Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K11594g2092066881e-92
Sklu_2430.122571573081e-34
Scas_721.1302121582946e-33
Kwal_26.76482021532753e-30
YKL119C (VPH2)2151572721e-29
KLLA0B12870g2051551856e-17
ABL021C239146952e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K11594g
         (206 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K11594g 1121044..1121673 similar to sp|P32341 Saccharomyces...   269   1e-92
Sklu_2430.12 YKL119C, Contig c2430 21414-22187 reverse complement     123   1e-34
Scas_721.130                                                          117   6e-33
Kwal_26.7648                                                          110   3e-30
YKL119C (VPH2) [3146] chr11 complement(218216..218863) Vacuolar ...   109   1e-29
KLLA0B12870g complement(1123581..1124198) weakly similar to sp|P...    76   6e-17
ABL021C [571] [Homologous to ScYKL119C (VPH2) - SH] (358274..358...    41   2e-04

>CAGL0K11594g 1121044..1121673 similar to sp|P32341 Saccharomyces
           cerevisiae YKL119c VPH2 H+-ATPase assembly protein,
           start by similarity
          Length = 209

 Score =  269 bits (688), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 142/206 (68%), Positives = 142/206 (68%)

Query: 1   MFEVAVGSXXXXXXXXXXXXXXXXXXXXXKVRLLELIERGSVPCGELAELCRAWGSEVSV 60
           MFEVAVGS                     KVRLLELIERGSVPCGELAELCRAWGSEVSV
Sbjct: 1   MFEVAVGSALRRALESAVEAAVAAGDGDAKVRLLELIERGSVPCGELAELCRAWGSEVSV 60

Query: 61  SEALSGLEFKFKDRETRKPSPEFXXXXXXXXXXXXXXXYQQIVKNRDLAITTESEATPAQ 120
           SEALSGLEFKFKDRETRKPSPEF               YQQIVKNRDLAITTESEATPAQ
Sbjct: 61  SEALSGLEFKFKDRETRKPSPEFQAQLARLRALQQEQEYQQIVKNRDLAITTESEATPAQ 120

Query: 121 INREIKEQVTTVFNXXXXXXXXXXAIWYWSRTSAGLAIHHRIFLCMFFGILVLVAEVVVY 180
           INREIKEQVTTVFN          AIWYWSRTSAGLAIHHRIFLCMFFGILVLVAEVVVY
Sbjct: 121 INREIKEQVTTVFNIIISVISVVVAIWYWSRTSAGLAIHHRIFLCMFFGILVLVAEVVVY 180

Query: 181 SSYLXXXXXXXXXXXXXXXXXXLVQK 206
           SSYL                  LVQK
Sbjct: 181 SSYLSKIEEAKASEKSKKEHKKLVQK 206

>Sklu_2430.12 YKL119C, Contig c2430 21414-22187 reverse complement
          Length = 257

 Score =  123 bits (308), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 95/157 (60%), Gaps = 4/157 (2%)

Query: 32  RLLELIERGSVPCGELAELCRAWGSEVSVSEALSGLEFKFKDRETR--KPSPEFXXXXXX 89
           R+ EL++  S+P   L E    + SE  +S+ LS L+FKFK++  R    S EF      
Sbjct: 76  RVEELLQNDSIPIKLLLEYHLEYWSERPISKLLSPLKFKFKEKYERGVNYSEEFKRQLEH 135

Query: 90  XXXXXXXXXYQQIVKNRDLAITTES--EATPAQINREIKEQVTTVFNXXXXXXXXXXAIW 147
                    YQ+++K   L    E+  E TP+Q++++I+EQ+TT+FN          AIW
Sbjct: 136 LKLQQEENEYQEMIKRDGLGYLKENAEELTPSQMSKQIREQITTIFNILLSVVSVVWAIW 195

Query: 148 YWSRTSAGLAIHHRIFLCMFFGILVLVAEVVVYSSYL 184
           YWS +S  +A H+RIFLC+FFG+LVLVAE+VVY+SYL
Sbjct: 196 YWSSSSTRIATHNRIFLCLFFGVLVLVAEIVVYNSYL 232

>Scas_721.130
          Length = 212

 Score =  117 bits (294), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 92/158 (58%), Gaps = 11/158 (6%)

Query: 36  LIERGSVPCGELAEL-CRAWGSEVSVSEALSGLEFKFKDRETRKP----SPEFXXXXXXX 90
           L+  G +P   L +     W +++ + + L+ +EF+FK++   +P    SPEF       
Sbjct: 32  LLNNGYIPMKTLLKYHSEYWKNQIPMRQLLNPIEFQFKEK--YQPGSTYSPEFKKQLETL 89

Query: 91  XXXXXXXXYQQIVKN--RDLAITTES--EATPAQINREIKEQVTTVFNXXXXXXXXXXAI 146
                   YQ ++KN  + L I  E     TPAQ+N++IKEQVTT+FN          AI
Sbjct: 90  KLKQEELDYQNMIKNERKTLQIIKEEGETLTPAQMNKQIKEQVTTIFNIFVSVISVVFAI 149

Query: 147 WYWSRTSAGLAIHHRIFLCMFFGILVLVAEVVVYSSYL 184
           WYW+ TSA + +H+R+ LC+F GILVLVAEVVVY+SYL
Sbjct: 150 WYWTGTSAHMPVHYRLLLCIFTGILVLVAEVVVYNSYL 187

>Kwal_26.7648
          Length = 202

 Score =  110 bits (275), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 85/153 (55%), Gaps = 4/153 (2%)

Query: 36  LIERGSVPCGELAELCRAWGSEVSVSEALSGLEFKFKDRETRKP--SPEFXXXXXXXXXX 93
           ++++GS+    L   C     +V++SE ++ L+F +K +  R    S EF          
Sbjct: 26  ILDKGSISMKSLLSFCEKHWQDVAISELVTPLDFVYKTKRERGAHYSEEFKLQLERLRLE 85

Query: 94  XXXXXYQQIVKNRDLAITTES--EATPAQINREIKEQVTTVFNXXXXXXXXXXAIWYWSR 151
                YQ +V+   LA+  +     TPAQI +++KEQ+TTVFN          A+WYW+ 
Sbjct: 86  QEESEYQNMVRRDGLAVGLQDSDNQTPAQITKQVKEQITTVFNILVSVVSVVFAVWYWTG 145

Query: 152 TSAGLAIHHRIFLCMFFGILVLVAEVVVYSSYL 184
           +SAG+    R+  C+F GILVLVAEVVVYSSYL
Sbjct: 146 SSAGMRPQSRVLFCLFGGILVLVAEVVVYSSYL 178

>YKL119C (VPH2) [3146] chr11 complement(218216..218863) Vacuolar
           H(+)-ATPase (V-ATPase) assembly protein acting in the
           endoplasmic reticulum [648 bp, 215 aa]
          Length = 215

 Score =  109 bits (272), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 85/157 (54%), Gaps = 8/157 (5%)

Query: 36  LIERGSVPCGEL----AELCRAWGSEVSVSEALSGLEFKFKDRETR--KPSPEFXXXXXX 89
            ++R ++P   L     E  +    + S+ E L  LEF+FK +  R    S +F      
Sbjct: 34  FLKRHAIPMQSLLFYVKEYRKDSDLQCSIKELLKPLEFEFKPKAVRGLHYSEDFKKKLEF 93

Query: 90  XXXXXXXXXYQQIVKNRD--LAITTESEATPAQINREIKEQVTTVFNXXXXXXXXXXAIW 147
                    YQ +VK      ++  + E TP+QIN++IKEQVTTVFN          AIW
Sbjct: 94  LKYQEQELEYQSMVKRSKSVFSLQEDDELTPSQINKQIKEQVTTVFNVLVSVISVVVAIW 153

Query: 148 YWSRTSAGLAIHHRIFLCMFFGILVLVAEVVVYSSYL 184
           YW+ +S    +H R+ LC+FFGILVLVA+VVVY+SYL
Sbjct: 154 YWTGSSTNFPVHVRLLLCLFFGILVLVADVVVYNSYL 190

>KLLA0B12870g complement(1123581..1124198) weakly similar to
           sp|P32341 Saccharomyces cerevisiae YKL119c VPH2
           H+-ATPase assembly protein singleton, start by
           similarity
          Length = 205

 Score = 75.9 bits (185), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 77/155 (49%), Gaps = 10/155 (6%)

Query: 37  IERGSVPCGELAELCRA-WGSEVSVSEALSGLEFKFKDRETRKP----SPEFXXXXXXXX 91
           +++ S+    L+EL +  W  + +VS        K + +E R P    S  F        
Sbjct: 28  LQQNSISFELLSELYQQFWRDDATVSMKQLLKSGKLRYKEKRVPGEGYSESFKAELENLK 87

Query: 92  XXXXXXXYQQIVKNRDLAI---TTESEATPAQINREIKEQVTTVFNXXXXXXXXXXAIWY 148
                  YQ+++K   L +   T + E + AQIN+EIKEQV+ V N          A+WY
Sbjct: 88  ALQQEKEYQEMLKRDSLHLAGSTADKEPSIAQINKEIKEQVSAVVNVLLTVFGTIYAVWY 147

Query: 149 WSRTSAGLAIHHRIFLCMFFGILVLVAEVVVYSSY 183
            +RT  G  IH R+ LC+F G+LVL A+V +Y+ Y
Sbjct: 148 VTRT--GWDIHVRVLLCLFSGLLVLTADVAMYNVY 180

>ABL021C [571] [Homologous to ScYKL119C (VPH2) - SH]
           (358274..358993) [720 bp, 239 aa]
          Length = 239

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 58/146 (39%), Gaps = 5/146 (3%)

Query: 39  RGSVPCGELAELCRAWGSEVSVSEALSG-LEFKFKDRETRKPSPEFXXXXXXXXXXXXXX 97
           RG V  G L  LC    +    ++AL G L  + +   +   S EF              
Sbjct: 75  RGWVTFGSLVVLCERGAATARETQALLGSLLLRPRAARSSNYSDEFRAQQQRLRAAAAED 134

Query: 98  XYQQIVKNRDLAITTESEATPAQINREIKEQVTTVFNXXXXXXXXXXAIWYWSRTSAGLA 157
            Y+ +              + A   RE++EQ+  V N           +W+ +R +AG+ 
Sbjct: 135 EYRALTGGMQQEQQRHGFGSAA---REVREQLAAVANVVLTVVGVAYGVWWVAR-AAGVG 190

Query: 158 IHHRIFLCMFFGILVLVAEVVVYSSY 183
              R+ L +  G+  LVA+V +Y+ Y
Sbjct: 191 AEARVLLALGCGLTALVADVAMYNVY 216

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,660,098
Number of extensions: 97425
Number of successful extensions: 209
Number of sequences better than 10.0: 7
Number of HSP's gapped: 203
Number of HSP's successfully gapped: 7
Length of query: 206
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 109
Effective length of database: 13,238,163
Effective search space: 1442959767
Effective search space used: 1442959767
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)