++Q+    +A+ +  +T     +  +    G+ GL +G 
Sbjct: 113 SGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQ 172

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
              +I +     +    YE ++  +      D        +   + +G ++G+      +
Sbjct: 173 SGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGL---AFNA 229

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
            +F   T        +K   QT +  + N +K I+   G+KG +RG+   + R    ++ 
Sbjct: 230 SIFPADT--------VKSVMQTEHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAA 281

Query: 204 QLPIYNT 210
              I+ T
Sbjct: 282 VFYIFET 288

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 75/201 (37%), Gaps = 26/201 (12%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G  A  +A  + NP +V+K RMQL       N R   + +     ++  EG        
Sbjct: 118 SGMAATTVADALMNPFDVIKQRMQL-------NTR--ESVWHVTKNIYHKEGFAAFYYSY 168

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
               +  I         YE     MN    P  E +      I+  +G  SG   A + +
Sbjct: 169 PTTLVMNIPFAAFNFAIYESATKFMN----PSNEYNPF----IHCISGGLSGATCAAITT 220

Query: 144 PLFLVKTRLQ-----SYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
           PL  +KT LQ     + SN I     T           IY   G KG  RG+   ++   
Sbjct: 221 PLDCIKTVLQVRGSETVSNEIMKQANT----FQRAASAIYKIHGWKGFLRGLKPRVIANM 276

Query: 199 AGSSVQLPIYNTAKNFLLRND 219
             +++    Y  AK+FL+ + 
Sbjct: 277 PATAISWTSYECAKHFLVNSS 297

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 63/288 (21%), Positives = 108/288 (37%), Gaps = 30/288 (10%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           AG  A  +  +V  P++ +K R+Q      A    I     + +  +   EG   L KG+
Sbjct: 22  AGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLI-----KQISKITTAEGSLALWKGV 76

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
            +  +     +      YE  ++   K   P Q+ H  Q +   +   AA+ +  A+M +
Sbjct: 77  QSVILGAGPAHAVYFATYEFSKS---KLIDP-QDMHTHQPIKTAISGMAATTVADALM-N 131

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
           P  ++K R+Q  +             VW+  K IY  EG    +      ++     ++ 
Sbjct: 132 PFDVIKQRMQLNTR----------ESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAF 181

Query: 204 QLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKG 263
              IY +A  F+  N   E  P +H  +  +SG   A +  P D I T +  +  +    
Sbjct: 182 NFAIYESATKFM--NPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSN 239

Query: 264 PIDCLVKTV--------KIEGITALYKGFEAQVFRIGPHTILCLTFLE 303
            I     T         KI G     +G + +V    P T +  T  E
Sbjct: 240 EIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYE 287

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 62/127 (48%), Gaps = 7/127 (5%)

Query: 128 VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF 187
           + AGA +GI+   +  P+  +KTR+QS S+    G  T   G+   +  I   EG   L+
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQSSSS----GAATQ--GLIKQISKITTAEGSLALW 73

Query: 188 RGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVA-VVMNPW 246
           +G+ + IL  G   +V    Y  +K+ L+    M     +    S ++   VA  +MNP+
Sbjct: 74  KGVQSVILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAISGMAATTVADALMNPF 133

Query: 247 DVILTRI 253
           DVI  R+
Sbjct: 134 DVIKQRM 140

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 2/83 (2%)

Query: 229 LTASTISGLGVAVVMNPWDVILTRIYNQK-GDLYKGPIDCLVKTVKIEGITALYKGFEAQ 287
           L A   +G+    V+ P D I TRI +   G   +G I  + K    EG  AL+KG ++ 
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQSV 79

Query: 288 VFRIGP-HTILCLTFLEQTMKLV 309
           +   GP H +   T+     KL+
Sbjct: 80  ILGAGPAHAVYFATYEFSKSKLI 102

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 72/318 (22%), Positives = 123/318 (38%), Gaps = 18/318 (5%)

Query: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQG--ELMAANQRIYTNP 63
           + + ++ +Q      S  AGG+    AV   +P ++VK+R Q       M A   I    
Sbjct: 16  NDVSQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAA 75

Query: 64  FQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS 123
            QA G    N  +RG  KG+V   +    +       Y+  + ++               
Sbjct: 76  RQAAGPTSLN-AVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVE 134

Query: 124 VGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHY--TGVWNGLKTIYMTE 181
             + +   AA+G I A+   P  LV     + +  +K+  QT        +  K I  T+
Sbjct: 135 PELTLSQMAAAGFISAI---PTTLVT----APTERVKVVLQTTQGKASFLDAAKQIVRTQ 187

Query: 182 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTIS----GL 237
           G + LF+G  A + R G GS++    Y   K +L +      G  L +T   IS    G+
Sbjct: 188 GFQSLFKGSLATLSRDGPGSALYFASYEICKEYLNKASGHTSG-ELSITNVCISGGMAGV 246

Query: 238 GVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTIL 297
            + VV+ P D + T++ +         +  ++   +  GI   + G    + R  P    
Sbjct: 247 SMWVVVFPIDTVKTQLQSSSKRQSMLEVTRMIYNTR-GGIKGFFPGVGPAILRSFPANAA 305

Query: 298 CLTFLEQTMKLVHAFESK 315
               +E T  L   FE +
Sbjct: 306 TFLGVELTHSLFKKFEQQ 323

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 81/191 (42%), Gaps = 28/191 (14%)

Query: 16  VSKFGSFTAGGLAACIA--------VTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAM 67
           +S FGS   GG+   +A         T    +E+ K +    G        I  + + A 
Sbjct: 105 LSNFGSGIMGGVTGGVAQAYLTMGFCTCMKTVEITKKKSAGAGA-------IPQSSWGAF 157

Query: 68  GVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFY----EPIRAVMNKTFYPDQESHKVQS 123
             +++ +GI+G+ KG+ A  I Q+   GSR GF     E IR    KT  PD +   ++ 
Sbjct: 158 KEIYKKDGIKGINKGVNAVAIRQMTNWGSRFGFSRLVEEGIRNATGKT-NPDDKLTALEK 216

Query: 124 VGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGV 183
           +  +   G  S         P+ +++  +QS         +     V +  K IY + G+
Sbjct: 217 IAASAIGGGLS-----AWNQPIEVIRVEMQSKKEDP---NRPKNLTVSSAFKYIYQSSGI 268

Query: 184 KGLFRGIDAAI 194
           KGL+RG+   I
Sbjct: 269 KGLYRGVAPRI 279

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 114/287 (39%), Gaps = 57/287 (19%)

Query: 26  GLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVA 85
           GL  C   T+  P+EV+K         MAAN+    + F A+  V+   G+ G  +GL+ 
Sbjct: 26  GLNMCEVTTLGQPLEVIKT-------TMAANRSF--SFFNAIKHVWSRGGVFGFYQGLIP 76

Query: 86  AYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPL 145
               + +  G+ L             F   +  ++ + +G++ F    SGI+G V G   
Sbjct: 77  WAWIEASTKGAVL------------LFVSAESEYQFKRMGLSNFG---SGIMGGVTGGVA 121

Query: 146 -------FLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
                  F    +    +     G        W   K IY  +G+KG+ +G++A  +R  
Sbjct: 122 QAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVNAVAIR-- 179

Query: 199 AGSSVQLPIYNTAKNFL------LRNDIMEDGPSLHLT------ASTISGLGVAVVMNPW 246
                Q+  + +   F       +RN   +  P   LT      AS I G G++    P 
Sbjct: 180 -----QMTNWGSRFGFSRLVEEGIRNATGKTNPDDKLTALEKIAASAIGG-GLSAWNQPI 233

Query: 247 DVILTRIYNQKGDLYKGPIDCLVKTV-----KIEGITALYKGFEAQV 288
           +VI   + ++K D  + P +  V +      +  GI  LY+G   ++
Sbjct: 234 EVIRVEMQSKKEDPNR-PKNLTVSSAFKYIYQSSGIKGLYRGVAPRI 279

>Scas_582.7
          Length = 329

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 75/163 (46%), Gaps = 7/163 (4%)

Query: 128 VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF 187
           + AGA +GI+      P+  +KTR+QS +   K  EQT  T +   +  I   EG   L+
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQSTTT--KGTEQTS-TSIIKQISKISTMEGSLALW 96

Query: 188 RGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTAS-TISGLGVAVVMNPW 246
           +G+ + IL  G   +V    Y   K  L+ +   E    + +  S   + +     MNP+
Sbjct: 97  KGVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATATVASDFFMNPF 156

Query: 247 DVILTRIYNQKGDLYKGPIDCLVKTV-KIEGITALYKGFEAQV 288
           D I  R+  Q  DL K  +  + K +  +EG++A Y  +   +
Sbjct: 157 DTIKQRM--QISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTI 197

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 81/201 (40%), Gaps = 16/201 (7%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G  A   +    NP + +K RMQ+        +++Y        V  +   + GL    
Sbjct: 141 SGATATVASDFFMNPFDTIKQRMQISD---LKKEKVY-------NVAKKIYNLEGLS-AF 189

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
             +Y   IA+N     F   I    +K F P    + +    I+   G  SG I A + +
Sbjct: 190 YYSYPTTIAMNIPFAAFNFMIYESASKFFNPLHHYNPL----IHCLCGGISGAIAAAVTT 245

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWN-GLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           PL  +KT +Q   +++   E       +      I M  G KG +RG+   IL     ++
Sbjct: 246 PLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATA 305

Query: 203 VQLPIYNTAKNFLLRNDIMED 223
           +    Y  AK+FL    ++++
Sbjct: 306 ISWTAYECAKHFLFSTRLLKN 326

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/291 (21%), Positives = 109/291 (37%), Gaps = 31/291 (10%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           AG  A  +  +   PI+ +K R  +Q       ++  T+  + +  +   EG   L KG+
Sbjct: 42  AGAFAGIMEHSTMFPIDALKTR--IQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGV 99

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
            +  +     +      YE  +A +     PD +    Q + + V +GA + +      +
Sbjct: 100 QSVILGAGPAHAVYFATYEFTKAHL----IPDSQRETHQPIKVAV-SGATATVASDFFMN 154

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
           P   +K R+Q  S+  K         V+N  K IY  EG+   +      I      ++ 
Sbjct: 155 PFDTIKQRMQ-ISDLKK-------EKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAF 206

Query: 204 QLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRI---------- 253
              IY +A  F   N +    P +H     ISG   A V  P D I T I          
Sbjct: 207 NFMIYESASKFF--NPLHHYNPLIHCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSL 264

Query: 254 -YNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLE 303
              +K + +K     +   + + G    ++G + ++    P T +  T  E
Sbjct: 265 EVMKKANTFKKATSAI---LMVYGWKGFWRGLQPRILANMPATAISWTAYE 312

>Scas_715.45
          Length = 305

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 77/179 (43%), Gaps = 15/179 (8%)

Query: 38  PIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSR 97
           P E +K++ Q              N  +    ++  EG+ G  KG+   +  QI     +
Sbjct: 135 PFEAIKVKQQTTMPPWC------NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCK 188

Query: 98  LGFYEPI-RAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYS 156
              +E I  A+  +      E   +Q + ++   G  +GI+ A++  P  ++ +++   +
Sbjct: 189 FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKI---N 245

Query: 157 NAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
           N  K+ E  +       LK IY   G  GL+ G+   IL  G  +S Q  IY++ K ++
Sbjct: 246 NERKVNESMNV-----ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/260 (21%), Positives = 102/260 (39%), Gaps = 48/260 (18%)

Query: 19  FGSFTAGGLAACIAV-TVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIR 77
           + + T GG+ AC    +   P++++K R+Q+   L  +N          +  + + EG+ 
Sbjct: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNT-------SGIIQILKKEGLG 68

Query: 78  GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGII 137
            L  G+ A  I        + G YE  + + +     D+ +       I + + A +   
Sbjct: 69  KLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFF 128

Query: 138 GAVMGSPLFLVKTRLQSYSNAIKIGEQT----HYTGVWNGLKTIYMTEGVKGLFRGIDAA 193
             +M  P             AIK+ +QT        V  G K +Y  EG+ G ++GI   
Sbjct: 129 ADIMLCPF-----------EAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPL 177

Query: 194 ILRTGAGSSVQLPIYNTAKNFLLRNDIME----------------DGPSLHLTASTISGL 237
             R       Q+P Y   K F     I+E                   S+      ++G+
Sbjct: 178 WCR-------QIP-YTMCK-FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGI 228

Query: 238 GVAVVMNPWDVILTRIYNQK 257
             A+V +P DV++++I N++
Sbjct: 229 LCAIVSHPADVMVSKINNER 248

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 71/175 (40%), Gaps = 14/175 (8%)

Query: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAIL---RTGA 199
           +PL L+K RLQ         + T Y    +G+  I   EG+  LF G+ A  +     GA
Sbjct: 35  TPLDLIKCRLQV--------DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGA 86

Query: 200 GSSVQLPIYNTAKNFLLRND---IMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQ 256
           G      ++    +  L  D     +   S++L +S  +     +++ P++ I  +    
Sbjct: 87  GKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT 146

Query: 257 KGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHA 311
                   I+   K    EG+   YKG      R  P+T+   T  E+ ++ ++A
Sbjct: 147 MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYA 201

>Kwal_56.23011
          Length = 303

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 121/299 (40%), Gaps = 37/299 (12%)

Query: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKG 82
           T GG+A    V V  P ++ K+R+Q           + T   Q +  + +NEG+    KG
Sbjct: 31  TVGGVAQ---VLVGQPFDITKVRLQ--------TSPVPTTAAQVIKSLVKNEGLLAFYKG 79

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF--AGAASGIIGAV 140
            +A      A    + G  E +     K ++  ++ +  Q + +  +   G  SG   A 
Sbjct: 80  TLAPLAGVGACVSCQFGVNEAL-----KKWFRKKDGNFDQPLALRQYYACGFVSGTANAF 134

Query: 141 MGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAG 200
           + +P+  V+ RLQ  + +    E   Y G  +  + + + +G   L RG  A  LRT  G
Sbjct: 135 LATPIEHVRIRLQLQTASSSAAE---YHGSLDCARKL-LKQG--ALMRGFTATTLRTSHG 188

Query: 201 SSVQLPIY-----NTAKNFLLRNDIMEDGPSLHLTA-STISGLGVAVVMNPWDVI--LTR 252
             +    Y     N A + +LR +I    P+  +      SG     +  P+DV+  + +
Sbjct: 189 FGIYFLTYETLIANQAHHGVLRENI----PAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQ 244

Query: 253 IYNQKGDLY-KGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVH 310
               K  +Y + P+       +  G  A  KGF   + R  P         E TM+L++
Sbjct: 245 ADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEITMRLIN 303

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 74/181 (40%), Gaps = 19/181 (10%)

Query: 117 ESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKT 176
           ++H  +    +VF G   G+   ++G P  + K RLQ+ S       Q         +K+
Sbjct: 16  DTHDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQT-SPVPTTAAQV--------IKS 66

Query: 177 IYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGP---SLHLTAST 233
           +   EG+   ++G  A +   GA  S Q  +    K +  + D   D P     +     
Sbjct: 67  LVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACGF 126

Query: 234 ISGLGVAVVMNPWDVILTRIYNQKGDL----YKGPIDCLVKTVKIEGITALYKGFEAQVF 289
           +SG   A +  P + +  R+  Q        Y G +DC  K +K +G  AL +GF A   
Sbjct: 127 VSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLK-QG--ALMRGFTATTL 183

Query: 290 R 290
           R
Sbjct: 184 R 184

 Score = 34.7 bits (78), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 39/97 (40%), Gaps = 8/97 (8%)

Query: 13  AQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR 72
           A KV  +G+F+     A     +T P +VVK  MQ        N     NP      ++R
Sbjct: 215 AWKVCVYGAFSGAFFWA-----MTYPFDVVKSVMQAD---KLKNPVYGRNPLAVAKAIYR 266

Query: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMN 109
             G R   KG     +  + +NG+    +E    ++N
Sbjct: 267 ERGPRAFTKGFTPTMLRSLPVNGATFAAFEITMRLIN 303

>Kwal_23.4354
          Length = 343

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 130/328 (39%), Gaps = 69/328 (21%)

Query: 35  VTNPIEVVKIRMQLQG-------------------------ELMAANQRIYTNP------ 63
           +  P++VV+IR+Q Q                          ++   + R  T+P      
Sbjct: 28  ILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRASSKGVFWQDICFEDVRCKTSPVRYNST 87

Query: 64  FQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS 123
           + A G + + EG++ L +GL    +     N      YE +R         D+   + + 
Sbjct: 88  WDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLR---------DKSRLQDKY 138

Query: 124 VGIN-VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLK-TIYMTE 181
             +N +  GA + ++ A   +PL L +TRLQS   +    + T    + + +K + Y   
Sbjct: 139 PTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSP--KSTTAMMIKDLIKESRYEIS 196

Query: 182 --GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSL---------HLT 230
             G K LFRG++  + R    SS    IY     F   N  ++   S+         H  
Sbjct: 197 KVGYKALFRGLEITLWRDVPFSS----IYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFV 252

Query: 231 AS----TISGLGVAVVMNPWDVILTR--IYNQKGDLYKGPIDCLVKTV----KIEGITAL 280
            S    +  G   AV+ +P+DV  TR  I      L K P   + K +    K EG+ AL
Sbjct: 253 NSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAAL 312

Query: 281 YKGFEAQVFRIGPHTILCLTFLEQTMKL 308
           Y G   +V +I P   + ++  E   +L
Sbjct: 313 YTGLVPRVIKIAPSCAIMISTYEVCKRL 340

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/212 (19%), Positives = 82/212 (38%), Gaps = 16/212 (7%)

Query: 14  QKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQL--QGELMAANQRIYTNPFQAMGVVF 71
            K         G LA  +A T   P+E+ + R+Q   +    +    +  +  +      
Sbjct: 136 DKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEI 195

Query: 72  RNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVG------ 125
              G + L +GL       +  +    G YE  ++ ++     D E   V S        
Sbjct: 196 SKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSI----DSEKSIVNSSNSNWNHF 251

Query: 126 INVFAGAA-SGIIGAVMGSPLFLVKTRLQ-SYSNAIKIGEQTHYTGVWNGLKTIYMTEGV 183
           +N F G +  G + AV+  P  + KTR+Q +Y N+    E+     ++  L  +  +EG+
Sbjct: 252 VNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTL--EKKPSKNMFKYLNQMRKSEGL 309

Query: 184 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
             L+ G+   +++     ++ +  Y   K   
Sbjct: 310 AALYTGLVPRVIKIAPSCAIMISTYEVCKRLF 341

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 69/163 (42%), Gaps = 11/163 (6%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
            + AGA +GI    +  PL  +KTRLQ+       G Q   + +   L +I   EG   L
Sbjct: 21  QLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVL 80

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISG----LGVAVV 242
           ++G+ + +L  G   +V    Y   K+FL+  D        H   +  SG    +    +
Sbjct: 81  WKGVQSVLLGAGPAHAVYFATYEMVKSFLI--DEATSTSKYHFFKTAFSGATATIAADAL 138

Query: 243 MNPWDVILTRI-YNQKGDLYKGPIDCLVKTVKIEGITALYKGF 284
           MNP+DVI  RI  N    ++    D   +    EG  A Y  +
Sbjct: 139 MNPFDVIKQRIQLNTNISVW----DTAKRIYSKEGFQAFYSSY 177

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/231 (20%), Positives = 90/231 (38%), Gaps = 17/231 (7%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQ-LQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKG 82
           AG  A     +V  P++ +K R+Q +        Q I +   + +  +   EG   L KG
Sbjct: 24  AGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLWKG 83

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMG 142
           + +  +     +      YE +++ +        + H  ++     F+GA + I    + 
Sbjct: 84  VQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTA----FSGATATIAADALM 139

Query: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           +P  ++K R+Q  +N            VW+  K IY  EG +  +      +      ++
Sbjct: 140 NPFDVIKQRIQLNTN----------ISVWDTAKRIYSKEGFQAFYSSYPTTLAINIPFAA 189

Query: 203 VQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRI 253
               IY+TA  +   + +    P +H     ISG   A +  P D I T +
Sbjct: 190 FNFGIYDTATRYFNPSGVYN--PFIHCLCGGISGAACAGLTTPLDCIKTAL 238

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 87/214 (40%), Gaps = 26/214 (12%)

Query: 9   QKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAAN--QRIYTNPFQA 66
           + ++  K   F +  +G  A   A  + NP +V+K R+QL   +   +  +RIY+     
Sbjct: 112 EATSTSKYHFFKTAFSGATATIAADALMNPFDVIKQRIQLNTNISVWDTAKRIYSK---- 167

Query: 67  MGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGI 126
                  EG     +   ++Y   +A+N     F   I     + F P      V +  I
Sbjct: 168 -------EGF----QAFYSSYPTTLAINIPFAAFNFGIYDTATRYFNPS----GVYNPFI 212

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQ---SYSNAIKIGEQTHYTGVWNGLKTIYMTEGV 183
           +   G  SG   A + +PL  +KT LQ   S   ++++ +Q          + IY   G 
Sbjct: 213 HCLCGGISGAACAGLTTPLDCIKTALQVRGSEKVSMEVFKQADTFK--KATRAIYQVYGW 270

Query: 184 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLR 217
           +G + G+   IL     +++    Y  AK+FL  
Sbjct: 271 RGFWSGVKPRILANMPATAISWTAYEFAKHFLFH 304

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 64/316 (20%), Positives = 127/316 (40%), Gaps = 53/316 (16%)

Query: 16  VSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGE------------------------ 51
           ++ F S  +G +A+ +A TV  P+++VK  +Q Q +                        
Sbjct: 1   MASFESALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDI 60

Query: 52  ------LMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIR 105
                 L   N   Y + F A+  +++ EGIRGL +GL  + +       S   +Y  +R
Sbjct: 61  PPVPIKLNENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVR 120

Query: 106 AVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQT 165
               +    ++++ K  ++   +  G  +     +  +P+ L+  R Q+      I    
Sbjct: 121 KCYFRVKLINRKNTKFTTIE-ELLLGIVAAATSQIFTNPISLISARQQTRQG---IDGDN 176

Query: 166 HYTGVWNGLKTIYMTE-GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIM--- 221
            +  V    K IY  +  +KG ++G+  +++ T    S+    Y   K+ L   D M   
Sbjct: 177 DFLTV---AKEIYKEQRSIKGFWKGLKVSLMLT-INPSITYTSYEKLKDALFTTDTMNLK 232

Query: 222 --------EDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQK-GDLYKGPIDCLVKTV 272
                   +  P  + T   +S +  A++  P  +I+++ + Q+ G  +      L    
Sbjct: 233 KELVDSSSQLSPYQNFTLGVLSKMISAIITMP--LIISKAWLQRNGSNFSSFQQVLYYLY 290

Query: 273 KIEGITALYKGFEAQV 288
           K EG+ + +KG   Q+
Sbjct: 291 KNEGLRSWWKGLSPQL 306

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 7/73 (9%)

Query: 11  SAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVV 70
            ++ ++S + +FT G L+  I+  +T P+ + K  +Q  G   ++ Q       Q +  +
Sbjct: 237 DSSSQLSPYQNFTLGVLSKMISAIITMPLIISKAWLQRNGSNFSSFQ-------QVLYYL 289

Query: 71  FRNEGIRGLQKGL 83
           ++NEG+R   KGL
Sbjct: 290 YKNEGLRSWWKGL 302

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 77/353 (21%), Positives = 139/353 (39%), Gaps = 64/353 (18%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQ---------GELMAA 55
           E + + SA +++    S +AG L   + +T   P++VV++R+  Q         G+L   
Sbjct: 4   ETRKEGSAKERMV---SASAGSLVTSLFLT---PLDVVRVRLHQQEMLPSCTCTGQLSKP 57

Query: 56  NQRIYTNP------------------FQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSR 97
             +++                      + +  + + EG+  L +GL    +  +  N   
Sbjct: 58  AGKVFWQDECFANVGCREPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVY 117

Query: 98  LGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSN 157
              YE +R         +        V   +  GA + I+ A   +PL L++TRLQS   
Sbjct: 118 FSGYEALRD--------NSPLASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPR 169

Query: 158 AIKIGEQTHYT--GVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKN-F 214
           A +  E+T Y    +   ++      G + LF+G++  + R    S++    Y   K  F
Sbjct: 170 A-RDTERTIYLIGDLLREMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQF 228

Query: 215 LLRNDIMEDGPSL-HLTAS----TISGLGVAVVMNPWDVILTRIY--------------N 255
             R+    +  +  H   S    ++ G   A++ +P+DV  TR+                
Sbjct: 229 WARHAATHNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKA 288

Query: 256 QKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKL 308
            K D  +G    L    K EGI ALY G   +V +I P   + ++  E + K 
Sbjct: 289 TKTDDSRGMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKF 341

>Scas_697.47
          Length = 328

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 122/307 (39%), Gaps = 32/307 (10%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN---EGIR 77
           S  AGG+    AV   +P +++K+R Q  G+  +    I      A  +   N     ++
Sbjct: 39  SLVAGGVGGVCAVLTGHPFDLIKVRCQ-SGQASSTIHAIKIILKDARAIPTSNMLVNSVK 97

Query: 78  GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGII 137
           G  KG++   +    +       Y+  + ++ ++   D  S ++ ++G    AG  S I 
Sbjct: 98  GFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRS---DSSSAQL-TMGQMAAAGFISAIP 153

Query: 138 GAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
             ++ +P   +K  LQ+         +T + G     K I    GVK LF+G  A + R 
Sbjct: 154 TTLVTAPTERIKVVLQTAG----ANSKTSFIG---AAKNIVKDGGVKSLFKGSLATLARD 206

Query: 198 GAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLT------ASTISGLGVAVVMNPWDVILT 251
           G GS++    Y  +K FL   +   +  +  +       A  I+G+ + +V+ P D I T
Sbjct: 207 GPGSALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKT 266

Query: 252 RIYNQKGDLYKGPIDCLVKT-----VKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTM 306
           ++ +  G         +V       VK  GI   + G    + R  P        +E T 
Sbjct: 267 KLQSSSGS------QSMVAATREIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVELTH 320

Query: 307 KLVHAFE 313
            L   + 
Sbjct: 321 SLFKKYN 327

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 83/186 (44%), Gaps = 27/186 (14%)

Query: 19  FGSFTAGGLAACIAVT-VTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIR 77
            G   A G  + I  T VT P E +K+ +Q  G    AN +  T+   A   + ++ G++
Sbjct: 140 MGQMAAAGFISAIPTTLVTAPTERIKVVLQTAG----ANSK--TSFIGAAKNIVKDGGVK 193

Query: 78  GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVG-INV----FAGA 132
            L KG +A        +      YE     ++K F  D+ +      G +N+     AG 
Sbjct: 194 SLFKGSLATLARDGPGSALYFASYE-----ISKKFLNDRNATAESKTGEVNIANVCLAGG 248

Query: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEG-VKGLFRGID 191
            +G+   ++  P+  +KT+LQS S     G Q+         + IY+  G +KG F G+ 
Sbjct: 249 IAGMSMWLVVFPIDTIKTKLQSSS-----GSQSMVAAT----REIYVKRGGIKGFFPGLG 299

Query: 192 AAILRT 197
            A+LR+
Sbjct: 300 PALLRS 305

>Kwal_34.15907
          Length = 312

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 118/282 (41%), Gaps = 47/282 (16%)

Query: 26  GLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVA 85
           GL  C A T+  P+EV+K         MAAN+ +  N  Q++  V+   G+ G  +GL+ 
Sbjct: 26  GLNLCEATTLGQPLEVIKT-------TMAANRNL--NFGQSVKHVWSRGGVFGFYQGLIP 76

Query: 86  AYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF-AGAASGIIGAVMGSP 144
               + +  G+ L             F   +  ++ + +G+  F AG   G+ G V  + 
Sbjct: 77  WAWIEASTKGAVL------------LFVSAEAEYQFKRLGLGNFGAGIMGGVSGGVAQAY 124

Query: 145 LFLVKTRLQSYSNAIKIGEQTHYTGV---------WNGLKTIYMTEGVKGLFRGIDAAIL 195
           L +       +   +K  E T              W+  K IY  EG+KG+ +G++A  +
Sbjct: 125 LTM------GFCTCMKTVEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGINKGVNAVAI 178

Query: 196 R--TGAGSSVQLP--IYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILT 251
           R  T  GS   L   +    ++F  + +  +   +L    ++  G G++    P +VI  
Sbjct: 179 RQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTALEKIFASALGGGLSAWNQPIEVIRV 238

Query: 252 RIYNQKGDLYKGPIDCLVKTV-----KIEGITALYKGFEAQV 288
            + ++K D  + P    V +      +  GI  LY+G   ++
Sbjct: 239 EMQSKKEDPNR-PKKLTVGSAFKYIYQSSGIKGLYRGVAPRI 279

>Scas_578.3*
          Length = 524

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 93/213 (43%), Gaps = 34/213 (15%)

Query: 16  VSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQ---LQGELMAANQRIYTNPFQAMGVVFR 72
           +SK  ++ AGG+A  +A     PI+ +K R+Q   L+G L      I T        +++
Sbjct: 324 LSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLIST-----AKEMYK 378

Query: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF--- 129
             GIR   +G++   +         LG +  +     K +Y  ++S K+     +V    
Sbjct: 379 EGGIRVFYRGVLLGALGIFPYAALDLGTFSAL-----KKWYIKRQSKKLNIPEKDVMLSY 433

Query: 130 -----AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTH-YTGVWNGLKTIYMT--- 180
                 GA SG +GA    P+ L++TRLQ+       G   H YT  + G + ++M    
Sbjct: 434 LLVLPMGAFSGTVGATAVYPINLLRTRLQAQ------GTYAHPYT--YTGFRDVFMQTLK 485

Query: 181 -EGVKGLFRGIDAAILRTGAGSSVQLPIYNTAK 212
            EGV G ++G+   +++     S+    Y   K
Sbjct: 486 REGVPGFYKGLVPTLVKVCPAVSIGYLCYEKFK 518

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/321 (22%), Positives = 132/321 (41%), Gaps = 37/321 (11%)

Query: 19  FGSFTAGGLAACIAVTVTNPIEVVKI----RMQLQGELMAANQ----------RIYTNPF 64
           FG F AGGL+  I+ T T P++ +K+    R  L   L+              +I +   
Sbjct: 209 FGYFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPII 268

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGS-RLGFYEPIRAVMNKTFYPDQESHKVQS 123
           +A+  ++R  G+R    G     +++I    S + G +E  + +M      D+  + +  
Sbjct: 269 KAIRSLYRQGGLRAFYVG-NGLSVFKICPESSIKFGTFELAKRLM-ANLSGDKLVNDLSK 326

Query: 124 VGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGV 183
           +   V AG  +G++  +   P+  +K R+Q    A   G       + +  K +Y   G+
Sbjct: 327 LQTYV-AGGIAGVMAQISIYPIDTLKFRIQC---APLEGNLKGNALLISTAKEMYKEGGI 382

Query: 184 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRN-----DIMEDGPSLH----LTASTI 234
           +  +RG+    L     +++ L  ++  K + ++      +I E    L     L     
Sbjct: 383 RVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAF 442

Query: 235 SGLGVAVVMNPWDVILTRIYNQ----KGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
           SG   A  + P +++ TR+  Q        Y G  D  ++T+K EG+   YKG    + +
Sbjct: 443 SGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVK 502

Query: 291 IGPHT---ILCLTFLEQTMKL 308
           + P      LC    +  M L
Sbjct: 503 VCPAVSIGYLCYEKFKAAMSL 523

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 77/194 (39%), Gaps = 24/194 (12%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           +G +   +   +T PI V+K+R +       +    YT+   A   +FR EG+RG  +G 
Sbjct: 110 SGAVTRALTGLITMPITVIKVRYE-------STLYQYTSLRYATSHIFRTEGLRGFFRGF 162

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYP--------DQESHKVQSVGINVFAGAASG 135
            A  +      G  + FY+ ++ V+  T  P        D       S  IN  +  ++ 
Sbjct: 163 GATALRDAPYAGLYMLFYDRMK-VLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAA 221

Query: 136 IIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAIL 195
           +I   + +P   VKTR+Q         E   +    +    I   E V+ LF GI   + 
Sbjct: 222 VIATSITAPFDTVKTRMQL--------EPAKFHSFTSTFWHIATKESVRNLFAGISLRLT 273

Query: 196 RTGAGSSVQLPIYN 209
           R    + +   IY 
Sbjct: 274 RKAFSAGIAWGIYE 287

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 82/192 (42%), Gaps = 23/192 (11%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           ++  G + G++ A++  P  L+KTRLQ          Q   + +W  LK+I   E    L
Sbjct: 10  HLIGGFSGGLVSAIILQPFDLLKTRLQ----------QDKTSTLWKTLKSI---ETPSQL 56

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFLLR-NDIMEDG----PSLHLTASTISGLG--- 238
           +RG   + +RT  GS++ L + N+ +  + +  +    G    P L++  +  SG     
Sbjct: 57  WRGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRA 116

Query: 239 -VAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTIL 297
              ++  P  VI  R Y      Y           + EG+   ++GF A   R  P+  L
Sbjct: 117 LTGLITMPITVIKVR-YESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGL 175

Query: 298 CLTFLEQTMKLV 309
            + F ++   LV
Sbjct: 176 YMLFYDRMKVLV 187

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 63/140 (45%), Gaps = 21/140 (15%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           N+F+GA +  +  ++  P+ ++K R +S            YT +      I+ TEG++G 
Sbjct: 107 NMFSGAVTRALTGLITMPITVIKVRYES--------TLYQYTSLRYATSHIFRTEGLRGF 158

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAK----NFLLRNDIMEDGPSLHLT-ASTI----SGL 237
           FRG  A  LR    + + +  Y+  K      L  N +  +  + + T AST+    S  
Sbjct: 159 FRGFGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAF 218

Query: 238 GVAVVMN----PWDVILTRI 253
             AV+      P+D + TR+
Sbjct: 219 SAAVIATSITAPFDTVKTRM 238

>Kwal_23.2913
          Length = 320

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 131/310 (42%), Gaps = 41/310 (13%)

Query: 18  KFGSFTAGGLAACIAVTVTNPIEVVKIRMQ---LQGELMAANQRIYTNPFQAMGVVFRNE 74
            F S  AGG+    AV   +P +++K+R Q     G L A + R+        G +  N+
Sbjct: 28  SFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAIS-RVLHEAKSKSGPLPLNQ 86

Query: 75  GIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINV---FAG 131
            I+G  +G++   +              PI AV   +F+      ++ + G N     AG
Sbjct: 87  -IKGFYRGVIPPLLG-----------VTPIFAV---SFWGYDVGKRLVTWGSNPVTDIAG 131

Query: 132 AASGIIG------AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGL-KTIYMTEGVK 184
           ++S +        A+ G    +  T + + +  +K+  QT  +G + G  +T+    GV+
Sbjct: 132 SSSKLTPLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSESGSFLGAARTLIREGGVR 191

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHL----TASTISGLGVA 240
            LF+G  A + R G GS++    Y  +K FL RN   +D  +L +     A  ++G+ + 
Sbjct: 192 SLFQGTLATLARDGPGSALYFASYEVSKRFLSRN---QDTDALSVVSICVAGGVAGMSMW 248

Query: 241 VVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP---HTIL 297
           + + P D I T++  Q     +  +    +     G+   + G    + R  P    T L
Sbjct: 249 IGVFPIDTIKTKL--QSSSRSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFL 306

Query: 298 CLTFLEQTMK 307
            + F  Q  K
Sbjct: 307 GVEFTHQLFK 316

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 85/219 (38%), Gaps = 21/219 (9%)

Query: 106 AVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNA---IKIG 162
           A +N        SH ++    ++ AG   G+   + G P  L+K R QS   +     I 
Sbjct: 10  ADLNAKIEQASNSHTLRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAIS 69

Query: 163 EQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLL--RNDI 220
              H     +G   +     +KG +RG+   +L      +V    Y+  K  +    N +
Sbjct: 70  RVLHEAKSKSGPLPLNQ---IKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPV 126

Query: 221 ME-DGPSLHLTASTISGLGVA---------VVMNPWDVILTRIYNQKGDLYKGPIDCLVK 270
            +  G S  LT  T S L +A         ++  P + +   +   +   + G    L++
Sbjct: 127 TDIAGSSSKLTPLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSESGSFLGAARTLIR 186

Query: 271 TVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309
                G+ +L++G  A + R GP + L     E + + +
Sbjct: 187 E---GGVRSLFQGTLATLARDGPGSALYFASYEVSKRFL 222

>Kwal_23.5757
          Length = 307

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 78/190 (41%), Gaps = 14/190 (7%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           A   A  IA     P E +K+R Q      A       N F A   +   EG   L KG+
Sbjct: 122 ASASAEFIADIFLCPWEAIKVRQQ-----TAVPPPFARNVFDAYSKMVGAEGFASLYKGI 176

Query: 84  VAAYIYQIALNGSRLGFYEPI-RAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMG 142
              +  QI     +   +E I   +  +   P +E  ++  + ++   G  +GI+ AV+ 
Sbjct: 177 TPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVS 236

Query: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
            P  ++ +++   +N  K GE T           IY   G  GL+ G+   IL  G  +S
Sbjct: 237 HPADVMVSKV---NNERKSGESTL-----QATSRIYGKIGFPGLWNGLAVRILMIGTLTS 288

Query: 203 VQLPIYNTAK 212
            Q  IY++ K
Sbjct: 289 FQWLIYDSFK 298

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 69/178 (38%), Gaps = 21/178 (11%)

Query: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           +PL LVK R Q         + + Y    +G + I  +EG   +F G+ A    T  G S
Sbjct: 38  TPLDLVKCRRQV--------DASLYKSNLDGWRQIVRSEGATKVFTGVGA----TAIGYS 85

Query: 203 VQLPIYNTAKNFLLRNDIMEDGPS--------LHLTASTISGLGVAVVMNPWDVILTRIY 254
           +Q         F          P         + L AS  +     + + PW+ I  R  
Sbjct: 86  LQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQ 145

Query: 255 NQKGDLY-KGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHA 311
                 + +   D   K V  EG  +LYKG     FR  P+T+   T  E+ +++++A
Sbjct: 146 TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYA 203

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/285 (21%), Positives = 117/285 (41%), Gaps = 30/285 (10%)

Query: 19  FGSFTAGGLAACIAV-TVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIR 77
           + + T GGL AC    +   P+++VK R Q+   L  +N             + R+EG  
Sbjct: 19  YAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN-------LDGWRQIVRSEGAT 71

Query: 78  GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGII 137
            +  G+ A  I        + G YE  +   ++   P+  +H  ++ GI + A A++  I
Sbjct: 72  KVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPE-TAHSYRT-GIFLAASASAEFI 129

Query: 138 GAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
             +   P   +K R Q+   A+          V++    +   EG   L++GI     R 
Sbjct: 130 ADIFLCPWEAIKVRQQT---AVP---PPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQ 183

Query: 198 GAGSSVQLPIYNT------AKNFLLRNDIMEDGP-SLHLTASTISGLGVAVVMNPWDVIL 250
              +  +   +        A+    + ++ + G  S+      ++G+  AVV +P DV++
Sbjct: 184 IPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMV 243

Query: 251 TRIYNQKGDLYKGPIDCLVKTVKIE---GITALYKGFEAQVFRIG 292
           +++ N++    K     L  T +I    G   L+ G   ++  IG
Sbjct: 244 SKVNNER----KSGESTLQATSRIYGKIGFPGLWNGLAVRILMIG 284

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 122/300 (40%), Gaps = 69/300 (23%)

Query: 21  SFTAGGLAACI----AVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGI 76
           SF+   L AC+      T+  P+EVVK         MAAN+       +++  V+   GI
Sbjct: 19  SFSNILLGACLNLSEVTTLGQPLEVVKT-------TMAANRNFTF--LESVKHVWSRGGI 69

Query: 77  RGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGI 136
            G  +GL+     + +  G+ L             F   +  ++ +S+G+N FA   SGI
Sbjct: 70  LGYYQGLIPWAWIEASTKGAVL------------LFVSAEAEYRFKSLGLNNFA---SGI 114

Query: 137 IGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGV---------WNGLKTIYMTEGVKGLF 187
           +G V G       T    +   +K  E T +            W+  K IY  EG++G+ 
Sbjct: 115 LGGVTGGVTQAYLT--MGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGIN 172

Query: 188 RGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDG---------------PSLHLTAS 232
           +G++A  +R          + N    F L + ++EDG               P   + AS
Sbjct: 173 KGVNAVAIRQ---------MTNWGSRFGL-SRLVEDGIRKITGKTNKDDKLNPFEKIGAS 222

Query: 233 TISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKI----EGITALYKGFEAQV 288
            + G G++    P +VI   + ++K D  +     + KT K      G+  LY+G   ++
Sbjct: 223 ALGG-GLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRI 281

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 129/287 (44%), Gaps = 24/287 (8%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVF-RNEGIRGLQKG 82
           +G  A  I    ++P++++K+R+Q     ++A  R  T     +  +F R +  R L +G
Sbjct: 14  SGLTAGTITTIASHPLDLLKLRLQ-----LSAGNRANTTYTGLIRDIFERQQWGRELYRG 68

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQES---HKVQSVGINVFAGAASGIIGA 139
           L    +          G Y   + +  +    +  +    +       + A  +SGI  A
Sbjct: 69  LGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGIATA 128

Query: 140 VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199
           V+ +P++++KTR+ + S A        Y   ++G+  +Y TEGV   +RG+  ++L    
Sbjct: 129 VLTNPIWVIKTRIMATSRA------GPYKSTFDGVYKLYQTEGVLAFWRGVVPSLLGVSQ 182

Query: 200 GSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLG-VAVVMNPWDVILTRIYNQKG 258
           G ++   +Y+T K   L +    D     L+ S I G+  ++ +++   V   ++   K 
Sbjct: 183 G-AIYFALYDTLKFHYLHSS--TDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSKL 239

Query: 259 DLYKGP--IDCLVKTV-KIEGITALYKGFEAQVFRIGPHTILCLTFL 302
             +  P  I  LV+TV   EGI   Y+G  A + R  P T  C+TF 
Sbjct: 240 QDFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPAT--CITFF 284

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 84/191 (43%), Gaps = 21/191 (10%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           A G +      +TNPI V+K R+     +  +    Y + F  +  +++ EG+    +G+
Sbjct: 119 AAGSSGIATAVLTNPIWVIKTRI-----MATSRAGPYKSTFDGVYKLYQTEGVLAFWRGV 173

Query: 84  VAAYIYQIALNGSRLGFYEPIR--AVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVM 141
           V + +  ++        Y+ ++   + + T   ++     + +GI       S +I    
Sbjct: 174 VPSLL-GVSQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCI----SKMISVTS 228

Query: 142 GSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201
             P  L+K++LQ +            +G+   ++T+Y  EG++G +RG+ A +LR    +
Sbjct: 229 VYPFQLLKSKLQDFGAP---------SGITQLVQTVYSREGIRGFYRGLSANLLRAVPAT 279

Query: 202 SVQLPIYNTAK 212
            +   +Y   K
Sbjct: 280 CITFFVYENIK 290

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 82/176 (46%), Gaps = 17/176 (9%)

Query: 119 HKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIY 178
           H++ S+   V +G  +G I  +   PL L+K RLQ  +        T YTG+   ++ I+
Sbjct: 3   HELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGN---RANTTYTGL---IRDIF 56

Query: 179 MTEGV-KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRN-------DIMEDGPSLH-- 228
             +   + L+RG+   +L      ++    Y  AK+  LR+        IM+     H  
Sbjct: 57  ERQQWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAY 116

Query: 229 LTASTISGLGVAVVMNPWDVILTRIY-NQKGDLYKGPIDCLVKTVKIEGITALYKG 283
           + A+  SG+  AV+ NP  VI TRI    +   YK   D + K  + EG+ A ++G
Sbjct: 117 MLAAGSSGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAFWRG 172

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/286 (20%), Positives = 121/286 (42%), Gaps = 32/286 (11%)

Query: 19  FGSFTAGGLAACIAV-TVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIR 77
           + + T GG+ AC    +   P+++VK R+Q+       N ++YT+  Q    +  NEG +
Sbjct: 18  YATCTLGGIIACGPTHSSITPLDLVKCRLQV-------NPKLYTSNLQGFRKIIANEGWK 70

Query: 78  GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGII 137
            +  G  A ++        + G YE  + + +    P         V + + A A +  +
Sbjct: 71  KVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSP--------GVTVYLMASATAEFL 122

Query: 138 GAVMGSPLFLVKTRLQS----YSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF-RGIDA 192
             +M  P   +K + Q+    + N +  G +  Y     G+K  Y  +G+  L+ R I  
Sbjct: 123 ADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAES-GGMKAFY--KGIVPLWCRQIPY 179

Query: 193 AILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTR 252
            + +  +   +   IY+         + ++   S+      ++G+  A V +P DV++++
Sbjct: 180 TMCKFTSFEKIVQKIYSVLPKKKEEMNALQQ-ISVSFVGGYLAGILCAAVSHPADVMVSK 238

Query: 253 IYNQKGDLYKGPIDCLVKTVKIE---GITALYKGFEAQVFRIGPHT 295
           I +++    K      V + +I    G T L+ G   ++  IG  T
Sbjct: 239 INSER----KANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLT 280

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 83/201 (41%), Gaps = 30/201 (14%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAAN-----QRIYTNPFQAMGVVFRNEGIRG 78
           A   A  +A  +  P E +K++ Q        N     +++Y            + G++ 
Sbjct: 115 ASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYA----------ESGGMKA 164

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPI----RAVMNKTFYPDQESHKVQSVGINVFAGAAS 134
             KG+V  +  QI     +   +E I     +V+ K     +E + +Q + ++   G  +
Sbjct: 165 FYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKK---KEEMNALQQISVSFVGGYLA 221

Query: 135 GIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAI 194
           GI+ A +  P  ++ +++ S        E+     +    K IY   G  GL+ G+   I
Sbjct: 222 GILCAAVSHPADVMVSKINS--------ERKANESMSVASKRIYQKIGFTGLWNGLMVRI 273

Query: 195 LRTGAGSSVQLPIYNTAKNFL 215
           +  G  +S Q  IY++ K ++
Sbjct: 274 VMIGTLTSFQWLIYDSFKAYV 294

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 69/170 (40%), Gaps = 11/170 (6%)

Query: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           +PL LVK RLQ             YT    G + I   EG K ++ G  A  +      +
Sbjct: 37  TPLDLVKCRLQV--------NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGA 88

Query: 203 VQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYK 262
            +   Y   K+  L +  +  G +++L AS  +     +++ P++ I  +          
Sbjct: 89  GKYGGYEYFKH--LYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN 146

Query: 263 GPIDCLVKT-VKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHA 311
             +D   K   +  G+ A YKG      R  P+T+   T  E+ ++ +++
Sbjct: 147 NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYS 196

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 113/280 (40%), Gaps = 42/280 (15%)

Query: 26  GLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVA 85
           GL      T+  P+EVVK  M    E          N  QA   V+   GI G  +GL+ 
Sbjct: 20  GLNLSEVTTLGQPLEVVKTTMAAHREF---------NFLQATKHVWSRGGIFGFYQGLIP 70

Query: 86  AYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF-AGAASGIIGAVMGSP 144
               + +  G+ L             F   +  ++ + +G+N F AG   GI G V  + 
Sbjct: 71  WAWIEASTKGAVL------------LFVSAEAEYRFKVLGLNNFGAGIMGGITGGVTQAY 118

Query: 145 LFL--------VKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILR 196
           L +        V+   Q  +N   +  Q+     W   K+IY  EG++G+ +G++A  +R
Sbjct: 119 LTMGFCTCMKTVEITRQKAANVPGVIPQSS----WQVFKSIYKKEGIRGINKGVNAVAIR 174

Query: 197 --TGAGSSVQLP--IYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTR 252
             T  GS   L   + +  +    +    +   +L    ++  G G++    P +VI   
Sbjct: 175 QMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGLSAWNQPIEVIRVE 234

Query: 253 IYNQKGDLYKGPIDCLVKTVKI----EGITALYKGFEAQV 288
           + ++K D  +     + KT K      G+  LY+G   +V
Sbjct: 235 MQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRV 274

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 74/321 (23%), Positives = 121/321 (37%), Gaps = 36/321 (11%)

Query: 1   MAKG-EDKIQKS-AAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQR 58
           MA G +D  + S  A++     S  AG  AA    T+++P E +K   QL   L  A   
Sbjct: 1   MADGTQDGTEASLVAERHGVRSSVIAGAAAAVFQTTMSHPFEFLKTGQQLHRALPGAAAF 60

Query: 59  IYTNPFQAM--GVVFRNEGIRGLQKGLVAAYIYQ-------------------IALNGSR 97
              +PF+    G    N G   L+ G   A   Q                   + L G+ 
Sbjct: 61  NMLHPFKYYFSGCAALNVGTL-LKTGTRFATFEQACVWLRDPEHADQPIAGPRLLLAGAI 119

Query: 98  LGFYE-----PIRAVMNKTFYPDQE-SHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTR 151
            GF E     P  ++         E S +VQ       A  + G            V+T 
Sbjct: 120 TGFLESLWVVPFESIKTTAVENALELSRRVQGEPETRAAAVSKGPAPKATFHAARPVQTA 179

Query: 152 LQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTA 211
            + +    +    +H+ G    +  IY T GV+G  +G    I R    S V+   Y   
Sbjct: 180 HERWLLHYERQPSSHFAGT---VLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWI 236

Query: 212 KNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGDL-YKGPIDCLVK 270
              L  +  +++  +    A  +S   V  +  P DVI TR+ ++     YK  ++C  +
Sbjct: 237 VQSLSPHKALDEYQA--FAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYR 294

Query: 271 TVKIEGITALYKGFEAQVFRI 291
               EG   ++KG+  ++F++
Sbjct: 295 IFVEEGFRYMWKGWVPRLFKV 315

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 6/85 (7%)

Query: 11  SAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVV 70
           S  + + ++ +F AG L++   V +T PI+V+K RMQ +          Y +       +
Sbjct: 241 SPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWF-----TYKSSLNCAYRI 295

Query: 71  FRNEGIRGLQKGLVAAYIYQIALNG 95
           F  EG R + KG V   +++++L+G
Sbjct: 296 FVEEGFRYMWKGWVPR-LFKVSLSG 319

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/147 (20%), Positives = 61/147 (41%), Gaps = 14/147 (9%)

Query: 70  VFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF 129
           ++R  G+RG  +G +     Q+  +  R   Y    A + ++  P +   + Q+      
Sbjct: 202 IYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTY----AWIVQSLSPHKALDEYQAFA---- 253

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
           AGA S      +  P+ ++KTR+QS +          Y    N    I++ EG + +++G
Sbjct: 254 AGALSSAAVVALTQPIDVIKTRMQSKTAWFT------YKSSLNCAYRIFVEEGFRYMWKG 307

Query: 190 IDAAILRTGAGSSVQLPIYNTAKNFLL 216
               + +      +   +Y   +N +L
Sbjct: 308 WVPRLFKVSLSGGISFGVYQYVENLVL 334

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 118/295 (40%), Gaps = 29/295 (9%)

Query: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKG 82
           TAGG++    V +  P +  K+R+Q           + T     +  + +NEG RG  KG
Sbjct: 31  TAGGVSQ---VLIGQPFDTTKVRLQ--------TSSVPTTALDVVKKLVKNEGFRGFYKG 79

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYP-DQESHKVQSVGINVF--AGAASGIIGA 139
            +   +   A    + G  E     M + F+  +  S   +++G+  +   G A G   +
Sbjct: 80  TLTPLVGVGACVSVQFGVNE----AMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANS 135

Query: 140 VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199
            + SP+  V+ RLQ+ +     G    + G  + +K +        L RG+   +LR   
Sbjct: 136 FLASPIEHVRIRLQTQTGT---GAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESH 189

Query: 200 GSSVQLPIYNTA-KNFLLRNDIMEDGPSLHLTA-STISGLGVAVVMNPWDVILTRIYNQK 257
           G  V    Y     N L +     + P+  L      SG  + +++ P DVI + +    
Sbjct: 190 GCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDS 249

Query: 258 GDLYKGPIDCL--VKTV-KIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309
               K   + L   KT+    G+++ +KGF   + R  P         E  M+++
Sbjct: 250 LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 75/182 (41%), Gaps = 21/182 (11%)

Query: 118 SHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTI 177
           +H    V  ++ AG A G+   ++G P    K RLQ+ S           T   + +K +
Sbjct: 17  AHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP---------TTALDVVKKL 67

Query: 178 YMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL-LRNDIMEDGPSLHLTASTISG 236
              EG +G ++G    ++  GA  SVQ  +    K F   RN       +L L    + G
Sbjct: 68  VKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCG 127

Query: 237 L--GVA--VVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITALYKGFEAQV 288
              G A   + +P + +  R+  Q G      + GP+DC+    K+    +L +G    +
Sbjct: 128 FAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCI---KKLTANNSLMRGLTPTM 184

Query: 289 FR 290
            R
Sbjct: 185 LR 186

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 63/301 (20%), Positives = 117/301 (38%), Gaps = 36/301 (11%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEG-IRGLQKGL 83
           G +A  +   +  P + VK+R+Q QG      + ++ + +  +   ++NEG I+G  +G+
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQTQG------RHVFPDTWSCITYTYKNEGIIKGFFQGI 73

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
            +        N +    Y      +       Q    V  +   + +GA +G   + + +
Sbjct: 74  ASPLAGAAIENAALFLSYNQCSKFL-------QHYTNVSDLTNILISGAFAGSCASFVLT 126

Query: 144 PLFLVKTRLQ-SYSNAIKIG------EQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILR 196
           P+ L+K +LQ S   ++ +G          +T +   ++ +    G  GL++G     +R
Sbjct: 127 PVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIR 186

Query: 197 TGAGSSVQLPIYNTAKNFLLRNDIMEDGPSL-------HLTASTIS-GLGVAVVMNPWDV 248
              G       Y   K +L     +ED PSL        L AS  S GL     + P D 
Sbjct: 187 ESFGGVAWFATYELMKKYLKSRHNIED-PSLPNDNKTWELLASGASAGLAFNASIFPADT 245

Query: 249 ILTRIYNQKGDLYKGPIDCLVKTVKIE-GITALYKGFEAQVFRIGPHTILCLTFLEQTMK 307
           + + +  +   L        +K + +E G+   Y+G    + R  P         E   K
Sbjct: 246 VKSMMQTEHLGL-----KTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYETLSK 300

Query: 308 L 308
           L
Sbjct: 301 L 301

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 80/196 (40%), Gaps = 20/196 (10%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQ---LQGELM------AANQRIYTNPFQAMGVVFRNE 74
           +G  A   A  V  P+E++K ++Q   LQ   +         +R +T     +  V +N 
Sbjct: 113 SGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTER-HTRIIPTIQAVIKNR 171

Query: 75  GIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAAS 134
           G  GL +G    +I +     +    YE ++  +      +  S    +    + A  AS
Sbjct: 172 GFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGAS 231

Query: 135 GIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAI 194
              G    + +F   T        +K   QT + G+   +K I++ +G++G +RG+   +
Sbjct: 232 A--GLAFNASIFPADT--------VKSMMQTEHLGLKTAIKKIFVEKGLRGFYRGLGITL 281

Query: 195 LRTGAGSSVQLPIYNT 210
           +R    ++    +Y T
Sbjct: 282 IRAIPANATVFYVYET 297

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 61/128 (47%), Gaps = 10/128 (7%)

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGL----KTIYMTEGVKG 185
           AG  SG     + +PL  +K   Q+ SN       T YTG   GL    K I++ +GV+G
Sbjct: 39  AGGISGSCAKTLIAPLDRIKILFQT-SNP----HYTKYTGSLIGLVEAAKHIWINDGVRG 93

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNP 245
            F+G  A +LR    ++V+   Y   +N L+ +   E      L + +++GL    +  P
Sbjct: 94  FFQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESH-WRRLVSGSLAGLCSVFITYP 152

Query: 246 WDVILTRI 253
            D++  R+
Sbjct: 153 LDLVRVRL 160

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 50/104 (48%), Gaps = 7/104 (6%)

Query: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQ 65
           +++QK   + +  +    +GGLA   + T   P E+++ R+Q+      + + +Y + FQ
Sbjct: 252 ERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSA---LSPKTMYDHKFQ 308

Query: 66  AMG----VVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIR 105
           ++     ++F+  G+RG   GL   YI    +       YE ++
Sbjct: 309 SISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERMK 352

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 9/142 (6%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           AGG++   A T+  P++ +KI  Q                 +A   ++ N+G+RG  +G 
Sbjct: 39  AGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGH 98

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
            A  +        +   YE IR     T  P +E    +S    + +G+ +G+    +  
Sbjct: 99  SATLLRIFPYAAVKFVAYEQIR----NTLIPSKE---FESHWRRLVSGSLAGLCSVFITY 151

Query: 144 PLFLVKTRL--QSYSNAIKIGE 163
           PL LV+ RL  ++    +K+G 
Sbjct: 152 PLDLVRVRLAYETEHKRVKLGR 173

>Kwal_0.232
          Length = 274

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 84/211 (39%), Gaps = 26/211 (12%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64
            D++ ++A    S     +AG +AAC+   V  P EV+K R Q              +  
Sbjct: 89  SDQVAETATHMFSS----SAGEIAACM---VRVPAEVIKQRTQTHKS---------DSSL 132

Query: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSV 124
           Q +  + +NE   G+++ L   +   +           P+   + K +       +V   
Sbjct: 133 QTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQFPLYEFLKKQWAISGGREQVAPW 192

Query: 125 GINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK 184
               F G  +G I A   +PL ++KTRL     ++ +    H        + IY TEG K
Sbjct: 193 Q-GAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVPV---LHLA------RQIYATEGWK 242

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
             F G+    +   AG ++ L +Y T  + L
Sbjct: 243 VFFSGVGPRTVWISAGGAIFLGVYETVHSIL 273

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 78/184 (42%), Gaps = 31/184 (16%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           ++ AGAA+G    +   P+  +KTRLQ+                       +   G  G+
Sbjct: 9   SLLAGAAAGTSTDLFFFPIDTLKTRLQAAGG-------------------FFANGGYLGV 49

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAK--------NFLLRNDIMEDGPSLHLTASTISGLG 238
           +RG+ +A++ +   +S+    Y+  K        N +  +D + +  + H+ +S+   + 
Sbjct: 50  YRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAE-TATHMFSSSAGEIA 108

Query: 239 VAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITA-LYKGFEAQVFRIGPHTIL 297
             +V  P +VI  R    K D     +  L++    EGI   LY+G+   V R  P T  
Sbjct: 109 ACMVRVPAEVIKQRTQTHKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFT-- 166

Query: 298 CLTF 301
           C+ F
Sbjct: 167 CIQF 170

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/287 (21%), Positives = 109/287 (37%), Gaps = 49/287 (17%)

Query: 21  SFTAGGLAACIAVTVTN----PIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGI 76
           SF    LA   A T T+    PI+ +K R+Q                  A G  F N G 
Sbjct: 5   SFITSLLAGAAAGTSTDLFFFPIDTLKTRLQ------------------AAGGFFANGGY 46

Query: 77  RGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYP-DQESHKVQSVGINVFAGAASG 135
            G+ +GL +A +            Y+ +++     F      S +V     ++F+ +A  
Sbjct: 47  LGVYRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGE 106

Query: 136 IIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG----LFRGID 191
           I   ++  P  ++K R Q++ +   +  QT        LK +   E  +G    L+RG  
Sbjct: 107 IAACMVRVPAEVIKQRTQTHKSDSSL--QT--------LKKLLQNENGEGIRRNLYRGWS 156

Query: 192 AAILRTGAGSSVQLPIYN-TAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVIL 250
             ++R    + +Q P+Y    K + +     +  P        ++G   A    P DV+ 
Sbjct: 157 TTVMREIPFTCIQFPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLK 216

Query: 251 TRIYNQKGDLYKGPIDCLVKTV-KIEGITALYKGFEAQVFRIGPHTI 296
           TR+      +   P+  L + +   EG    + G       +GP T+
Sbjct: 217 TRLMLSHTSV---PVLHLARQIYATEGWKVFFSG-------VGPRTV 253

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/301 (22%), Positives = 112/301 (37%), Gaps = 43/301 (14%)

Query: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN--EGIRGLQ 80
           TAG ++   + T+T P E +K  +QL   ++AA       PF+ +G   R    G   + 
Sbjct: 14  TAGSVSGLFSATITYPFEFLKTGLQLHRNVVAAK------PFEVLGYQVRTYFAGCSAVN 67

Query: 81  KGLV-------------------AAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKV 121
            G+V                    A      L+G +L     +   M        E+ KV
Sbjct: 68  IGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQLLMAGALTGTMESLCIIPFENVKV 127

Query: 122 QSVGINVFA-----GAASGIIGAVMGS--PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGL 174
             +  ++ +        S + G V       F  K  L+S   A+    +   T V    
Sbjct: 128 AMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEAL--FPEKLPTNVLTTA 185

Query: 175 KTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTI 234
             +Y   G++  F+G    ++R    S V+   +   K F  +    ++          I
Sbjct: 186 AELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKE--YQNNEYFATLLGLI 243

Query: 235 SGLGVAVVMNPWDVILTRIYNQKGD---LYKGPIDCLVKTVKIEGITALYKGFEAQVFRI 291
           S   V     P DVI TR+  Q  D   LY+  I+C  +    EG   L+KG+  ++ ++
Sbjct: 244 SSCAVVGATQPLDVIKTRM--QAKDSVLLYRNSINCAYRIFVEEGFAMLWKGWLPRLMKV 301

Query: 292 G 292
           G
Sbjct: 302 G 302

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 7/79 (8%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLV 84
           G +++C  V  T P++V+K RMQ +  ++     +Y N       +F  EG   L KG +
Sbjct: 241 GLISSCAVVGATQPLDVIKTRMQAKDSVL-----LYRNSINCAYRIFVEEGFAMLWKGWL 295

Query: 85  AAYIYQIALNGS-RLGFYE 102
              + ++ L+GS   G Y+
Sbjct: 296 PR-LMKVGLSGSVSFGIYQ 313

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 117/297 (39%), Gaps = 43/297 (14%)

Query: 16  VSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEG 75
           V +     AG L    ++ VT P+  V I   LQ +   A  ++     + +  ++   G
Sbjct: 9   VDELAHAIAGSLGGAASIAVTYPL--VTITTNLQTKENEARPKL-----ETIKEIYNKNG 61

Query: 76  IRGLQKGLVAAYIYQIALNGSRLGFYE----PIRAVMNKTFYPDQESHKVQSVGINVFAG 131
           I G   GL +A       N     FYE      R +  K +    ES         + A 
Sbjct: 62  IIGYFLGLESAVYGMATTNFVYYYFYEWCAKTARTLTTKQYLSTWES---------ILAS 112

Query: 132 AASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKT---IYMTEGVKGLFR 188
             +G + AV  +P+++  TR+        + +  H T     L+T   I  T+G   L  
Sbjct: 113 TIAGSMTAVASNPIWVANTRMT-------VAKSNHST-----LRTVIDIVKTDGPLTLLN 160

Query: 189 GIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMED-GPSLHLTASTISGLGVAVVMNPWD 247
           G+  A++   +   +Q  +Y   KN +LR    +   PS       I  L       P+ 
Sbjct: 161 GLKPALVLV-SNPIIQYTVYEQLKNLVLRLQRKKVLSPSWAFLLGAIGKLAATGTTYPYI 219

Query: 248 VILTRIYNQKGD--LYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFL 302
            + TR++  + D    K     +V+ VK +G++ LY G   ++ +    +I+   FL
Sbjct: 220 TLKTRMHLMQNDPKHQKSMWSLIVEIVKKDGVSGLYNGVAVKLVQ----SIMTAAFL 272

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 77/190 (40%), Gaps = 18/190 (9%)

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189
           AG+  G     +  PL  + T LQ+  N  +   +T        +K IY   G+ G F G
Sbjct: 17  AGSLGGAASIAVTYPLVTITTNLQTKENEARPKLET--------IKEIYNKNGIIGYFLG 68

Query: 190 IDAAILRTGAGSSVQLPIYN----TAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNP 245
           +++A+      + V    Y     TA+    +  +      L   ASTI+G   AV  NP
Sbjct: 69  LESAVYGMATTNFVYYYFYEWCAKTARTLTTKQYLSTWESIL---ASTIAGSMTAVASNP 125

Query: 246 WDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQT 305
             V  TR+   K +     +  ++  VK +G   L  G +  +  +  + I+  T  EQ 
Sbjct: 126 IWVANTRMTVAKSN--HSTLRTVIDIVKTDGPLTLLNGLKPALVLVS-NPIIQYTVYEQL 182

Query: 306 MKLVHAFESK 315
             LV   + K
Sbjct: 183 KNLVLRLQRK 192

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/187 (20%), Positives = 75/187 (40%), Gaps = 19/187 (10%)

Query: 11  SAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVV 70
           +  Q +S + S  A  +A  +    +NPI V   RM +      +N     +  + +  +
Sbjct: 98  TTKQYLSTWESILASTIAGSMTAVASNPIWVANTRMTVA----KSNH----STLRTVIDI 149

Query: 71  FRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFA 130
            + +G   L  GL  A +  ++    +   YE ++ ++ +      +  KV S       
Sbjct: 150 VKTDGPLTLLNGLKPALVL-VSNPIIQYTVYEQLKNLVLRL-----QRKKVLSPSWAFLL 203

Query: 131 GAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGI 190
           GA   +       P   +KTR+    N  K     H   +W+ +  I   +GV GL+ G+
Sbjct: 204 GAIGKLAATGTTYPYITLKTRMHLMQNDPK-----HQKSMWSLIVEIVKKDGVSGLYNGV 258

Query: 191 DAAILRT 197
              ++++
Sbjct: 259 AVKLVQS 265

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 76/194 (39%), Gaps = 16/194 (8%)

Query: 25  GGLAACIAV-TVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
            G+AA +A   + NP + +K R+QLQ +  +++  ++   F     +++NEG        
Sbjct: 140 SGVAATVAADALMNPFDTIKQRLQLQSK--SSDSSMWRMAFN----IYKNEGPMAFFYSY 193

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
                  I         YE      N T           +  I+   G  +G   A + +
Sbjct: 194 PTTLAMNIPFAALNFVIYESSTKFFNPT--------NAYNPWIHCLCGGIAGATCAAVTT 245

Query: 144 PLFLVKTRLQSY-SNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           PL  +KT LQ   S+ + +             + I+ + G KG +RG+   ++     ++
Sbjct: 246 PLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATA 305

Query: 203 VQLPIYNTAKNFLL 216
           +    Y  AK+ L 
Sbjct: 306 ISWTSYEFAKHLLF 319

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/241 (19%), Positives = 85/241 (35%), Gaps = 27/241 (11%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGEL-------------MAANQRIYTNPFQAMGVV 70
           AG  A  +  ++  PI+ +K RMQ   E+              A+         Q +  +
Sbjct: 26  AGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQISRI 85

Query: 71  FRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFA 130
              EG   L +G+ +  +     +      YE  +  +      D  +H+     +   +
Sbjct: 86  SSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDA--KDFNTHQPLKTAV---S 140

Query: 131 GAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGI 190
           G A+ +    + +P   +K RLQ       +  ++  + +W     IY  EG    F   
Sbjct: 141 GVAATVAADALMNPFDTIKQRLQ-------LQSKSSDSSMWRMAFNIYKNEGPMAFFYSY 193

Query: 191 DAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVIL 250
              +      +++   IY ++  F   N      P +H     I+G   A V  P D I 
Sbjct: 194 PTTLAMNIPFAALNFVIYESSTKFF--NPTNAYNPWIHCLCGGIAGATCAAVTTPLDCIK 251

Query: 251 T 251
           T
Sbjct: 252 T 252

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 41/200 (20%), Positives = 70/200 (35%), Gaps = 13/200 (6%)

Query: 124 VGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSN------------AIKIGEQTHYTGVW 171
           +   + AGA +GI+   +  P+  +KTR+Q+ S             A           + 
Sbjct: 20  LSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLL 79

Query: 172 NGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLR-NDIMEDGPSLHLT 230
             +  I  TEG   L+RG+ + ++  G   +V    Y   K  L+   D     P     
Sbjct: 80  QQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTAV 139

Query: 231 ASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
           +   + +    +MNP+D I  R+  Q                K EG  A +  +   +  
Sbjct: 140 SGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYPTTLAM 199

Query: 291 IGPHTILCLTFLEQTMKLVH 310
             P   L     E + K  +
Sbjct: 200 NIPFAALNFVIYESSTKFFN 219

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/289 (22%), Positives = 113/289 (39%), Gaps = 52/289 (17%)

Query: 19  FGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRG 78
           F S  +G  A      V  PI+ +K R+Q                  A G  F N G +G
Sbjct: 5   FLSLLSGAAAGTSTDLVFFPIDTIKTRLQ------------------AKGGFFANGGYKG 46

Query: 79  LQKGLVAAYIYQIALNGSRLGF--YEPI----RAVMNKTFYPDQESHKVQSVGINVFAGA 132
           + +GL +A +   +  G+ L F  Y+ +    R  ++K +   Q S ++     ++ + +
Sbjct: 47  IYRGLGSAVV--ASAPGASLFFISYDYMKVKSRPYISKLY--SQGSEQLIDTTTHMLSSS 102

Query: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG----LFR 188
              I   ++  P  +VK R Q +S              W  L++I   +  +G    L+R
Sbjct: 103 IGEICACLVRVPAEVVKQRTQVHST----------NSSWQTLQSILRNDNKEGLRKNLYR 152

Query: 189 GIDAAILRTGAGSSVQLPIYNTAKNFLLR-NDIMEDGPSLHLTASTISGLGVAVVMNPWD 247
           G    I+R    + +Q P+Y   K    + N   +  P       +I+G   A    P D
Sbjct: 153 GWSTTIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLD 212

Query: 248 VILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTI 296
            + TR+   K     G +  +++  + EG    + G       +GP T+
Sbjct: 213 FLKTRLMLNKTTASLGSV--IIRIYREEGPAVFFSG-------VGPRTM 252

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 77/198 (38%), Gaps = 22/198 (11%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           S + G + AC+   V  P EVVK R Q+             + +Q +  + RN+   GL+
Sbjct: 100 SSSIGEICACL---VRVPAEVVKQRTQVHST---------NSSWQTLQSILRNDNKEGLR 147

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140
           K L   +   I           P+   + KT+       +V+        G+ +G I A 
Sbjct: 148 KNLYRGWSTTIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEPWK-GAICGSIAGGIAAA 206

Query: 141 MGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAG 200
             +PL  +KTRL        +G           +  IY  EG    F G+    +   AG
Sbjct: 207 TTTPLDFLKTRLMLNKTTASLGSV---------IIRIYREEGPAVFFSGVGPRTMWISAG 257

Query: 201 SSVQLPIYNTAKNFLLRN 218
            ++ L +Y T  + L ++
Sbjct: 258 GAIFLGMYETVHSLLSKS 275

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/185 (20%), Positives = 80/185 (43%), Gaps = 30/185 (16%)

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185
           +++ +GAA+G    ++  P+  +KTRLQ+                       +   G KG
Sbjct: 6   LSLLSGAAAGTSTDLVFFPIDTIKTRLQAKGG-------------------FFANGGYKG 46

Query: 186 LFRGIDAAILRTGAGSSVQLPIYN--TAKNFLLRNDIMEDGP------SLHLTASTISGL 237
           ++RG+ +A++ +  G+S+    Y+    K+    + +   G       + H+ +S+I  +
Sbjct: 47  IYRGLGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEI 106

Query: 238 GVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITA-LYKGFEAQVFRIGPHTI 296
              +V  P +V+  R      +     +  +++    EG+   LY+G+   + R  P T 
Sbjct: 107 CACLVRVPAEVVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFT- 165

Query: 297 LCLTF 301
            C+ F
Sbjct: 166 -CIQF 169

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 38/89 (42%), Gaps = 8/89 (8%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
            G +A  IA   T P++ +K R+ L     +    I          ++R EG      G+
Sbjct: 196 CGSIAGGIAAATTTPLDFLKTRLMLNKTTASLGSVIIR--------IYREEGPAVFFSGV 247

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTF 112
               ++  A     LG YE + ++++K+F
Sbjct: 248 GPRTMWISAGGAIFLGMYETVHSLLSKSF 276

>Kwal_33.15597
          Length = 305

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 76/320 (23%), Positives = 125/320 (39%), Gaps = 50/320 (15%)

Query: 16  VSKFGSFTAGGLAAC-IAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNE 74
           +S +  F   G   C    +   PI+VVK R+QL  E    N+ + ++  Q    +  +E
Sbjct: 10  ISDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQL--EPTVYNKGMISSFKQ----IISSE 63

Query: 75  GIRGLQKGLVAAYIYQIALNGS-RLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAA 133
           G   L  G     +   +L GS + G YE  + +   T   DQ  +   S+ I   + A 
Sbjct: 64  GAGALLTGF-GPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIG--SAAI 120

Query: 134 SGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAA 193
           +     +   PL   + RL        + + T   G+  G   I   EG+   + G    
Sbjct: 121 AEFFADIALCPLEATRIRL--------VSQPTFANGLVGGFSRILKEEGLSSFYNGFTPI 172

Query: 194 ILRTGAGSSVQLPIYNTAKNFLLRNDIME-----DGPS----------LHLTASTISGLG 238
           + +       Q+P YN AK FL+     E      GP           L+L +   +GL 
Sbjct: 173 LFK-------QIP-YNIAK-FLVFERAAEVYFGMAGPKETLSTSTTTGLNLLSGLTAGLA 223

Query: 239 VAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILC 298
            A+V  P D +L+++   K    +  I  L +  K  G    + G   ++  +G  T+  
Sbjct: 224 AAIVSQPADTLLSKVNKAKKAPGQSTIGLLGQLAKELGFVGSFAGLPTRLVMVG--TLTS 281

Query: 299 LTF-----LEQTMKLVHAFE 313
           L F     L++T+    A E
Sbjct: 282 LQFGIYGSLKKTLGCAPAIE 301

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 79/321 (24%), Positives = 124/321 (38%), Gaps = 50/321 (15%)

Query: 15  KVSKFGSFTAGGLAAC-IAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN 73
            +S +  F   G   C    +   PI+VVK R+QL  E    N+ + ++  Q    +  +
Sbjct: 9   SLSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQL--EPTVYNKGMISSFKQ----IISS 62

Query: 74  EGIRGLQKGLVAAYIYQIALNGS-RLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGA 132
           EG   L  G     +   +L GS + G YE  + +       DQ  +   S+ I   + A
Sbjct: 63  EGAGALLTGF-GPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIG--SAA 119

Query: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDA 192
            +     +   PL   + RL S        + T   G+  G   I   EG    + G   
Sbjct: 120 IAEFFADIALCPLEATRIRLVS--------QPTFANGLVGGFSRILKEEGAGSFYNGFTP 171

Query: 193 AILRTGAGSSVQLPIYNTAKNFLLRNDIME-----DGPSLHL-TASTI---------SGL 237
            + +       Q+P YN AK FL+     E      GP   L TAST          +GL
Sbjct: 172 ILFK-------QIP-YNIAK-FLVFERAAEVYFGMAGPKESLSTASTTGINLLSGLTAGL 222

Query: 238 GVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTIL 297
             A+V  P D +L+++   K    +  I  L +  K  G    + G   ++  +G  T+ 
Sbjct: 223 AAAIVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFAGLPTRLVMVG--TLT 280

Query: 298 CLTF-----LEQTMKLVHAFE 313
            L F     L++T+    A E
Sbjct: 281 SLQFGIYGSLKKTLGCAPAIE 301

>Kwal_55.21106
          Length = 328

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 63/306 (20%), Positives = 123/306 (40%), Gaps = 64/306 (20%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGEL-----------MAANQRI----YTNPFQAMG 68
            G +A+ +A  V  P+++VK  +Q Q +             A   R+    Y +   A+ 
Sbjct: 9   TGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALI 68

Query: 69  VVFRNEGIRGLQKGLVA----------AYIYQIALNGSRLGFYEPIRAVMNKTFYPDQES 118
            +F+ +G+ GL +GL            +Y +  ++       Y+ +R  + K   P++  
Sbjct: 69  KIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEE-- 126

Query: 119 HKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIG----------EQTHYT 168
                    +  G  +  +  +  SP+ ++ TR Q+ ++  K G          EQ + T
Sbjct: 127 ---------LLLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNIT 177

Query: 169 GVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRN-DIMED---- 223
           G W G K          L   ++ +I  T A       I+ T+K  +  N  ++E     
Sbjct: 178 GFWRGFKV--------SLILTVNPSI--TFASYEKLQDIFITSKRAVDENGQLLETSGQL 227

Query: 224 GPSLHLTASTISGLGVAVVMNPWDVILTRIYNQK-GDLYKGPIDCLVKTVKIEGITALYK 282
            P  +      S +   ++  P  +I+++ Y Q+ G  ++     L+   K EG+ +L+K
Sbjct: 228 SPRQNFLLGVFSKVISTLITQP--LIVSKAYLQRTGSNFQSFQQVLLYLYKQEGLISLWK 285

Query: 283 GFEAQV 288
           G   Q+
Sbjct: 286 GLAPQL 291

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 66/150 (44%), Gaps = 9/150 (6%)

Query: 3   KGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTN 62
           +G   + KS+   + K G   AGG+A   A T+  P++ +KI  Q      A        
Sbjct: 6   RGSGPVDKSSVDYIVKSG--LAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGG 63

Query: 63  PFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQ 122
             +A   +  ++G RG  +G  A  +        +   YE IR+V+  T+    ESH  +
Sbjct: 64  LVRASKYIMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTW--RHESHWRR 121

Query: 123 SVGINVFAGAASGIIGAVMGSPLFLVKTRL 152
                + +G+ +G+    +  PL LV+ RL
Sbjct: 122 -----LLSGSLAGLCSVFVTYPLDLVRVRL 146

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/222 (21%), Positives = 84/222 (37%), Gaps = 28/222 (12%)

Query: 17  SKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQR-----IYTN-PFQAMGVV 70
           S +    +G LA   +V VT P+++V++R+    E   A  R     IY   P +A+   
Sbjct: 117 SHWRRLLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKW 176

Query: 71  FRNEGI---RGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVG-- 125
           +  +         +G     I  I   G     ++  + +     +P  E + V S G  
Sbjct: 177 YIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFR---HPMLEPYSVLSPGGS 233

Query: 126 ------------INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNG 173
                         + AG  +G+       P  +++ RLQ   +AI    + H+ G+   
Sbjct: 234 SAYDRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQV--SAITDPTRRHFVGINEI 291

Query: 174 LKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
            K IY   G +G F G+    ++     +    IY   K +L
Sbjct: 292 AKIIYTEGGWRGFFVGLSIGYIKVTPMVACSFFIYERTKWYL 333

 Score = 31.6 bits (70), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 62/138 (44%), Gaps = 13/138 (9%)

Query: 123 SVGINVFAGAASGIIGAV---MGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGL----K 175
           SV   V +G A GI G+    + +PL  +K   Q+ SN     +   + G   GL    K
Sbjct: 15  SVDYIVKSGLAGGIAGSCAKTLVAPLDRIKILFQT-SNP----QFAQFAGSMGGLVRASK 69

Query: 176 TIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTIS 235
            I   +G +G F+G  A +LR    ++++   Y   ++ ++     E      L + +++
Sbjct: 70  YIMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESH-WRRLLSGSLA 128

Query: 236 GLGVAVVMNPWDVILTRI 253
           GL    V  P D++  R+
Sbjct: 129 GLCSVFVTYPLDLVRVRL 146

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 85/209 (40%), Gaps = 22/209 (10%)

Query: 15  KVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF--QAMGVVFR 72
           ++S+  ++ AGGL   +A     PI+ +K R+Q        + R    P   +    ++R
Sbjct: 292 ELSRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQ----CAPLDTRCRGLPLLIKTAKDMYR 347

Query: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQ--------ESHKVQSV 124
             G+R   +GL    +         LG +  +     K +Y  +        E+  V S 
Sbjct: 348 EGGLRLFYRGLGVGILGVFPYAALDLGTFSAL-----KRWYITRRANALGISENEVVMSN 402

Query: 125 GINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK 184
            + +  GA SG +GA +  P+ L++TRLQ+            Y G  +  +     EG+ 
Sbjct: 403 LVVLPMGAFSGTVGATVVYPINLLRTRLQAQGT---YAHPHRYDGFQDVFRKTVQREGLP 459

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKN 213
           GL++G+   + +     ++    Y   K 
Sbjct: 460 GLYKGLVPTLAKVCPAVAISYLCYENLKR 488

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 70/313 (22%), Positives = 124/313 (39%), Gaps = 43/313 (13%)

Query: 31  IAVTVTNPIEVVKI----RMQLQGELM-AANQRIYTNP-----------FQAMGVVFRNE 74
           ++ T T P + +K+    R  L   L+    Q ++ NP            +A   ++R  
Sbjct: 188 VSRTCTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQG 247

Query: 75  GIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAAS 134
           G+R    G     I     +  + G +E  + V+        E+ ++  +   V AG   
Sbjct: 248 GLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVL-AGLEGCGETGELSRLSTYV-AGGLG 305

Query: 135 GIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKT---IYMTEGVKGLFRGID 191
           GI+      P+  +K R+Q           T   G+   +KT   +Y   G++  +RG+ 
Sbjct: 306 GIMAQFSVYPIDTLKFRIQCAPL------DTRCRGLPLLIKTAKDMYREGGLRLFYRGLG 359

Query: 192 AAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLH---------LTASTISGLGVAVV 242
             IL     +++ L  ++  K + +       G S +         L     SG   A V
Sbjct: 360 VGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATV 419

Query: 243 MNPWDVILTRIYNQ----KGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPH---T 295
           + P +++ TR+  Q        Y G  D   KTV+ EG+  LYKG    + ++ P    +
Sbjct: 420 VYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAVAIS 479

Query: 296 ILCLTFLEQTMKL 308
            LC   L++ M+L
Sbjct: 480 YLCYENLKRAMRL 492

>Scas_714.18
          Length = 305

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 64/307 (20%), Positives = 120/307 (39%), Gaps = 40/307 (13%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGI-RGLQKG 82
           AG +A  I   +  P + VK+R+Q Q   M      + + +  +   + NEGI  G  +G
Sbjct: 18  AGSIAGAIGKFIEYPFDTVKVRLQTQEAYM------FPSTWSCIKYTYENEGILEGFYQG 71

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMG 142
           + +  I     N      Y    + +N          +  +  I + +   +G   + + 
Sbjct: 72  IESPLIGAALENAILFLAYNQCSSFLNAF-------TEFSAFLIILISAGFAGSCASFVL 124

Query: 143 SPLFLVKTRLQ----SYS---------------NAIKIGEQTHYTGVWNGLKTIYMTEGV 183
           +P+ L+K +LQ     YS                 + IGE  H T +   +K+I   +G+
Sbjct: 125 TPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRH-TRIIPTIKSIIKEKGL 183

Query: 184 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTAS-TISGLGVAVV 242
            GL++G  +  +R   GS V    Y   K   LR+   E   +  L  S   +GL     
Sbjct: 184 FGLWQGQSSTFIRESIGSVVWFATYELMKQ-TLRDPKSEVNTTWQLLISGATAGLAFNGS 242

Query: 243 MNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFL 302
           + P D + + +  +   L    ++ +   ++ +G+   Y+G    + R  P         
Sbjct: 243 VFPADTVKSIMQTEHLAL----METVRSILERDGVAGFYRGLGITLLRAVPSNAAVFYTY 298

Query: 303 EQTMKLV 309
           E+  K++
Sbjct: 299 EKLSKIL 305

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 61/129 (47%), Gaps = 11/129 (8%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGV-KG 185
            + AG+ +G IG  +  P   VK RLQ+        E   +   W+ +K  Y  EG+ +G
Sbjct: 15  EILAGSIAGAIGKFIEYPFDTVKVRLQT-------QEAYMFPSTWSCIKYTYENEGILEG 67

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSL-HLTASTISGLGVAVVMN 244
            ++GI++ ++     +++    YN   +FL  N   E    L  L ++  +G   + V+ 
Sbjct: 68  FYQGIESPLIGAALENAILFLAYNQCSSFL--NAFTEFSAFLIILISAGFAGSCASFVLT 125

Query: 245 PWDVILTRI 253
           P ++I  ++
Sbjct: 126 PVELIKCKL 134

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 18/86 (20%), Positives = 36/86 (41%), Gaps = 1/86 (1%)

Query: 228 HLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGI-TALYKGFEA 286
            + A +I+G     +  P+D +  R+  Q+  ++     C+  T + EGI    Y+G E+
Sbjct: 15  EILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTWSCIKYTYENEGILEGFYQGIES 74

Query: 287 QVFRIGPHTILCLTFLEQTMKLVHAF 312
            +        +      Q    ++AF
Sbjct: 75  PLIGAALENAILFLAYNQCSSFLNAF 100

>Kwal_27.11419
          Length = 298

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 78/192 (40%), Gaps = 35/192 (18%)

Query: 131 GAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGI 190
           G   G+  AV+  P  L+KTRLQ   ++             N L  +   E    L++G 
Sbjct: 14  GFVGGLTSAVILQPFDLLKTRLQQNKSS-------------NLLDVVRSIETPGQLWKGT 60

Query: 191 DAAILRTGAGSSVQLPIYNTAKNFLLRNDIM----EDG-----PSLHLTASTISGL---- 237
             + LRT  GS++ L   N  ++ +    +     ++G     P L +  + ISG     
Sbjct: 61  LPSALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRA 120

Query: 238 GVAVVMNPWDVILTR----IYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293
            V V   P  V+  R    +YN     YK   +      + EGI  L+ G  A V R  P
Sbjct: 121 AVGVATMPITVLKVRFESTMYN-----YKSLGEAATHIYRSEGIRGLFSGCGATVMRDAP 175

Query: 294 HTILCLTFLEQT 305
           +  L + F EQ+
Sbjct: 176 YAGLYVLFYEQS 187

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 74/179 (41%), Gaps = 26/179 (14%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQS-YSNAIKIGEQ-THYTGVWNGLKTIYMTEGVK 184
           N+ +GA +     V   P+ ++K R +S   N   +GE  TH          IY +EG++
Sbjct: 111 NLISGAITRAAVGVATMPITVLKVRFESTMYNYKSLGEAATH----------IYRSEGIR 160

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLR------NDIMEDGPSLHLTASTISGLG 238
           GLF G  A ++R    + + +  Y  +K  L R       +  E G     T++ I+ + 
Sbjct: 161 GLFSGCGATVMRDAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIA 220

Query: 239 -------VAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
                     + +P+D I TR+       Y G I      ++ E    L+ G   ++ R
Sbjct: 221 AFSSASLATTITSPFDTIKTRMQLNPSQYY-GFIQTFKSIIRYERPRNLFDGLSLRLSR 278

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 32/77 (41%), Gaps = 7/77 (9%)

Query: 28  AACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAY 87
           +A +A T+T+P + +K RMQL       N   Y    Q    + R E  R L  GL    
Sbjct: 224 SASLATTITSPFDTIKTRMQL-------NPSQYYGFIQTFKSIIRYERPRNLFDGLSLRL 276

Query: 88  IYQIALNGSRLGFYEPI 104
             +    G   G YE +
Sbjct: 277 SRKALSAGIAWGIYEEL 293

 Score = 28.1 bits (61), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 14/58 (24%)

Query: 228 HLTASTISGLGVAVVMNPWDVILTRIYNQK--------------GDLYKGPIDCLVKT 271
           H     + GL  AV++ P+D++ TR+   K              G L+KG +   ++T
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNLLDVVRSIETPGQLWKGTLPSALRT 67

>Kwal_55.21338
          Length = 323

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/284 (21%), Positives = 115/284 (40%), Gaps = 39/284 (13%)

Query: 30  CIAVTVTNPIEVVKIRMQLQ---GELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAA 86
            I++T+T P+ VV  ++Q Q   GE ++    I          ++R +G  G   GL +A
Sbjct: 34  AISMTLTYPLIVVTTKLQTQDAKGEKLSLADTIKD--------IYRKDGAMGFFAGLESA 85

Query: 87  YIYQIALNGSRLGFYE-PIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPL 145
                  N      YE   R V+       + + ++ +   ++  G+ +G + A   +PL
Sbjct: 86  LFGTTLSNFVYYYCYEASSRCVLRA-----RHTQRLTTAE-SMLVGSIAGSLNATAANPL 139

Query: 146 FLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQL 205
           ++  TR+           Q    G  + +  I   EG+ GLF+G++ A++       +Q 
Sbjct: 140 WVANTRMTV---------QKSDRGTLSTIFDIVKDEGISGLFKGLNPALILV-INPIIQY 189

Query: 206 PIYNTAKNFLLRNDIMED-GPSLHLTASTISGLGVAVVMNPWDVILTRIY---NQKGDLY 261
            +Y   KN++L +       PS       +  L       P+  +  R++     K    
Sbjct: 190 TVYEQLKNWILSSRQTRTLSPSWAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTA 249

Query: 262 KGP---IDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFL 302
             P   +  + + +K +GI  LY+G   ++      +IL   FL
Sbjct: 250 APPRSLLSLMAEIIKKDGILGLYRGIGIKLV----QSILTAAFL 289

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 81/185 (43%), Gaps = 31/185 (16%)

Query: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185
           +++ +GAA+G    +   P+  +KTRLQ+                       +   G KG
Sbjct: 8   VSLASGAAAGTSTDLAFFPIDTLKTRLQAKGG-------------------FFANGGYKG 48

Query: 186 LFRGIDAAILRTGAGSSVQLPIYNTAK--------NFLLRNDIMEDGPSLHLTASTISGL 237
           ++RG+ +A++ +   +S+    Y++ K         ++  N+ M D  S H+ +S+I  +
Sbjct: 49  VYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLS-HMFSSSIGEV 107

Query: 238 GVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGI-TALYKGFEAQVFRIGPHTI 296
              +V  P +VI  R    K +        +++    EG+   LY+G+   + R  P T 
Sbjct: 108 SACLVRVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFT- 166

Query: 297 LCLTF 301
            C+ F
Sbjct: 167 -CIQF 170

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 83/207 (40%), Gaps = 30/207 (14%)

Query: 13  AQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR 72
           A  +S   S + G ++AC+   V  P EV+K R Q              + +Q    + +
Sbjct: 93  ADTLSHMFSSSIGEVSACL---VRVPAEVIKQRTQTHKT---------NSSWQTFTKILQ 140

Query: 73  NEG----IRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINV 128
           NE     +R L +G     + +I     +   YE ++    K    D  +    SV    
Sbjct: 141 NENGEGVLRNLYRGWNTTIMREIPFTCIQFPLYEFLKKTWAKRNGQDHVAPWQGSV---- 196

Query: 129 FAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFR 188
             G+ +G I A   +PL ++KTRL     +I + +           K IY  EG K  F 
Sbjct: 197 -CGSVAGAIAAATTTPLDVLKTRLMLSHKSIPVAQLA---------KNIYAEEGFKVFFS 246

Query: 189 GIDAAILRTGAGSSVQLPIYNTAKNFL 215
           G+    +   AG ++ L +Y T  + L
Sbjct: 247 GVGPRTMWISAGGAIFLGVYETVHSIL 273

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 99/249 (39%), Gaps = 45/249 (18%)

Query: 64  FQAMGVVFRNEGIRGLQKGLVAAYI--------YQIALNGSRLGFYEPI--RAVMNKTFY 113
            QA G  F N G +G+ +GL +A I        + ++ +  ++ + +P+  + V +    
Sbjct: 34  LQAKGGFFANGGYKGVYRGLGSAVIASAPSASLFFVSYDSMKV-YSKPVISKYVTSNNQM 92

Query: 114 PDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYT-GVWN 172
            D  SH        +F+ +   +   ++  P  ++K R            QTH T   W 
Sbjct: 93  ADTLSH--------MFSSSIGEVSACLVRVPAEVIKQR-----------TQTHKTNSSWQ 133

Query: 173 GLKTIYMTEGVKG----LFRGIDAAILRTGAGSSVQLPIYN-TAKNFLLRNDIMEDGPSL 227
               I   E  +G    L+RG +  I+R    + +Q P+Y    K +  RN      P  
Sbjct: 134 TFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQFPLYEFLKKTWAKRNGQDHVAPWQ 193

Query: 228 HLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQ 287
                +++G   A    P DV+ TR+      +   P+  L K +  E      +GF+  
Sbjct: 194 GSVCGSVAGAIAAATTTPLDVLKTRLMLSHKSI---PVAQLAKNIYAE------EGFKVF 244

Query: 288 VFRIGPHTI 296
              +GP T+
Sbjct: 245 FSGVGPRTM 253

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 116/297 (39%), Gaps = 22/297 (7%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQ--GELMAANQRIYTNPFQAMGVVFRNEGIRG 78
           S  AG +    AV   +P +++K+R Q       + A ++I        G+   N  +RG
Sbjct: 50  SLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSAVNM-MRG 108

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIG 138
             KG++   +    +       Y+    V  K    +  S K+ +  +   AG  S I  
Sbjct: 109 FYKGVIPPLLGVTPIFAVSFWGYD----VGKKLVTWNDNSGKLTTAQLAT-AGFISAIPT 163

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
            ++ +P   VK  LQ+ SN        H  G  +  K I  T GV+ LFRG  A + R G
Sbjct: 164 TLVMAPTERVKVVLQTQSN--------HSLG--SAAKHILATGGVRSLFRGSLATLARDG 213

Query: 199 AGSSVQLPIYNTAKNFL-LRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQK 257
            GS++    Y   K +L  R+   E        A  ++G+ + V + P D I T +  Q 
Sbjct: 214 PGSALYFASYEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTEL--QS 271

Query: 258 GDLYKGPIDCLVKTVKIE-GITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFE 313
            +  +  ++   K      GI   + G    + R  P        +E T  L   + 
Sbjct: 272 SNTRQTMMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVELTHSLFKKYN 328

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 79/209 (37%), Gaps = 24/209 (11%)

Query: 9   QKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMG 68
           + S   ++S + +   G  A      +T PI ++K+R +       +    Y +  +A  
Sbjct: 98  KSSNLPQLSMYENLVTGAFARGTVGYITMPITIIKVRYE-------STLYNYKSIAEAAK 150

Query: 69  VVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYP------DQESHKV- 121
            +   EGIRG  +G     +     +G  +  YE ++  +  T  P      D E     
Sbjct: 151 SIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHTL-PTILPKSLLQLDSEGRYTA 209

Query: 122 -QSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMT 180
             S  IN  +   S  +   + +P   +KTR+Q         E T +   W+ L TI   
Sbjct: 210 YTSTAINSTSAILSASMATTVTAPFDTIKTRMQL--------EPTKFKTFWSTLTTIVTQ 261

Query: 181 EGVKGLFRGIDAAILRTGAGSSVQLPIYN 209
           E    +F G+   + R    + +   IY 
Sbjct: 262 EHPIKIFSGLSMRLTRKALSAGIAWGIYE 290

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 107/246 (43%), Gaps = 33/246 (13%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQ-LQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKG 82
           AGGL++ +A+    P++++K R Q  +G  +    +    P+Q    ++R      ++  
Sbjct: 13  AGGLSSAVAL---QPLDLLKTRFQQTKGGTLWQTVKSLDTPWQ----LWRGTLPSAIRTS 65

Query: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQ-SVGINVFAGA-ASGIIGAV 140
            V + +Y  +LN  R    +  +     +    + S+  Q S+  N+  GA A G +G +
Sbjct: 66  -VGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGYI 124

Query: 141 MGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAG 200
              P+ ++K R +S           +Y  +    K+I   EG++G FRG     LR    
Sbjct: 125 T-MPITIIKVRYES--------TLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPY 175

Query: 201 SSVQLPIYNTAKNFL---LRNDIME----------DGPSLHLTASTISGLGVAVVMNPWD 247
           S + + +Y   K+ L   L   +++             +++ T++ +S      V  P+D
Sbjct: 176 SGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFD 235

Query: 248 VILTRI 253
            I TR+
Sbjct: 236 TIKTRM 241

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 80/207 (38%), Gaps = 40/207 (19%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           ++  G A G+  AV   PL L+KTR Q          QT    +W  +K++   +    L
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQ----------QTKGGTLWQTVKSL---DTPWQL 53

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDG-----------PSLHLTASTIS 235
           +RG   + +RT  GS++ L   N  +  L +    +             P L +  + ++
Sbjct: 54  WRGTLPSAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVT 113

Query: 236 GL----GVAVVMNPWDVILTR----IYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQ 287
           G      V  +  P  +I  R    +YN     YK   +        EGI   ++GF   
Sbjct: 114 GAFARGTVGYITMPITIIKVRYESTLYN-----YKSIAEAAKSIAAQEGIRGFFRGFGPT 168

Query: 288 VFRIGPHTILCLTFLEQTMKLVHAFES 314
             R  P++ L +   E   KL H   +
Sbjct: 169 CLRDAPYSGLYVLLYE---KLKHTLPT 192

>Scas_696.9
          Length = 312

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/270 (21%), Positives = 108/270 (40%), Gaps = 47/270 (17%)

Query: 38  PIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSR 97
           P+EVVK         MAAN+ +  N   +M  V+   GI G  +GL+     + +  G+ 
Sbjct: 38  PLEVVKT-------TMAANRNL--NFVNSMKYVWSRGGIVGFYQGLIPWAWIEASTKGAV 88

Query: 98  LGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVK-------- 149
           L             F   +  ++ + +G+  F     G +   +      +         
Sbjct: 89  L------------LFVSAESEYRFKLLGMGNFTSGILGGVLGGVTQSYLTMGFCTCMKTV 136

Query: 150 --TRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPI 207
             TRL+S S    +         WN  ++IY  EG++G+++G++A  +R       +   
Sbjct: 137 EITRLKSASAGAPVQSS------WNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGF 190

Query: 208 YNTAKNFLLRNDIMEDGPSLHLTA-----STISGLGVAVVMNPWDVILTRIYNQKGDLYK 262
               +++ +R    +  P   L A     +T  G G++    P +VI   + ++K D  +
Sbjct: 191 SRLVEDW-VRKATGKTKPEDRLNAWEKIGATAVGGGLSAWNQPIEVIRVEMQSKKEDPNR 249

Query: 263 GPIDCLVKT----VKIEGITALYKGFEAQV 288
                + KT    +K  G+  LY+G   ++
Sbjct: 250 PKNLTVAKTFKYIMKTNGVKGLYRGVTPRI 279

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 62/141 (43%), Gaps = 26/141 (18%)

Query: 64  FQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFY----EPIRAVMNKTFYPDQESH 119
            Q    +F  EG+RG+ KG+ A  I Q+   GSR G      + IR V +K    D++  
Sbjct: 154 LQVFKQIFAAEGLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKR--SDEKLS 211

Query: 120 KVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNA------IKIGEQTHYTGVWNG 173
            ++ +  +   G  S         P+ +++  +QS +N       + +G+   Y      
Sbjct: 212 AMEKIVASALGGGLS-----AWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRY------ 260

Query: 174 LKTIYMTEGVKGLFRGIDAAI 194
              IY   G++GL+RG+   I
Sbjct: 261 ---IYENNGLRGLYRGVTPRI 278

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 61/305 (20%), Positives = 117/305 (38%), Gaps = 48/305 (15%)

Query: 4   GEDKIQKSAAQKVSKFGSFTAGG-LAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTN 62
           G +   K   +K   F +   G  L  C   T+  P+EV K         MAAN++   +
Sbjct: 2   GAEHGPKDLQKKPVSFSNIALGAALNMCEVTTLGQPLEVTKT-------TMAANRQFGFS 54

Query: 63  PFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQ 122
             QA+  V+   G+ G  +GL+     + +  G+ L             F   +  ++ +
Sbjct: 55  --QAVRHVWSRGGVFGFYQGLIPWAWIEASTKGAVL------------LFVSAEAEYQFR 100

Query: 123 SVGINVF-AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGV----------W 171
            +G++ F AG   G+ G V  + L +       +   +K  E T                
Sbjct: 101 RLGLSNFGAGILGGVSGGVAQAYLTM------GFCTCMKTVEITRSKAASAPGVPVPSSL 154

Query: 172 NGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSL---- 227
              K I+  EG++G+ +G++A  +R       +  +    ++ + R         L    
Sbjct: 155 QVFKQIFAAEGLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAME 214

Query: 228 HLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKI----EGITALYKG 283
            + AS + G G++    P +VI   + ++  D  +     + KT +      G+  LY+G
Sbjct: 215 KIVASALGG-GLSAWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGLYRG 273

Query: 284 FEAQV 288
              ++
Sbjct: 274 VTPRI 278

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 77/206 (37%), Gaps = 32/206 (15%)

Query: 114 PDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNG 173
           P   SH        +  G   G+  A++  P  L+KTRLQ          Q   T +W  
Sbjct: 5   PKTSSH--------LIGGFVGGLTSAIVLQPFDLLKTRLQ----------QNKDTTLWGT 46

Query: 174 LKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLL--RNDIMEDG----PSL 227
           LK I      K L+RG   + LRT  GS++ L   N  +  +   +   +  G    P L
Sbjct: 47  LKEI---RSPKQLWRGALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQL 103

Query: 228 HLTASTISGLG----VAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKG 283
            +  +  SG      V  +  P  +I  R Y      YK   +        EGI   + G
Sbjct: 104 TMYENLASGAFTRGVVGFITMPITIIKVR-YESTMYSYKSLGEATRHIYSTEGIRGFFNG 162

Query: 284 FEAQVFRIGPHTILCLTFLEQTMKLV 309
             A V R  P+  L +   E+   LV
Sbjct: 163 CGATVMRDAPYAGLYVLLYEKAKLLV 188

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 119/284 (41%), Gaps = 43/284 (15%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQLQGEL-MAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           GGL + I   V  P +++K R+Q   +  +    +   +P Q    ++R      L+  +
Sbjct: 17  GGLTSAI---VLQPFDLLKTRLQQNKDTTLWGTLKEIRSPKQ----LWRGALPSSLRTSI 69

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMN--KTFYPDQESHKVQSVGINVFAGAAS-GIIGAV 140
            +A +Y   LN  R    +     +N   +F P    ++      N+ +GA + G++G +
Sbjct: 70  GSA-LYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYE------NLASGAFTRGVVGFI 122

Query: 141 MGSPLFLVKTRLQSYSNAIK-IGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199
              P+ ++K R +S   + K +GE T +         IY TEG++G F G  A ++R   
Sbjct: 123 T-MPITIIKVRYESTMYSYKSLGEATRH---------IYSTEGIRGFFNGCGATVMRDAP 172

Query: 200 GSSVQLPIYNTAK----NFLLRNDIMEDGPSLHLTAST---------ISGLGVAVVMNPW 246
            + + + +Y  AK      L  + I  D   +  T ++         +S      + +P+
Sbjct: 173 YAGLYVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPF 232

Query: 247 DVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
           D I TR+       + G    LV  V  E    L+ G   ++ R
Sbjct: 233 DTIKTRM-QLDPTKFSGFYKTLVLIVSKEKFKNLFDGLTLRLTR 275

>Scas_613.24
          Length = 177

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 74/182 (40%), Gaps = 26/182 (14%)

Query: 118 SHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTI 177
           S K     +++ +G   G+  AV   PL L+KTR+Q +  A           +W+ +K I
Sbjct: 2   SDKSPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGAT----------LWSAIKDI 51

Query: 178 YMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDG------PSLH--- 228
              +     +RG   + LRT  GS++ L   N  +  L+              P L    
Sbjct: 52  ---KDPIQFWRGTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYE 108

Query: 229 --LTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEA 286
             LT +   GL V  +  P  ++  R Y      YK   + +    K+EGI+  +KGF  
Sbjct: 109 NLLTGAMARGL-VGYITMPITILKVR-YESTYYSYKSMNEAIKDIYKMEGISGFFKGFGP 166

Query: 287 QV 288
            V
Sbjct: 167 TV 168

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 86/195 (44%), Gaps = 33/195 (16%)

Query: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQL-QGELMAANQRIYTNP 63
            DK  K++   VS F     GGL++ + +    P++++K R+Q  +G  + +  +   +P
Sbjct: 2   SDKSPKTSVHLVSGF----IGGLSSAVTL---QPLDLLKTRIQQHKGATLWSAIKDIKDP 54

Query: 64  FQAMGVVFRNEGIRGLQKGLVAA-YIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQ 122
            Q     +R      L+  + +A Y+  + +  ++L   +   A    +  P    ++  
Sbjct: 55  IQ----FWRGTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYE-- 108

Query: 123 SVGINVFAGA-ASGIIGAVMGSPLFLVKTRLQS--YSNAIKIGEQTHYTGVWNGLKTIYM 179
               N+  GA A G++G +   P+ ++K R +S  YS          Y  +   +K IY 
Sbjct: 109 ----NLLTGAMARGLVGYIT-MPITILKVRYESTYYS----------YKSMNEAIKDIYK 153

Query: 180 TEGVKGLFRGIDAAI 194
            EG+ G F+G    +
Sbjct: 154 MEGISGFFKGFGPTV 168

>Scas_705.9
          Length = 323

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 63/304 (20%), Positives = 127/304 (41%), Gaps = 46/304 (15%)

Query: 16  VSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQ------GELMAANQRIY--TNPFQAM 67
           +S   S   G +A+ +A  +  P++V K  +Q +       EL   ++RI    N  + +
Sbjct: 1   MSNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCL 60

Query: 68  GVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN 127
             +FR  G+RGL +G+  +   +   +     +Y  +R    + ++  +     Q+  IN
Sbjct: 61  IRIFRKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLR----RKYFSLKLLRNTQARPIN 116

Query: 128 VFAGAASGIIGA-------VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMT 180
             +     I+G        V+ +P+ ++ T+ Q+  +   +         ++ LK IY+ 
Sbjct: 117 SISTVEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDNV-------DFYSVLKQIYVE 169

Query: 181 EG--VKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRN-DIMEDGPSLHLTASTISGL 237
               +   ++G   +++ T    S+    Y   K+ LL+     E   S  LT +    L
Sbjct: 170 SNGKLSSYWKGFKVSLILT-VNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFIL 228

Query: 238 GV------AVVMNPWDVILTRIYNQKGD-LYKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
           G        ++  P  +I+ ++  Q+ +  +K   + L    K EG+ AL+KG       
Sbjct: 229 GALAKIISTIITQP--LIVAKVSLQRSNSKFKHFEEVLRYLYKEEGVLALWKG------- 279

Query: 291 IGPH 294
           +GP 
Sbjct: 280 VGPQ 283

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 40/75 (53%), Gaps = 7/75 (9%)

Query: 9   QKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMG 68
           +KS + +++   +F  G LA  I+  +T P+ V K+ +Q       +N + + +  + + 
Sbjct: 213 EKSYSGQLTVNQNFILGALAKIISTIITQPLIVAKVSLQ------RSNSK-FKHFEEVLR 265

Query: 69  VVFRNEGIRGLQKGL 83
            +++ EG+  L KG+
Sbjct: 266 YLYKEEGVLALWKGV 280

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 117/289 (40%), Gaps = 54/289 (18%)

Query: 19  FGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRG 78
             S  +G  A      V  PI+ +K R+Q                  A G  F N G RG
Sbjct: 6   LASLVSGAAAGTSTDVVFFPIDTLKTRLQ------------------AKGGFFHNGGYRG 47

Query: 79  LQKGLVAAYIYQIALNGSRLGF--YEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGI 136
           + +GL +A +   +  G+ L F  Y+ ++  +         S ++  V  ++ + +   +
Sbjct: 48  IYRGLGSAVV--ASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEM 105

Query: 137 IGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMT------EG-VKGLFRG 189
              ++  P  ++K R            QTH+T   + L+T+ +       EG V+GL+RG
Sbjct: 106 SACLVRVPAEVIKQR-----------TQTHHTN--SSLQTLRLILRDPTGEGVVRGLYRG 152

Query: 190 IDAAILRTGAGSSVQLPIYN-TAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDV 248
               I+R    + +Q P+Y    K +    +I            +++G   A    P DV
Sbjct: 153 WWTTIMREIPFTCIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDV 212

Query: 249 ILTRIYNQKGDLYKGPIDCLVKTV-KIEGITALYKGFEAQVFRIGPHTI 296
           + TR+   +  +   P+  L +T+ + EG    ++G       IGP T+
Sbjct: 213 LKTRMMLHERRV---PMLHLARTLFREEGARVFFRG-------IGPRTM 251

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 91/217 (41%), Gaps = 32/217 (14%)

Query: 4   GEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNP 63
           G     +  A+ ++   S + G ++AC+   V  P EV+K R Q            +TN 
Sbjct: 82  GRWTASEQLAEVLTHMLSSSLGEMSACL---VRVPAEVIKQRTQTH----------HTNS 128

Query: 64  -FQAMGVVFRN---EGI-RGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQES 118
             Q + ++ R+   EG+ RGL +G     + +I     +   YE     + K +    E 
Sbjct: 129 SLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLYE----YLKKKWAAYAEI 184

Query: 119 HKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIY 178
            +V S       G+ +G I A   +PL ++KTR+  +   + +    H        +T++
Sbjct: 185 ERV-SAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVPM---LHLA------RTLF 234

Query: 179 MTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
             EG +  FRGI    +   AG ++ L +Y    +  
Sbjct: 235 REEGARVFFRGIGPRTMWISAGGAIFLGVYEAVHSLF 271

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 79/182 (43%), Gaps = 28/182 (15%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           ++ +GAA+G    V+  P+  +KTRLQ+       G                   G +G+
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQAKGGFFHNG-------------------GYRGI 48

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFLL----RNDIMEDGPSL--HLTASTISGLGVA 240
           +RG+ +A++ +  G+S+    Y++ K  L     R    E    +  H+ +S++  +   
Sbjct: 49  YRGLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSAC 108

Query: 241 VVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGIT-ALYKGFEAQVFRIGPHTILCL 299
           +V  P +VI  R      +     +  +++    EG+   LY+G+   + R  P T  C+
Sbjct: 109 LVRVPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFT--CI 166

Query: 300 TF 301
            F
Sbjct: 167 QF 168

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 86/215 (40%), Gaps = 26/215 (12%)

Query: 1   MAKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIY 60
           + KGED+   + +  VS   SF  G ++AC+   V  P EV+K R Q             
Sbjct: 86  LPKGEDQTADTLSHMVSS--SF--GEISACM---VRVPAEVIKQRTQTHRT--------- 129

Query: 61  TNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHK 120
            +  Q +  + RNE   GL++ L   +   I           P+   M K +   Q   +
Sbjct: 130 NSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQFPLYEYMKKRWAEVQGKER 189

Query: 121 VQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMT 180
                 +V    A GI  A   +PL ++KTR+  +  ++      H        KT+   
Sbjct: 190 AAPWQGSVCGCIAGGIAAAAT-TPLDVLKTRIMLHHKSV---SALHLA------KTMLQE 239

Query: 181 EGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
           EGVK  F G+    +   AG ++ L +Y T  +  
Sbjct: 240 EGVKVFFSGVGPRTMWISAGGAIFLGVYETVHSLF 274

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 83/191 (43%), Gaps = 31/191 (16%)

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           ++ +GAA+G    +   P+  +KTRLQ+                       +   G KG+
Sbjct: 9   SLVSGAAAGTSTDLAFFPIDTLKTRLQAKGG-------------------FFANGGYKGV 49

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNF-------LLRNDIMEDGPSL-HLTASTISGLG 238
           +RG+ +A++ +   +S+    Y++ K +       LL     +   +L H+ +S+   + 
Sbjct: 50  YRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEIS 109

Query: 239 VAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITA-LYKGFEAQVFRIGPHTIL 297
             +V  P +VI  R    + +     +  L++    EG+   LY+G+   + R  P T  
Sbjct: 110 ACMVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFT-- 167

Query: 298 CLTF-LEQTMK 307
           C+ F L + MK
Sbjct: 168 CIQFPLYEYMK 178

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 114/272 (41%), Gaps = 41/272 (15%)

Query: 32  AVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQI 91
           ++ +T P+  +  ++Q QG     N ++ +   + +  ++R +G+ G   GL +A IY +
Sbjct: 27  SMALTYPLVTITTKLQTQGN--DENNQVKSK-LETIKEIYRKDGLLGFYAGLESA-IYGM 82

Query: 92  AL-NGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKT 150
           AL N     FYE     + K        HK  +   ++  G  +G + A+  +P+++  T
Sbjct: 83  ALTNFVYYYFYELTSRNVLKV-----RKHKKLNTLESMLTGCVAGSVTAIASNPIWVANT 137

Query: 151 RLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNT 210
           R+      +   E+T    +   +K     +  K LF G+  A++       VQ  ++  
Sbjct: 138 RM-----TVTKSEKTALATIIEIVK----KDSAKTLFNGLKPALVLV-MNPIVQYTVFEQ 187

Query: 211 AKNFLL---RNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIY---------NQKG 258
            KN +L   +  I+   PS       +  L       P+  + TR++         +  G
Sbjct: 188 LKNLVLAWNKQGIL--SPSWAFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSG 245

Query: 259 DLYKGP-------IDCLVKTVKIEGITALYKG 283
              KG        +  + + VK +G++ LY+G
Sbjct: 246 KKAKGHKASSKSMLSLITEIVKKDGVSGLYRG 277

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 74/174 (42%), Gaps = 10/174 (5%)

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSV 203
           PL  + T+LQ+  N     E          +K IY  +G+ G + G+++AI      + V
Sbjct: 33  PLVTITTKLQTQGN----DENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFV 88

Query: 204 QLPIYN-TAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYK 262
               Y  T++N L      +      +    ++G   A+  NP  V  TR+   K +  K
Sbjct: 89  YYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSE--K 146

Query: 263 GPIDCLVKTVKIEGITALYKGFE-AQVFRIGPHTILCLTFLEQTMKLVHAFESK 315
             +  +++ VK +    L+ G + A V  + P  I+  T  EQ   LV A+  +
Sbjct: 147 TALATIIEIVKKDSAKTLFNGLKPALVLVMNP--IVQYTVFEQLKNLVLAWNKQ 198

>Scas_717.20
          Length = 356

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 58/129 (44%), Gaps = 10/129 (7%)

Query: 129 FAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKT----IYMTEGVK 184
            AG  SG     + +PL  +K   Q+ SN       T Y G   GLK     I++ +G++
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKILFQT-SNP----HYTKYAGSLVGLKEAAKHIWLNDGIR 91

Query: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMN 244
           G F+G    ++R    ++V+   Y   +N L+ +   E      L + +++GL       
Sbjct: 92  GFFQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWR-RLMSGSLAGLCSVFTTY 150

Query: 245 PWDVILTRI 253
           P D+I  R+
Sbjct: 151 PLDLIRVRL 159

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 64/150 (42%), Gaps = 9/150 (6%)

Query: 3   KGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTN 62
           + +  I K++ + +++ G   AGG++   A T+  P++ +KI  Q               
Sbjct: 19  RNQMPIDKNSLEYITRSG--LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVG 76

Query: 63  PFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQ 122
             +A   ++ N+GIRG  +G     +        +   YE IR     T  P +E    +
Sbjct: 77  LKEAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIR----NTLIPSKE---YE 129

Query: 123 SVGINVFAGAASGIIGAVMGSPLFLVKTRL 152
           S    + +G+ +G+       PL L++ RL
Sbjct: 130 SHWRRLMSGSLAGLCSVFTTYPLDLIRVRL 159

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 51/108 (47%), Gaps = 7/108 (6%)

Query: 2   AKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYT 61
           ++ E++  K     +  +    +GGLA   + T   P E+++ R+Q+    ++ +Q +Y 
Sbjct: 247 SEQEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVST--LSVSQ-MYD 303

Query: 62  NPFQAMG----VVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIR 105
           + FQ++     ++++  G RG   GL   YI    +       YE ++
Sbjct: 304 HRFQSISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMK 351

>Scas_673.17
          Length = 314

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 64/307 (20%), Positives = 111/307 (36%), Gaps = 44/307 (14%)

Query: 7   KIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQA 66
           KI   AA    KF    AG +      +   P++VVK R+QL+  +     +     F+ 
Sbjct: 11  KIPDYAASDYFKFA--LAGAIGCGTTHSSLVPVDVVKTRIQLEPTVY---NKGMVGSFKK 65

Query: 67  MGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGI 126
              +  +EG   L  G     +        + G YE  + +   T   +   H   SV +
Sbjct: 66  ---IIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYM 122

Query: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
              + A +  +  +   PL   + RL        + + T   G+  G   I   EGV   
Sbjct: 123 G--SAAVAEFLADIALCPLEATRIRL--------VSQPTFANGLVGGFSRILKEEGVGSF 172

Query: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFLLR----------------NDIMEDGPSLHLT 230
           + G    + +       Q+P YN AK  +                  +D+   G  ++L 
Sbjct: 173 YSGFTPILFK-------QIP-YNIAKFLVFERASEVYYGIVGAKETLSDMTNTG--INLL 222

Query: 231 ASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
           +   +G   A V  P D +L+++   K    +  I  L +  K  G+   + G   ++  
Sbjct: 223 SGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGVIGSFAGLPTRLIM 282

Query: 291 IGPHTIL 297
           +G  T L
Sbjct: 283 VGTLTSL 289

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 66/179 (36%), Gaps = 16/179 (8%)

Query: 38  PIEVVKIRMQLQGELMAANQRIYTNPF-QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGS 96
           P+E  +IR+         +Q  + N        + + EG+     G       QI  N +
Sbjct: 138 PLEATRIRL--------VSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIA 189

Query: 97  RLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYS 156
           +   +E    V        +    + + GIN+ +G  +G   A +  P       L S  
Sbjct: 190 KFLVFERASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQP----ADTLLSKV 245

Query: 157 NAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
           N  K        G+   L  +    GV G F G+   ++  G  +S+Q  IY + KN L
Sbjct: 246 NKTKKAPGQSTIGL---LAQLAKQLGVIGSFAGLPTRLIMVGTLTSLQFAIYGSLKNTL 301

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 35/172 (20%), Positives = 68/172 (39%), Gaps = 14/172 (8%)

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYT-GVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           P+ +VKTR+Q         E T Y  G+    K I   EG   L  G    +L      +
Sbjct: 40  PVDVVKTRIQL--------EPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGA 91

Query: 203 VQLPIYNTAKNFLLRNDIMEDG----PSLHLTASTISGLGVAVVMNPWDVILTRIYNQKG 258
            +   Y   K   +     E+      S+++ ++ ++     + + P +    R+ +Q  
Sbjct: 92  FKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQP- 150

Query: 259 DLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVH 310
               G +    + +K EG+ + Y GF   +F+  P+ I      E+  ++ +
Sbjct: 151 TFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASEVYY 202

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 119/299 (39%), Gaps = 43/299 (14%)

Query: 16  VSKFGSFTAGGLAAC-IAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNE 74
           VS +  F   G   C I  +   PI+VVK R+QL  E    N+ + ++  Q    +  +E
Sbjct: 10  VSDYAKFALAGAIGCGITHSSMVPIDVVKTRIQL--EPTVYNKGMVSSFKQ----IISSE 63

Query: 75  GIRGLQKGLVAAYIYQIALNGS-RLGFYEPIRAV-MNKTFYPDQESHKVQSVGINVFAGA 132
           G   L  G     +   +L GS + G YE  + + ++   Y +  ++K     I + + A
Sbjct: 64  GAGALLTGF-GPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNT---IYIGSAA 119

Query: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDA 192
            +     +   PL   + RL        + + T   G++ G   I   EGV   + G   
Sbjct: 120 IAEFFADIALCPLEATRIRL--------VSQPTFANGLFGGFSRILKEEGVGSFYNGFTP 171

Query: 193 AILRTGAGSSVQLPIYNTAKNFLLRNDIME----DGPSLHLTASTISGLGVA-------- 240
            + +       Q+P YN AK F+  +         GP   ++ +T + + +A        
Sbjct: 172 ILFK-------QIP-YNIAKFFVFEHAANAYFGLAGPKETMSETTHTAINLAAGLTAGLA 223

Query: 241 --VVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTIL 297
             VV  P D +L+++   K    +  I  L +  K  G    + G   ++  +G  T L
Sbjct: 224 AAVVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSL 282

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 55/111 (49%), Gaps = 9/111 (8%)

Query: 1   MAKGEDKIQKSAAQK--VSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQR 58
           ++  E+  +K   QK  +  +    AGGL+  ++ T   P+E+++ R+Q+      + ++
Sbjct: 230 LSSQEELERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVS---TLSPRK 286

Query: 59  IYTNPFQAMG----VVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIR 105
           +Y + FQ++     ++++ +G RG   GL   YI    +       YE ++
Sbjct: 287 MYDHKFQSISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMK 337

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 2/125 (1%)

Query: 129 FAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFR 188
            AG  SG     + +PL  +K   Q+ SN           G++   K I++ +G++G F+
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQT-SNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQ 81

Query: 189 GIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDV 248
           G    +LR    ++V+   Y   ++ L+ +   E      L + +++GL    +  P D+
Sbjct: 82  GHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWR-RLASGSLAGLCSVFITYPLDL 140

Query: 249 ILTRI 253
              R+
Sbjct: 141 TRVRL 145

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 70/163 (42%), Gaps = 14/163 (8%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           AGG++   A T+  P++ +KI  Q      +         ++A   ++ N+GIRG  +G 
Sbjct: 24  AGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQGH 83

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143
               +        +   YE IR+++     P +E    +S    + +G+ +G+    +  
Sbjct: 84  SVTLLRIFPYAAVKFVAYEQIRSIL----IPSRE---YESHWRRLASGSLAGLCSVFITY 136

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
           PL L + RL   +   ++  +       + +KTIY     +GL
Sbjct: 137 PLDLTRVRLAYVTEHKRVKLR-------DIVKTIYHEPASEGL 172

 Score = 31.2 bits (69), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 42/233 (18%), Positives = 82/233 (35%), Gaps = 42/233 (18%)

Query: 17  SKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQR-----IYTNPFQAMGVVF 71
           S +    +G LA   +V +T P+++ ++R+    E      R     IY  P        
Sbjct: 116 SHWRRLASGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEP-------- 167

Query: 72  RNEGIRG-------------LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFY----- 113
            +EG+                 +G V   +  I   G     ++ I  +M  +       
Sbjct: 168 ASEGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAV 227

Query: 114 ------PDQESHKVQS-----VGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIG 162
                  + E  K++          + AG  SGI+      PL +++ RLQ  + + +  
Sbjct: 228 KQLSSQEELERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKM 287

Query: 163 EQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
               +  + +  + IY  +G +G F G+    ++     +    +Y   K  L
Sbjct: 288 YDHKFQSISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 340

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 73/186 (39%), Gaps = 21/186 (11%)

Query: 10  KSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMG- 68
           K  A + S         LAA  +   TNPI +V  + Q +  L         N F+A+  
Sbjct: 142 KGEAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEG------DNSFKAIAK 195

Query: 69  VVFRNEGIRGLQKGLVAAYIYQIALNGS-RLGFYEPIRAVMNKTFY--PDQESHKVQ-SV 124
            V+  +GI G  K L  + +  + +N S      E ++ ++    +   D     +Q   
Sbjct: 196 EVYDEDGITGFWKSLKVSLV--LTINPSITYASAEKLKDILYHVEWNAKDLNDSSLQLKP 253

Query: 125 GINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK 184
           G N   G  S II   +  PL + K  LQ  S        + +T     L  +Y  EG  
Sbjct: 254 GQNFLIGVLSKIISTCLTHPLIVAKASLQRSS--------SKFTSFQEVLTYLYRHEGAH 305

Query: 185 GLFRGI 190
            L++G+
Sbjct: 306 ALWKGL 311

 Score = 35.0 bits (79), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 114/274 (41%), Gaps = 46/274 (16%)

Query: 57  QRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQ 116
           ++ Y +    +  V+RNEG  GL  GL A+ +     + S   +Y  IR    +      
Sbjct: 84  EQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKG 143

Query: 117 ESHK---VQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSY-----SNAIK-----IGE 163
           E+ +   ++ + +++ A A S +      +P+ +V T+ Q+       N+ K     + +
Sbjct: 144 EAARFSTIEELLLSMLAAATSQL----FTNPINIVSTKQQTRRGLEGDNSFKAIAKEVYD 199

Query: 164 QTHYTGVWNGLK-----------TIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAK 212
           +   TG W  LK           T    E +K +   ++    +    SS+QL      +
Sbjct: 200 EDGITGFWKSLKVSLVLTINPSITYASAEKLKDILYHVEWNA-KDLNDSSLQL---KPGQ 255

Query: 213 NFLL--RNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKG--DLYKGPIDCL 268
           NFL+   + I+    +  L  +  S    +     +  +LT +Y  +G   L+KG +  L
Sbjct: 256 NFLIGVLSKIISTCLTHPLIVAKASLQRSSSKFTSFQEVLTYLYRHEGAHALWKGLLPQL 315

Query: 269 VKTVKIEGITALYKG----------FEAQVFRIG 292
            K V ++G+  ++KG          F  QV+R G
Sbjct: 316 TKGVIVQGLLFMFKGELAKHIKKLLFLLQVYRKG 349

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 7/64 (10%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           +F  G L+  I+  +T+P+ V K  +Q       + Q + T        ++R+EG   L 
Sbjct: 256 NFLIGVLSKIISTCLTHPLIVAKASLQRSSSKFTSFQEVLT-------YLYRHEGAHALW 308

Query: 81  KGLV 84
           KGL+
Sbjct: 309 KGLL 312

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 69/174 (39%), Gaps = 14/174 (8%)

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYT-GVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           P+ +VKTR+Q         E T Y  G+    K I   EG   L  G    +L      +
Sbjct: 37  PIDVVKTRIQL--------EPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGA 88

Query: 203 VQLPIYNTAKNFLLRNDIMEDGP----SLHLTASTISGLGVAVVMNPWDVILTRIYNQKG 258
            +   Y   K F + N   +       S+++ ++ ++     + + P +    R+ +Q  
Sbjct: 89  FKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQP- 147

Query: 259 DLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAF 312
               G +    + +K EGI + Y GF   +F+  P+ I      E+  +  + F
Sbjct: 148 QFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEFYYGF 201

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 113/301 (37%), Gaps = 47/301 (15%)

Query: 16  VSKFGSFTAGGLAACIAVTVTN-PIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNE 74
           VS +  F   G   C +   +  PI+VVK R+QL  E    N+ +  +  Q    +   E
Sbjct: 14  VSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQL--EPTVYNKGMVGSFKQ----IIAGE 67

Query: 75  GIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN-VFAGAA 133
           G   L  G     +        + G YE     + K F+ D   +   S   N V+ G+A
Sbjct: 68  GAGALLTGFGPTLLGYSIQGAFKFGGYE-----VFKKFFIDNLGYDTASRYKNSVYMGSA 122

Query: 134 S--GIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGID 191
           +    +  +   PL   + RL        + +     G+  G   I   EG+   + G  
Sbjct: 123 AMAEFLADIALCPLEATRIRL--------VSQPQFANGLVGGFSRILKEEGIGSFYSGFT 174

Query: 192 AAILRTGAGSSVQLPIYNTAKNFLLRNDIME-----DGPS----------LHLTASTISG 236
             + +       Q+P YN AK FL+     E      GP           L+L +   +G
Sbjct: 175 PILFK-------QIP-YNIAK-FLVFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAG 225

Query: 237 LGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTI 296
           L  A+V  P D +L+++   K    +  +  L +  K  G    + G   ++  +G  T 
Sbjct: 226 LAAAIVSQPADTLLSKVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTS 285

Query: 297 L 297
           L
Sbjct: 286 L 286

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 75/202 (37%), Gaps = 14/202 (6%)

Query: 27  LAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAA 86
           +A  +A     P+E  +IR+  Q +   AN  +          + + EGI     G    
Sbjct: 124 MAEFLADIALCPLEATRIRLVSQPQF--ANGLV-----GGFSRILKEEGIGSFYSGFTPI 176

Query: 87  YIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLF 146
              QI  N ++   +E           P ++     +  +N+ +G  +G+  A++  P  
Sbjct: 177 LFKQIPYNIAKFLVFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQP-- 234

Query: 147 LVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLP 206
                L S  N  K        G+   L  +    G  G F G+   ++  G  +S+Q  
Sbjct: 235 --ADTLLSKVNKTKKAPGQSTVGL---LAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFG 289

Query: 207 IYNTAKNFLLRNDIMEDGPSLH 228
           IY + K+ L     +E G   H
Sbjct: 290 IYGSLKSTLGCPPTIEIGGGGH 311

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 111/278 (39%), Gaps = 20/278 (7%)

Query: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80
           SF AG  A  I   VT P E  K R+QL  +    ++    NP   +    R +G   L 
Sbjct: 13  SFVAGAAAGAIEGCVTYPFEFAKTRLQLAQQGSGESR----NPLVLLYRTARTQGAGALY 68

Query: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140
            G  A  +      G R   ++ +R  +       Q+     S    + AG  +G++ +V
Sbjct: 69  VGCPAFVVGNTCKAGVRFLGFDALRRAL-------QDERGALSGPRGMLAGLGAGLLESV 121

Query: 141 MG-SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199
           +  +P   VKT L     A +   Q +  G       +    G++GL+ G+    LR  +
Sbjct: 122 LAVTPFEAVKTALIDDRQAARPRYQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQAS 181

Query: 200 GSSVQLPIYNTAKNFLLR------NDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRI 253
             +V+   Y   K  + R      +  +  G +  + A  +SG+       P D + TR+
Sbjct: 182 NQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGA--LSGIVTVYATMPVDTVKTRM 239

Query: 254 YNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRI 291
                  Y   + C    V+ EG+ AL++G   ++ R+
Sbjct: 240 QALDAARYGSTVGCFRAVVREEGVRALWRGATPRLGRL 277

 Score = 34.3 bits (77), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 6/71 (8%)

Query: 12  AAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVF 71
           A Q +    +F  G L+  + V  T P++ VK RMQ    L AA        F+A   V 
Sbjct: 205 ADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQ---ALDAARYGSTVGCFRA---VV 258

Query: 72  RNEGIRGLQKG 82
           R EG+R L +G
Sbjct: 259 REEGVRALWRG 269

>Scas_671.1*
          Length = 123

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 28  AACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAY 87
           +A +A  +T P + +K RMQL+        +++TN F  + ++ +NE I  L  GL    
Sbjct: 49  SASLATAITAPFDTIKTRMQLKP-------KVFTNFFTTLVLITKNESIFQLFSGLSMRL 101

Query: 88  IYQIALNGSRLGFYE 102
             +    G   G YE
Sbjct: 102 TRKALSAGIAWGIYE 116

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 107/301 (35%), Gaps = 49/301 (16%)

Query: 17  SKFGSFTAGGLAACIAVTVTN-PIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR--- 72
           S +  F   G   C +   +  PI+VVK R+QL+         +Y    + M   FR   
Sbjct: 11  SDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQLE-------PTVYN---KGMVGSFRKII 60

Query: 73  -NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAG 131
             EG   L  G     +        + G YE  +     T   D  +    SV I   + 
Sbjct: 61  AEEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIG--SA 118

Query: 132 AASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGID 191
           AA+  +  +   PL   + RL        + + T   G+  G   I   EGV   + G  
Sbjct: 119 AAAEFLADIALCPLEATRIRL--------VSQPTFANGLVGGFSRILKEEGVGSFYSGFT 170

Query: 192 AAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTIS---------------G 236
             + +       Q+P YN AK FL+     E   SL     T+S               G
Sbjct: 171 PILFK-------QIP-YNIAK-FLVFERASELYFSLAPPKDTLSQTSLTAINLLSGLTAG 221

Query: 237 LGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTI 296
           L  A+V  P D +L+++        +  +  L +  K  G    + G   ++  +G  T 
Sbjct: 222 LAAAIVSQPADTLLSKVNKTSKAPGQSTVGLLFQLAKQLGFVGSFAGLPTRLVMVGTLTS 281

Query: 297 L 297
           L
Sbjct: 282 L 282

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 66/170 (38%), Gaps = 14/170 (8%)

Query: 144 PLFLVKTRLQSYSNAIKIGEQTHYT-GVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202
           P+ +VKTR+Q         E T Y  G+    + I   EG   L  G    +L      +
Sbjct: 33  PIDVVKTRIQL--------EPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGA 84

Query: 203 VQLPIYNTAKNFLLRNDIMEDGP----SLHLTASTISGLGVAVVMNPWDVILTRIYNQKG 258
            +   Y   K F +     +       S+++ ++  +     + + P +    R+ +Q  
Sbjct: 85  FKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQP- 143

Query: 259 DLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKL 308
               G +    + +K EG+ + Y GF   +F+  P+ I      E+  +L
Sbjct: 144 TFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASEL 193

 Score = 31.6 bits (70), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 72/197 (36%), Gaps = 19/197 (9%)

Query: 20  GSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF-QAMGVVFRNEGIRG 78
           GS  A    A IA+    P+E  +IR+         +Q  + N        + + EG+  
Sbjct: 116 GSAAAAEFLADIALC---PLEATRIRL--------VSQPTFANGLVGGFSRILKEEGVGS 164

Query: 79  LQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIG 138
              G       QI  N ++   +E    +      P     +     IN+ +G  +G+  
Sbjct: 165 FYSGFTPILFKQIPYNIAKFLVFERASELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAA 224

Query: 139 AVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198
           A++  P     T L   +   K   Q+    ++   K +    G  G F G+   ++  G
Sbjct: 225 AIVSQP---ADTLLSKVNKTSKAPGQSTVGLLFQLAKQL----GFVGSFAGLPTRLVMVG 277

Query: 199 AGSSVQLPIYNTAKNFL 215
             +S+Q  IY   K  L
Sbjct: 278 TLTSLQFGIYGQLKKSL 294

>Kwal_26.7972
          Length = 358

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 65/154 (42%), Gaps = 9/154 (5%)

Query: 8   IQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAM 67
           + K +A  + + G   AGG+A   A T+  P++ +KI  Q                 +A 
Sbjct: 19  VDKRSAHYILRSG--LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAG 76

Query: 68  GVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN 127
             +  ++GIRG  +G  A  I        +   YE IR  M     P +E    ++    
Sbjct: 77  AHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFM----IPSKE---YETHARR 129

Query: 128 VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKI 161
           + +G+ +G+    M  PL L++ RL   ++  +I
Sbjct: 130 LASGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRI 163

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 7   KIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQA 66
           + +K +++ +  +    AGGLA   + T + P E+++ R+Q+      +     T P   
Sbjct: 247 RSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIP-DM 305

Query: 67  MGVVFRNEGIRGLQKGLVAAYI 88
           + ++++  G RG   GL   YI
Sbjct: 306 IRIIYKERGWRGFFVGLSIGYI 327

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 7/78 (8%)

Query: 27  LAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAA 86
           L+A +A TVT P + +K RMQL+          +TN F     + +NE +  L  GL   
Sbjct: 232 LSASLATTVTAPFDTIKTRMQLEPS-------KFTNSFNTFTSIVKNENVLKLFSGLSMR 284

Query: 87  YIYQIALNGSRLGFYEPI 104
              +    G   G YE +
Sbjct: 285 LARKAFSAGIAWGIYEEL 302

 Score = 34.7 bits (78), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 42/102 (41%), Gaps = 21/102 (20%)

Query: 114 PDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNG 173
           P   SH        +  G   G+  AV   PL L+KTR+Q          Q     +W  
Sbjct: 8   PRNSSH--------LIGGFFGGLTSAVALQPLDLLKTRIQ----------QDKKATLWKN 49

Query: 174 LKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215
           LK I   +    L+RG   + LRT  GS++ L   N  ++ L
Sbjct: 50  LKEI---DSPLQLWRGTLPSALRTSIGSALYLSCLNLMRSSL 88

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 64/286 (22%), Positives = 120/286 (41%), Gaps = 38/286 (13%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQLQGE-LMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83
           GGL + +A+    P++++K R+Q   +  +  N +   +P Q    ++R      L+  +
Sbjct: 20  GGLTSAVAL---QPLDLLKTRIQQDKKATLWKNLKEIDSPLQ----LWRGTLPSALRTSI 72

Query: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKT-----FYPDQESHKVQSVGINVFAGA-ASGII 137
            +A +Y   LN  R    +   AV + T      Y    S    ++  N+  GA A G++
Sbjct: 73  GSA-LYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYENLLTGAFARGLV 131

Query: 138 GAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197
           G +   P+ ++K R +S           +Y+ +   +  IY  EG+ G FRG  A  LR 
Sbjct: 132 GYIT-MPITVIKVRYES--------TLYNYSSLKEAITHIYTKEGLFGFFRGFGATCLRD 182

Query: 198 GAGSSVQLPIYNTAKNFL---LRNDIMEDGPS----------LHLTASTISGLGVAVVMN 244
              + + + +Y  +K  L   L +  +   P           ++ T++ +S      V  
Sbjct: 183 APYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLATTVTA 242

Query: 245 PWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFR 290
           P+D I TR+  +    +    +     VK E +  L+ G   ++ R
Sbjct: 243 PFDTIKTRMQLEPSK-FTNSFNTFTSIVKNENVLKLFSGLSMRLAR 287

 Score = 28.9 bits (63), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 41/208 (19%), Positives = 81/208 (38%), Gaps = 24/208 (11%)

Query: 9   QKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMG 68
           + S+  +++ + +   G  A  +   +T PI V+K+R +       +    Y++  +A+ 
Sbjct: 108 KSSSLPRLTMYENLLTGAFARGLVGYITMPITVIKVRYE-------STLYNYSSLKEAIT 160

Query: 69  VVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINV 128
            ++  EG+ G  +G  A  +      G  +  YE  + ++     P +  H     G   
Sbjct: 161 HIYTKEGLFGFFRGFGATCLRDAPYAGLYVLLYEKSKQLLPMVL-PSRFIHYNPEGGFTT 219

Query: 129 FAGAASGIIGAVMGS--------PLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMT 180
           +         AV+ +        P   +KTR+Q         E + +T  +N   +I   
Sbjct: 220 YTSTTVNTTSAVLSASLATTVTAPFDTIKTRMQL--------EPSKFTNSFNTFTSIVKN 271

Query: 181 EGVKGLFRGIDAAILRTGAGSSVQLPIY 208
           E V  LF G+   + R    + +   IY
Sbjct: 272 ENVLKLFSGLSMRLARKAFSAGIAWGIY 299

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 124/303 (40%), Gaps = 35/303 (11%)

Query: 20  GSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELM----AANQRIYTNPFQAMGVVFRNEG 75
            +FT G +A+ +A T   P+++ K  +Q Q +      +  +  Y N    +  +F+  G
Sbjct: 6   SAFT-GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRG 64

Query: 76  IRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYP------DQESHKVQSVGINVF 129
             GL +GL          N     +Y  IR+  N   +         +S  ++   I   
Sbjct: 65  FLGLYQGLATNVAANFVQNFIYFFWYSLIRS--NYFVFKAGRLQLKDDSKFIELSTIEEL 122

Query: 130 A-GAASGIIGAVMGSPLFLVKTRLQ--------SYSNAIK-IGEQTH--YTGVWNGLKTI 177
           A G ++G +  V+ +P+ ++ TR Q        S    IK I E+++   T  W G K  
Sbjct: 123 ALGMSAGAMTQVVTNPISVISTRQQLTKDGEDASLKAVIKQIYEESNGDLTAFWKGFKVA 182

Query: 178 YMTEG----VKGLFRGIDAAILRTG--AGSSVQLPIYNTAKNFLL--RNDIMEDGPSLHL 229
            +         G ++ + + IL     +GS       +  +NFLL   + ++    +  L
Sbjct: 183 LVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMISTFVTQPL 242

Query: 230 TASTISGLGVAVVMNPWDVILTRIYNQKG--DLYKGPIDCLVKTVKIEGITALYKGFEAQ 287
             + I+  G       +  +L  IY  +G   L+KG I  + K V ++G+   YK    +
Sbjct: 243 IVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGVIPQVSKGVIVQGLLFTYKDEIVR 302

Query: 288 VFR 290
           V R
Sbjct: 303 VIR 305

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 8/112 (7%)

Query: 2   AKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYT 61
           AKG    QK + Q +S   +F  G  +  I+  VT P+ V KI +Q +G      Q +  
Sbjct: 206 AKGLSGSQKISTQ-LSAGENFLLGMFSKMISTFVTQPLIVAKITLQGKGSKFKTFQEVLQ 264

Query: 62  NPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFY 113
           +       +++NEG   L KG++      + + G    + + I  V+ K  +
Sbjct: 265 H-------IYQNEGFLSLWKGVIPQVSKGVIVQGLLFTYKDEIVRVIRKLLF 309

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 1/93 (1%)

Query: 16  VSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEG 75
           ++ +    AGGLA   + T   P E+++ R+Q+ G +    +  +T+  +   ++F   G
Sbjct: 288 LNTWAELLAGGLAGMASQTAAYPFEIIRRRLQV-GAVTNPLEHKFTSMSEMAKIIFHERG 346

Query: 76  IRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVM 108
            RG   GL   YI    +       YE ++  M
Sbjct: 347 WRGFFVGLSIGYIKVTPMVACSFFVYERMKWYM 379

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 57/125 (45%), Gaps = 2/125 (1%)

Query: 129 FAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFR 188
            AG  +G     + +PL  +K   Q+ SN   +     + G+ N    I+  + ++G+F+
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQT-SNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQ 116

Query: 189 GIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDV 248
           G  A +LR    ++V+   Y   +N ++ +   E      L + +++GL       P D+
Sbjct: 117 GHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETH-FRRLCSGSLAGLCSVFCTYPLDL 175

Query: 249 ILTRI 253
           I  R+
Sbjct: 176 IRVRL 180

 Score = 36.6 bits (83), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 70/167 (41%), Gaps = 22/167 (13%)

Query: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAM---GV-VFRNEGIRGL 79
           AGG+A   A T+  P++ +KI  Q            Y   FQ +   GV ++  + +RG+
Sbjct: 59  AGGVAGSCAKTLIAPLDRIKILFQTSNPHYVK----YAGSFQGLLNAGVHIWSRDRLRGV 114

Query: 80  QKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGA 139
            +G  A  +        +   YE IR V+  +   + E+H  +     + +G+ +G+   
Sbjct: 115 FQGHSATLLRIFPYAAVKFIAYEQIRNVIIPS--KEYETHFRR-----LCSGSLAGLCSV 167

Query: 140 VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186
               PL L++ RL   +       + H   VW  +K IY     + L
Sbjct: 168 FCTYPLDLIRVRLAYVT-------EHHKVRVWPLVKQIYSEPASEAL 207

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 64/287 (22%), Positives = 114/287 (39%), Gaps = 35/287 (12%)

Query: 25  GGLAACIAVTVTNPIEVVKIRMQLQ---------GELMAANQRIYTNPFQAMGVVFRNEG 75
           G +A+ +A     P+++ K  +Q Q          E      R Y N    M  +F+ +G
Sbjct: 10  GAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKEKG 69

Query: 76  IRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGI------NVF 129
           I GL +G+    +     N     +Y  IR    K      +S K +   I       + 
Sbjct: 70  ILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIEELV 129

Query: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEG--VKGLF 187
            G A+  I  +  SP+ +V TR Q+  +A    E   +T V   +K IY      +   +
Sbjct: 130 LGVAAASISQLFTSPMAVVATRQQTVHSA----ESAKFTNV---IKDIYRENNGDITAFW 182

Query: 188 RGIDAAILRTGAGSSVQLPI-YNTAKNF--LLRNDIMEDGPSLHLTASTISGL---GVAV 241
           +G     LRTG   ++   I Y + +    +  +D   D  SL    + I G+    ++ 
Sbjct: 183 KG-----LRTGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMIST 237

Query: 242 VMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQV 288
           ++    ++   +    G  +    + L+   K EG+ +L+KG   Q+
Sbjct: 238 LVTQPLIVAKAMLQSAGSKFTTFQEALLYLYKNEGLKSLWKGVLPQL 284

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 13  AQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR 72
           A  +S   +F  G L+  I+  VT P+ V K  +Q  G      Q       +A+  +++
Sbjct: 217 AGSLSAVQNFILGVLSKMISTLVTQPLIVAKAMLQSAGSKFTTFQ-------EALLYLYK 269

Query: 73  NEGIRGLQKGLV 84
           NEG++ L KG++
Sbjct: 270 NEGLKSLWKGVL 281

>Scas_198.1
          Length = 72

 Score = 33.9 bits (76), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 21/33 (63%)

Query: 21 SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELM 53
           F  GG++A IA T   PIE VKI MQ Q E++
Sbjct: 18 DFLMGGVSAAIAKTGAAPIERVKILMQNQDEML 50

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 34.7 bits (78), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 6/82 (7%)

Query: 228 HLTASTISGLGVAVVMNPWDVILTRIY------NQKGDLYKGPIDCLVKTVKIEGITALY 281
            L    ISG     ++ P+D++  R        N+ G  YK   D L+   K EG    Y
Sbjct: 13  KLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYY 72

Query: 282 KGFEAQVFRIGPHTILCLTFLE 303
           KG  A +F++ P T +     E
Sbjct: 73  KGLTANLFKVIPSTAVSWLVYE 94

 Score = 31.2 bits (69), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 7/86 (8%)

Query: 131 GAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQT---HYTGVWNGLKTIYMTEGVKGLF 187
           GA SG +   +  P  L++ R Q     + +G       Y  V + L TI  TEG KG +
Sbjct: 17  GAISGGVAQTLVYPFDLLRRRFQ----VLAMGGNELGFRYKSVSDALITIGKTEGPKGYY 72

Query: 188 RGIDAAILRTGAGSSVQLPIYNTAKN 213
           +G+ A + +    ++V   +Y   + 
Sbjct: 73  KGLTANLFKVIPSTAVSWLVYEVIRE 98

>CAGL0K06545g complement(641129..642667) similar to tr|Q03327
           Saccharomyces cerevisiae YDR470c, hypothetical start
          Length = 512

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 42/94 (44%), Gaps = 16/94 (17%)

Query: 67  MGVVFRNEGIRGLQKGLVAAYIYQI---ALNGSRLGFYEPIRAVMNKTF-----YPDQES 118
           M  +   EGI+GL K     +IYQI    L     G   P+  + +  F     +PD +S
Sbjct: 240 MNSILDEEGIKGLWKANNTNFIYQILSSTLEAWYTGLISPLLHIPDPYFIDLIHFPDTQS 299

Query: 119 HKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRL 152
             + ++ +        G++ A+   P+ L++TR 
Sbjct: 300 AVLLTLSV--------GVLTALTLIPIDLIRTRF 325

>Scas_720.94
          Length = 1683

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 52/124 (41%), Gaps = 24/124 (19%)

Query: 131  GAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWN-GLKTIYMTEGVKGLFRG 189
            GA S  +  ++G+P+++    +  Y N  K G       +W+ G   + M  G +  +  
Sbjct: 1538 GANS--VHDMLGTPMYMAPESITGYKNKTKFGSD----DIWSFGCVVLEMITGRRP-WAN 1590

Query: 190  ID---AAILRTGAGSSVQLPIYNTA----KNFLLRNDIMEDGPSLHLTASTISGLGVAVV 242
            +D   A I    AG + QLP  N      + FL R   +   P    TA       V ++
Sbjct: 1591 LDNEWAIIYHVAAGQTPQLPYPNEVSPAGRRFLQR--CLVQDPIKRATA-------VELL 1641

Query: 243  MNPW 246
            M+PW
Sbjct: 1642 MDPW 1645

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 166 HYTGVWNGLKTIYMTEGVKGLFRGIDAA 193
            Y G  + L+ IY  EGV GL+RG+ ++
Sbjct: 71  QYKGALDALQRIYGAEGVAGLYRGLGSS 98

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 256 QKGDLYKGPIDCLVKTVKIEGITALYKGF 284
           Q  + YKG +D L +    EG+  LY+G 
Sbjct: 67  QAAEQYKGALDALQRIYGAEGVAGLYRGL 95

>KLLA0A01342g complement(120385..122730) some similarities with
           sp|P18494 Saccharomyces cerevisiae YER040w GLN3
           transcription factor for positive nitrogen regulation,
           hypothetical start
          Length = 781

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 17/21 (80%)

Query: 204 QLPIYNTAKNFLLRNDIMEDG 224
           QLP  ++++N L++ND+ EDG
Sbjct: 269 QLPRRSSSRNLLIKNDMNEDG 289

>YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein of
           the mitochondrial outer membrane required for
           mitochondrial fusion, member of the mitochondrial
           carrier family (MCF) of membrane transporters [1509 bp,
           502 aa]
          Length = 502

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 48/112 (42%), Gaps = 24/112 (21%)

Query: 52  LMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQI----------ALNGSRLGFY 101
           L  A Q ++T     +  +F  EGIRGL K     +IY             L  S LG  
Sbjct: 220 LTIAPQSLHT--IDVINALFDQEGIRGLWKANNTTFIYNFLSLSIDTWFTGLLSSFLGVP 277

Query: 102 EP-IRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRL 152
           +P    V+N    PD     + ++G        +G+  +++  P+ L++TRL
Sbjct: 278 DPYFMEVINS---PDISKSFILALG--------AGVFTSIILLPVDLIRTRL 318

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.137    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,941,441
Number of extensions: 351605
Number of successful extensions: 2328
Number of sequences better than 10.0: 214
Number of HSP's gapped: 1344
Number of HSP's successfully gapped: 561
Length of query: 315
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 213
Effective length of database: 13,065,073
Effective search space: 2782860549
Effective search space used: 2782860549
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)