Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K11550g53853028390.0
Scas_721.13258447713720.0
YKL116C (PRR1)51853713370.0
Kwal_26.768251849910661e-140
Scas_336.148648310271e-135
KLLA0C14278g5415189291e-119
ABL055C5363859211e-118
AFR696C11422673128e-30
CAGL0K05709g11032563111e-29
KLLA0C01650g11122623082e-29
CAGL0K08514g14892712978e-28
AEL230W6082682894e-27
CAGL0M08910g6122642885e-27
Scas_493.211172652897e-27
YDR507C (GIN4)11421952871e-26
Scas_660.286232642832e-26
YCL024W (KCC4)10372522852e-26
KLLA0A03806g6022642804e-26
YDR477W (SNF1)6332642804e-26
Kwal_47.182335982652795e-26
ABL034W14252532772e-25
Scas_616.1014611902692e-24
YKL101W (HSL1)15181902674e-24
KLLA0F13552g12672522656e-24
Scas_693.1710492672559e-23
Kwal_26.778812672522542e-22
Kwal_26.87098292552486e-22
AGR058W10712642471e-21
CAGL0B01925g9442722451e-21
ACR119W9313162442e-21
CAGL0J03872g6612552432e-21
Scas_640.14*7281902381e-20
YDR122W (KIN1)10642622381e-20
Scas_700.348641922344e-20
YLR096W (KIN2)11472622319e-20
KLLA0F19536g11043162319e-20
Scas_564.712102622301e-19
Kwal_26.87518482552272e-19
Scas_690.133542592213e-19
CAGL0M02519g7562162263e-19
CAGL0G09020g3612482213e-19
ACR133C8512592263e-19
YAR019C (CDC15)9742632255e-19
ACR142W8372102246e-19
AFL090W3462482186e-19
CAGL0M11396g11922622247e-19
Kwal_56.240593532482161e-18
KLLA0E01584g4153122181e-18
YDL101C (DUN1)5133092182e-18
AFL188C4723132163e-18
Kwal_27.1058111543262184e-18
KLLA0D07348g9092462175e-18
Kwal_56.237178581422166e-18
CAGL0M02299g8931952157e-18
KLLA0D03190g3722592091e-17
AAR009W4532572111e-17
Scas_613.55172552092e-17
KLLA0F23507g4872752083e-17
CAGL0L03520g14472652113e-17
KLLA0F23155g4272482064e-17
YJL164C (TPK1)3972482054e-17
YCR073C (SSK22)13312672104e-17
CAGL0L07326g5063032074e-17
Kwal_26.735514462652095e-17
KLLA0F11319g8431422076e-17
YJL095W (BCK1)14783882086e-17
Scas_700.288961942078e-17
Scas_700.546982232041e-16
Scas_707.349053432051e-16
Scas_651.183712591992e-16
Kwal_55.203267502952032e-16
Kwal_23.35904992582012e-16
CAGL0L06006g9422782023e-16
Scas_711.2515152622033e-16
KLLA0B07205g4552481993e-16
Kwal_33.138463752481983e-16
KLLA0B13112g7303102013e-16
YKL166C (TPK3)3983311983e-16
KLLA0F11143g8131992013e-16
Kwal_26.87967962052014e-16
AER264C14832692014e-16
KLLA0C17160g8313052005e-16
YFR014C (CMK1)4462471985e-16
Scas_627.73491951955e-16
KLLA0F14190g13382622007e-16
Kwal_47.172528722251997e-16
CAGL0M08404g4621861969e-16
Scas_593.14d4952701961e-15
YBL105C (PKC1)11511461981e-15
Kwal_23.632515422691981e-15
KLLA0F01408g2922661901e-15
AEL115C3861861941e-15
Scas_715.3411501421971e-15
Kwal_0.964272571941e-15
Kwal_56.240913811901922e-15
ACL054W9722621962e-15
ACR191C11492531962e-15
KLLA0E06413g11611421952e-15
Scas_689.25*4093131913e-15
CAGL0I07513g10762801953e-15
CAGL0M02233g7672141943e-15
KLLA0B12716g7162491924e-15
Scas_201.1*2741901854e-15
AFR092W14232651934e-15
CAGL0C05005g10762631934e-15
Scas_628.96212561906e-15
CAGL0H06259g13361121926e-15
YAL017W (PSK1)13562891926e-15
Scas_713.79832631908e-15
CAGL0F04741g4421931879e-15
CAGL0B02739g6762661899e-15
YDR466W (PKH3)8981621891e-14
ABL028W7222491891e-14
CAGL0F00913g12061251891e-14
CAGL0J11638g7461481881e-14
KLLA0F07623g12291211881e-14
Kwal_0.3074902931862e-14
KLLA0F24618g5562611852e-14
Kwal_47.183076211731852e-14
Kwal_27.97734062661833e-14
Scas_720.9416832861863e-14
Scas_618.84271951833e-14
KLLA0C08525g15513061863e-14
CAGL0M09361g11441421854e-14
Kwal_26.715412131121845e-14
Scas_721.1246841371835e-14
Kwal_23.42765211751825e-14
YGL180W (ATG1)8972781835e-14
YJL106W (IME2)6451231835e-14
AFL101C3671941796e-14
Scas_580.610151431836e-14
YKL126W (YPK1)6801421827e-14
CAGL0J04972g3391571788e-14
ACL006W7081921819e-14
Scas_644.157261891819e-14
Scas_548.613821211829e-14
CAGL0K10604g4461891791e-13
CAGL0K07458g7041371801e-13
KLLA0B02332g3611941771e-13
KLLA0C04213g3942361771e-13
Kwal_56.226939841501802e-13
YLR362W (STE11)7172851792e-13
YGL158W (RCK1)5123631772e-13
Scas_477.57032761782e-13
Scas_502.211162551792e-13
YKL139W (CTK1)5282511772e-13
CAGL0K03399g7032161773e-13
YBR028C5252761754e-13
YDL108W (KIN28)3062591714e-13
YDR523C (SPS1)4902651744e-13
ADL283W3062601714e-13
Scas_613.13*3122641715e-13
YMR001C (CDC5)7051921755e-13
CAGL0L11550g10721431756e-13
Scas_675.25271601736e-13
CAGL0L07810g5961961746e-13
AFR377C7261921747e-13
AER195C5042521737e-13
CAGL0K02673g9151421747e-13
ACR281C12591211757e-13
Scas_618.156202211738e-13
Scas_720.1038043931739e-13
ACL053C11812371749e-13
Kwal_33.132221481301609e-13
CAGL0B04301g5422961711e-12
Kwal_56.227885152691711e-12
Scas_707.369152211721e-12
AEL083W5363301711e-12
YMR104C (YPK2)6771421711e-12
KLLA0C12485g9252581721e-12
CAGL0E05720g3581901681e-12
Kwal_26.76356912511702e-12
AFR335C10332761712e-12
KLLA0C04191g7971931702e-12
Scas_711.157271091702e-12
Kwal_56.224766971171692e-12
Kwal_55.201898121491702e-12
CAGL0C03509g8951981702e-12
Scas_700.354391231682e-12
CAGL0M03729g8612021692e-12
KLLA0C06138g7081921692e-12
CAGL0J03828g4671981682e-12
Kwal_27.100047351611693e-12
YHR102W (KIC1)10801431693e-12
Scas_703.57491411683e-12
ABR014W9711421693e-12
Kwal_47.167617441411683e-12
ACL104C9472811684e-12
YHR082C (KSP1)10291501684e-12
KLLA0B03586g7342911684e-12
Kwal_27.97638681891684e-12
KLLA0D09328g10462241684e-12
CAGL0D02002g5531881674e-12
Kwal_26.75524612461664e-12
ADL389W7111411675e-12
CAGL0D02244g4872111665e-12
KLLA0E03487g6473191665e-12
YKL168C (KKQ8)7341431665e-12
Scas_668.228931421676e-12
CAGL0I09504g5281581656e-12
Kwal_55.215458652071667e-12
AER222C4232781638e-12
AER223C9021851658e-12
Scas_629.169182051658e-12
KLLA0F02838g7551241658e-12
Kwal_33.131125053131639e-12
CAGL0G04455g7511241659e-12
KLLA0B13607g9891421641e-11
ADR300C8902171641e-11
ACR117W5241451631e-11
YHR205W (SCH9)8241411641e-11
ABL011C7012661631e-11
KLLA0C18568g7742161631e-11
CAGL0H10318g3072581591e-11
KLLA0C00979g4832681621e-11
YHL007C (STE20)9391871631e-11
CAGL0F09075g7461411631e-11
Kwal_23.64588682611632e-11
Kwal_26.87034441901612e-11
Kwal_33.138317002201622e-11
CAGL0K06479g9912361622e-11
CAGL0K02167g11622301622e-11
KLLA0E14828g3101991572e-11
Scas_653.256661521612e-11
AEL205W7931481612e-11
Scas_598.67901541612e-11
Scas_640.165051441603e-11
Kwal_47.1726311272211613e-11
Kwal_23.52908191541613e-11
CAGL0F03311g10451721613e-11
Kwal_26.78619551421613e-11
YCR091W (KIN82)7202641603e-11
Scas_717.696741371603e-11
Scas_643.2010821251604e-11
KLLA0E21780g10161431595e-11
KLLA0E17127g8521501587e-11
CAGL0G04609g9651531587e-11
Scas_684.286201791577e-11
KLLA0D07304g4651231567e-11
Scas_673.20*7582531561e-10
Scas_651.198011431561e-10
YLR248W (RCK2)6101991551e-10
KLLA0F12188g5461621551e-10
AGR334W5311741541e-10
ADR379C4923501541e-10
KLLA0C07535g6242811541e-10
KLLA0E11979g6141961541e-10
YDR490C (PKH1)7661551551e-10
Scas_721.1105201921541e-10
Scas_692.247182161542e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K11550g
         (530 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...  1098   0.0  
Scas_721.132                                                          533   0.0  
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...   519   0.0  
Kwal_26.7682                                                          415   e-140
Scas_336.1                                                            400   e-135
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...   362   e-119
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...   359   e-118
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...   124   8e-30
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...   124   1e-29
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...   123   2e-29
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...   119   8e-28
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...   115   4e-27
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   115   5e-27
Scas_493.2                                                            115   7e-27
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...   115   1e-26
Scas_660.28                                                           113   2e-26
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...   114   2e-26
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   112   4e-26
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   112   4e-26
Kwal_47.18233                                                         112   5e-26
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...   111   2e-25
Scas_616.10                                                           108   2e-24
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...   107   4e-24
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...   106   6e-24
Scas_693.17                                                           102   9e-23
Kwal_26.7788                                                          102   2e-22
Kwal_26.8709                                                          100   6e-22
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...   100   1e-21
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    99   1e-21
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    99   2e-21
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    98   2e-21
Scas_640.14*                                                           96   1e-20
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    96   1e-20
Scas_700.34                                                            95   4e-20
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    94   9e-20
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    94   9e-20
Scas_564.7                                                             93   1e-19
Kwal_26.8751                                                           92   2e-19
Scas_690.13                                                            90   3e-19
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    92   3e-19
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    90   3e-19
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    92   3e-19
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    91   5e-19
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    91   6e-19
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    89   6e-19
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    91   7e-19
Kwal_56.24059                                                          88   1e-18
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    89   1e-18
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    89   2e-18
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    88   3e-18
Kwal_27.10581                                                          89   4e-18
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    88   5e-18
Kwal_56.23717                                                          88   6e-18
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    87   7e-18
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    85   1e-17
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    86   1e-17
Scas_613.5                                                             85   2e-17
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    85   3e-17
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    86   3e-17
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    84   4e-17
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    84   4e-17
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    86   4e-17
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    84   4e-17
Kwal_26.7355                                                           85   5e-17
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    84   6e-17
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    85   6e-17
Scas_700.28                                                            84   8e-17
Scas_700.54                                                            83   1e-16
Scas_707.34                                                            84   1e-16
Scas_651.18                                                            81   2e-16
Kwal_55.20326                                                          83   2e-16
Kwal_23.3590                                                           82   2e-16
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    82   3e-16
Scas_711.25                                                            83   3e-16
KLLA0B07205g complement(624606..625973) some similarities with s...    81   3e-16
Kwal_33.13846                                                          81   3e-16
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    82   3e-16
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    81   3e-16
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    82   3e-16
Kwal_26.8796                                                           82   4e-16
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    82   4e-16
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    82   5e-16
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    81   5e-16
Scas_627.7                                                             80   5e-16
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    82   7e-16
Kwal_47.17252                                                          81   7e-16
CAGL0M08404g complement(836791..838179) some similarities with s...    80   9e-16
Scas_593.14d                                                           80   1e-15
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    81   1e-15
Kwal_23.6325                                                           81   1e-15
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    78   1e-15
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    79   1e-15
Scas_715.34                                                            80   1e-15
Kwal_0.96                                                              79   1e-15
Kwal_56.24091                                                          79   2e-15
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    80   2e-15
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    80   2e-15
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    80   2e-15
Scas_689.25*                                                           78   3e-15
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    80   3e-15
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    79   3e-15
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    79   4e-15
Scas_201.1*                                                            76   4e-15
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    79   4e-15
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    79   4e-15
Scas_628.9                                                             78   6e-15
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    79   6e-15
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    79   6e-15
Scas_713.7                                                             78   8e-15
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    77   9e-15
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    77   9e-15
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    77   1e-14
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    77   1e-14
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    77   1e-14
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    77   1e-14
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    77   1e-14
Kwal_0.307                                                             76   2e-14
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    76   2e-14
Kwal_47.18307                                                          76   2e-14
Kwal_27.9773                                                           75   3e-14
Scas_720.94                                                            76   3e-14
Scas_618.8                                                             75   3e-14
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    76   3e-14
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    76   4e-14
Kwal_26.7154                                                           75   5e-14
Scas_721.124                                                           75   5e-14
Kwal_23.4276                                                           75   5e-14
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    75   5e-14
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    75   5e-14
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    74   6e-14
Scas_580.6                                                             75   6e-14
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    75   7e-14
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    73   8e-14
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    74   9e-14
Scas_644.15                                                            74   9e-14
Scas_548.6                                                             75   9e-14
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    74   1e-13
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    74   1e-13
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    73   1e-13
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    73   1e-13
Kwal_56.22693                                                          74   2e-13
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    74   2e-13
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    73   2e-13
Scas_477.5                                                             73   2e-13
Scas_502.2                                                             74   2e-13
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    73   2e-13
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    73   3e-13
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    72   4e-13
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    70   4e-13
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    72   4e-13
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    70   4e-13
Scas_613.13*                                                           70   5e-13
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...    72   5e-13
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    72   6e-13
Scas_675.2                                                             71   6e-13
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    72   6e-13
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    72   7e-13
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    71   7e-13
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    72   7e-13
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    72   7e-13
Scas_618.15                                                            71   8e-13
Scas_720.103                                                           71   9e-13
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    72   9e-13
Kwal_33.13222                                                          66   9e-13
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    70   1e-12
Kwal_56.22788                                                          70   1e-12
Scas_707.36                                                            71   1e-12
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    70   1e-12
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    70   1e-12
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    71   1e-12
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    69   1e-12
Kwal_26.7635                                                           70   2e-12
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    70   2e-12
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    70   2e-12
Scas_711.15                                                            70   2e-12
Kwal_56.22476                                                          70   2e-12
Kwal_55.20189                                                          70   2e-12
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    70   2e-12
Scas_700.35                                                            69   2e-12
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    70   2e-12
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    70   2e-12
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    69   2e-12
Kwal_27.10004                                                          70   3e-12
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    70   3e-12
Scas_703.5                                                             69   3e-12
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    70   3e-12
Kwal_47.16761                                                          69   3e-12
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    69   4e-12
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    69   4e-12
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    69   4e-12
Kwal_27.9763                                                           69   4e-12
KLLA0D09328g complement(788565..791705) some similarities with s...    69   4e-12
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    69   4e-12
Kwal_26.7552                                                           69   4e-12
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    69   5e-12
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    69   5e-12
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    69   5e-12
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    69   5e-12
Scas_668.22                                                            69   6e-12
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    68   6e-12
Kwal_55.21545                                                          69   7e-12
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    67   8e-12
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    68   8e-12
Scas_629.16                                                            68   8e-12
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    68   8e-12
Kwal_33.13112                                                          67   9e-12
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    68   9e-12
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    68   1e-11
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    68   1e-11
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    67   1e-11
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    68   1e-11
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    67   1e-11
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    67   1e-11
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    66   1e-11
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    67   1e-11
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    67   1e-11
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    67   1e-11
Kwal_23.6458                                                           67   2e-11
Kwal_26.8703                                                           67   2e-11
Kwal_33.13831                                                          67   2e-11
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    67   2e-11
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    67   2e-11
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    65   2e-11
Scas_653.25                                                            67   2e-11
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    67   2e-11
Scas_598.6                                                             67   2e-11
Scas_640.16                                                            66   3e-11
Kwal_47.17263                                                          67   3e-11
Kwal_23.5290                                                           67   3e-11
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    67   3e-11
Kwal_26.7861                                                           67   3e-11
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    66   3e-11
Scas_717.69                                                            66   3e-11
Scas_643.20                                                            66   4e-11
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    66   5e-11
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    65   7e-11
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    65   7e-11
Scas_684.28                                                            65   7e-11
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    65   7e-11
Scas_673.20*                                                           65   1e-10
Scas_651.19                                                            65   1e-10
YLR248W (RCK2) [3644] chr12 (634254..636086) Calcium/calmodulin-...    64   1e-10
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    64   1e-10
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    64   1e-10
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    64   1e-10
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    64   1e-10
KLLA0E11979g complement(1060048..1061892) some similarities with...    64   1e-10
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    64   1e-10
Scas_721.110                                                           64   1e-10
Scas_692.24                                                            64   2e-10
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    64   2e-10
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    64   2e-10
Kwal_26.7276                                                           64   2e-10
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    63   2e-10
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    64   2e-10
Scas_716.73                                                            63   2e-10
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    63   2e-10
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    62   2e-10
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    64   3e-10
KLLA0C03938g complement(358851..360632) some similarities with s...    63   3e-10
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    62   3e-10
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    63   3e-10
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    63   3e-10
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    63   3e-10
CAGL0M10153g complement(1010688..1013291) some similarities with...    63   4e-10
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    63   4e-10
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    63   4e-10
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    62   4e-10
Scas_685.24                                                            62   5e-10
Kwal_27.12559                                                          62   5e-10
Kwal_33.14434                                                          62   6e-10
Kwal_23.5668                                                           62   6e-10
Kwal_14.1273                                                           61   7e-10
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    62   7e-10
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    61   7e-10
Scas_660.20                                                            62   8e-10
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    62   9e-10
Kwal_0.155                                                             61   1e-09
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    61   1e-09
Scas_619.5*                                                            61   1e-09
Scas_584.11                                                            62   1e-09
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    61   1e-09
YKL198C (PTK1) [3074] chr11 complement(68274..70223) Protein con...    61   1e-09
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    61   1e-09
Scas_655.2                                                             61   2e-09
Scas_671.16                                                            61   2e-09
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    60   2e-09
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    60   2e-09
Scas_710.28                                                            59   2e-09
Kwal_23.3471                                                           59   2e-09
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    60   3e-09
Scas_602.11                                                            60   3e-09
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    59   4e-09
Kwal_26.8941                                                           59   4e-09
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    59   4e-09
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    59   5e-09
Scas_695.33                                                            59   5e-09
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    59   6e-09
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    58   7e-09
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    58   8e-09
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    58   9e-09
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    58   1e-08
CAGL0K01661g complement(146952..148400) some similarities with t...    58   1e-08
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    58   1e-08
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    58   1e-08
KLLA0A06820g complement(615686..618004) some similarities with s...    58   1e-08
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    58   1e-08
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    57   1e-08
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    57   2e-08
Kwal_27.11542                                                          57   2e-08
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    57   2e-08
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    57   2e-08
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    57   2e-08
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    57   2e-08
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    57   2e-08
CAGL0M08360g complement(833220..835520) some similarities with s...    57   2e-08
Kwal_56.23841                                                          57   2e-08
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    57   2e-08
Kwal_33.14167                                                          57   3e-08
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    56   3e-08
Scas_677.18                                                            57   3e-08
Scas_573.10                                                            56   3e-08
Scas_721.46                                                            55   3e-08
Scas_582.1                                                             56   4e-08
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    56   4e-08
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    56   4e-08
Kwal_55.21900                                                          56   4e-08
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    55   4e-08
Scas_544.6                                                             56   5e-08
Scas_713.38                                                            55   5e-08
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    55   5e-08
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    56   6e-08
Scas_673.34*                                                           55   7e-08
Scas_610.7                                                             55   7e-08
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    55   8e-08
Scas_568.9*                                                            54   8e-08
YJR059W (PTK2) [2953] chr10 (545701..548157) Serine/threonine pr...    55   9e-08
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    55   9e-08
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    55   9e-08
Kwal_14.2497                                                           55   9e-08
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    54   1e-07
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    55   1e-07
Kwal_56.24584                                                          54   1e-07
Kwal_33.14192                                                          55   1e-07
Scas_718.90                                                            55   1e-07
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    54   1e-07
Scas_667.18                                                            54   1e-07
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    54   2e-07
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    54   2e-07
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    54   2e-07
Scas_635.1                                                             54   2e-07
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    54   2e-07
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    54   2e-07
Kwal_33.13681                                                          54   2e-07
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    54   2e-07
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    54   2e-07
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    53   2e-07
Scas_678.24                                                            54   2e-07
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    54   2e-07
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    53   2e-07
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    53   3e-07
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    54   3e-07
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    54   3e-07
KLLA0B06501g complement(576636..579089) some similarities with s...    54   3e-07
Scas_601.6                                                             53   4e-07
Kwal_55.22001                                                          52   4e-07
Scas_689.24                                                            53   4e-07
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    53   4e-07
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    53   4e-07
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    52   5e-07
Scas_648.17                                                            52   5e-07
Kwal_26.8347                                                           53   5e-07
Kwal_27.11830                                                          53   5e-07
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    53   5e-07
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    53   5e-07
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    53   5e-07
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    53   5e-07
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    52   5e-07
Kwal_33.14081                                                          52   5e-07
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    53   5e-07
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    52   6e-07
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    52   6e-07
Scas_633.29                                                            52   6e-07
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    52   7e-07
Scas_680.20                                                            52   7e-07
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    52   8e-07
Scas_707.3                                                             52   9e-07
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    52   9e-07
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    51   9e-07
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    52   9e-07
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    52   1e-06
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    52   1e-06
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    51   1e-06
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    52   1e-06
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    52   1e-06
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    51   1e-06
Kwal_27.11919                                                          50   1e-06
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    51   1e-06
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    51   1e-06
Kwal_55.20221                                                          52   1e-06
Kwal_47.17868                                                          51   1e-06
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    51   1e-06
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    51   1e-06
Scas_584.8                                                             52   1e-06
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    50   2e-06
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    51   2e-06
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    50   2e-06
Kwal_14.2554                                                           51   2e-06
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    50   2e-06
Scas_688.14                                                            50   2e-06
Kwal_17.2687                                                           50   2e-06
Kwal_14.1159                                                           51   2e-06
Scas_683.12                                                            50   2e-06
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    50   2e-06
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    51   3e-06
Scas_568.13                                                            50   3e-06
CAGL0G01716g complement(155248..156390) similar to tr|Q06098 Sac...    50   3e-06
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    50   3e-06
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    50   3e-06
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    50   3e-06
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    50   3e-06
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    50   4e-06
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    50   5e-06
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    49   5e-06
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    49   5e-06
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    50   5e-06
Kwal_55.21709                                                          49   5e-06
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    50   5e-06
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    49   5e-06
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    49   5e-06
Kwal_27.11803                                                          48   5e-06
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    49   5e-06
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    49   6e-06
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    49   7e-06
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    49   8e-06
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    49   8e-06
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    49   8e-06
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    49   8e-06
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    49   9e-06
Scas_649.30                                                            49   1e-05
Scas_623.11                                                            48   1e-05
YHR079C (IRE1) [2368] chr8 complement(258245..261592) Protein ki...    49   1e-05
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    48   1e-05
Kwal_33.13984                                                          48   1e-05
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    48   1e-05
Kwal_47.18098                                                          47   2e-05
Scas_716.33                                                            48   2e-05
Scas_705.23                                                            48   2e-05
YLL019C (KNS1) [3399] chr12 complement(105685..107898) Serine/th...    48   2e-05
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    48   2e-05
Kwal_23.3992                                                           48   2e-05
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    47   2e-05
Scas_651.3                                                             48   2e-05
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    47   2e-05
Kwal_23.5576                                                           47   2e-05
Scas_713.21                                                            47   2e-05
Scas_634.5                                                             47   3e-05
Scas_698.37                                                            47   3e-05
Scas_707.7                                                             46   4e-05
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    47   4e-05
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    46   5e-05
CAGL0K11990g complement(1155395..1158370) some similarities with...    47   5e-05
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    46   5e-05
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    46   5e-05
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    45   8e-05
KLLA0C16577g complement(1451181..1452695) some similarities with...    45   8e-05
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    45   8e-05
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    45   9e-05
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    45   1e-04
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    45   1e-04
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    45   1e-04
Kwal_33.14554                                                          45   1e-04
Kwal_27.11777                                                          45   1e-04
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    45   1e-04
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    45   1e-04
YJL057C (YJL057C) [2854] chr10 complement(328034..330037) Probab...    45   1e-04
Scas_654.12                                                            45   1e-04
Kwal_14.1249                                                           44   2e-04
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    44   2e-04
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    44   3e-04
Scas_704.50                                                            44   3e-04
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    44   3e-04
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    44   3e-04
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    44   3e-04
Scas_683.6                                                             43   4e-04
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    44   4e-04
CAGL0F03905g complement(377962..380088) similar to sp|Q03656 Sac...    44   4e-04
Scas_721.61                                                            43   4e-04
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    43   4e-04
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    43   4e-04
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    43   6e-04
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    42   6e-04
Scas_690.12                                                            43   6e-04
Kwal_33.13225                                                          43   6e-04
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    42   6e-04
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...    42   7e-04
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    42   7e-04
Kwal_27.10945                                                          43   8e-04
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    42   9e-04
Scas_661.27                                                            42   0.001

>CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces
           cerevisiae YKL116c, hypothetical start
          Length = 538

 Score = 1098 bits (2839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/530 (100%), Positives = 530/530 (100%)

Query: 1   MSEQYLHNDPKTPRIPQTGFDIPEGTMTGFNGTSEGNTSVAGSIDELTSRDTNVSEFGAS 60
           MSEQYLHNDPKTPRIPQTGFDIPEGTMTGFNGTSEGNTSVAGSIDELTSRDTNVSEFGAS
Sbjct: 1   MSEQYLHNDPKTPRIPQTGFDIPEGTMTGFNGTSEGNTSVAGSIDELTSRDTNVSEFGAS 60

Query: 61  VPDITMNTEVGADETEDVKVVTPLSVSIPTFENVATLPTPMVYSPMSPAVLNKSPQAIKS 120
           VPDITMNTEVGADETEDVKVVTPLSVSIPTFENVATLPTPMVYSPMSPAVLNKSPQAIKS
Sbjct: 61  VPDITMNTEVGADETEDVKVVTPLSVSIPTFENVATLPTPMVYSPMSPAVLNKSPQAIKS 120

Query: 121 TEMKINIPKRRAQYKPNLDGLIGSKPIRIISEVVPTPDTAQQRVISLPTVSEETTTENDK 180
           TEMKINIPKRRAQYKPNLDGLIGSKPIRIISEVVPTPDTAQQRVISLPTVSEETTTENDK
Sbjct: 121 TEMKINIPKRRAQYKPNLDGLIGSKPIRIISEVVPTPDTAQQRVISLPTVSEETTTENDK 180

Query: 181 FPIHHDGTALADDSNSQEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQN 240
           FPIHHDGTALADDSNSQEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQN
Sbjct: 181 FPIHHDGTALADDSNSQEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQN 240

Query: 241 DPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGV 300
           DPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGV
Sbjct: 241 DPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGV 300

Query: 301 NDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEI 360
           NDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEI
Sbjct: 301 NDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEI 360

Query: 361 LLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPD 420
           LLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPD
Sbjct: 361 LLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPD 420

Query: 421 ELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLPGASIRQKNR 480
           ELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLPGASIRQKNR
Sbjct: 421 ELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLPGASIRQKNR 480

Query: 481 PTAHRIARFEWKWHKMIEDDSSAKEIVNNTLTRKNQRWNCNDIFNSAFIQ 530
           PTAHRIARFEWKWHKMIEDDSSAKEIVNNTLTRKNQRWNCNDIFNSAFIQ
Sbjct: 481 PTAHRIARFEWKWHKMIEDDSSAKEIVNNTLTRKNQRWNCNDIFNSAFIQ 530

>Scas_721.132
          Length = 584

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/477 (55%), Positives = 347/477 (72%), Gaps = 16/477 (3%)

Query: 68  TEVGADETEDVKV----VTPLSVSIPTFENVATLPTPMVYSPMSPAVLNKSP-QAIKSTE 122
           TE G +  +D +      TPLS++IPTF+NV TLPTPM Y+P+SPA L+ SP +  K  +
Sbjct: 102 TEAGEENEDDSQQQQEETTPLSLTIPTFDNVQTLPTPMTYTPLSPAGLSLSPIKDQKQPD 161

Query: 123 MKINIPKRRAQYKP----NLDGLIGSKPIRIISEVVPTPDTAQQRVISLPTVSEET--TT 176
             + I K+RA   P     LD ++     R+ISE++P P   QQRV+SLPTV+EE   + 
Sbjct: 162 QPLQIKKKRAHGSPRIGGGLDSVLLESQQRVISELIPAPSFQQQRVVSLPTVNEEPIPSF 221

Query: 177 ENDKFPIHHDGTALADDSNSQEDDIVLMGYRIGEYTKA--LQWRKVKTIGVGNFSDVLLY 234
           E D  P     T +    N  E    L+GY +    KA  L+W+KVK IG GNFSDVLLY
Sbjct: 222 EPDIIPKEFAHTNIDTFDNHAES--TLVGYPLQHLDKAHVLRWKKVKKIGEGNFSDVLLY 279

Query: 235 ESIDQNDPELLQVAVKRIRYPQELKDIRNR-SANFDELLGRLDNSLTREISVLNSLNHPC 293
           ES+DQ DP+++Q+AVKRI+YP E+ DI  R +  +++ L RL++SLTRE+ VL  L++PC
Sbjct: 280 ESLDQTDPKMMQIAVKRIKYPVEVTDITFRGTPQYNDTLSRLESSLTRELGVLKLLDYPC 339

Query: 294 IVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLI 353
           IVKL+G+N+P+F++S  PL D+L     L PC++IMSYC GGDLLAA+S+C G LD WLI
Sbjct: 340 IVKLYGINNPIFVQSKTPLRDLLAKNPALPPCDMIMSYCSGGDLLAAISRCLGELDIWLI 399

Query: 354 QRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGL 413
           QRLFTE+++ V YLH++NIIHRDLKLENILLK PL +I +LKD  ++   + +E+ADFGL
Sbjct: 400 QRLFTELVMAVNYLHDNNIIHRDLKLENILLKYPLEHIIALKDSPVFTSLNMIELADFGL 459

Query: 414 CKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLPGA 473
           CK+I+P ELCTARCGSEDYVSPEILMGVPYDGHL+DTWA+GVILYS+LEDRLPFDP P A
Sbjct: 460 CKQIQPGELCTARCGSEDYVSPEILMGVPYDGHLTDTWALGVILYSILEDRLPFDPPPNA 519

Query: 474 SIRQKNRPTAHRIARFEWKWHKMIEDDSSAKEIVNNTLTRKNQRWNCNDIFNSAFIQ 530
           + RQ+NR T+HRIARF+W W ++   +  AKEIV NTLTRKNQRW+   I  S F++
Sbjct: 520 TSRQRNRATSHRIARFDWHWFRLANTELDAKEIVANTLTRKNQRWDIKQIMESIFVK 576

>YKL116C (PRR1) [3148] chr11 complement(220990..222546)
           Serine/threonine protein kinase potentially involved in
           pheromone response, has similarity to S. pombe Nim1p
           [1557 bp, 518 aa]
          Length = 518

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/537 (50%), Positives = 368/537 (68%), Gaps = 46/537 (8%)

Query: 6   LHNDPKTPRIPQTGFDIPEGTMTGFNGTSEGNTSVAGSIDELTSRDTNVSEFGASVPDIT 65
           +++ PKTPR+ Q GF  P+         S G+      IDE    D  ++    +  D  
Sbjct: 7   IYSQPKTPRLKQEGF--PD---------SIGDQHEKALIDENGEEDKKMASTEGTTGD-- 53

Query: 66  MNTEVGADETEDVKVVTPLSVSIPTFENVATLPTPMVYSPMSPAVLNKSPQAIKSTEMKI 125
                           TPL+VSIPTFENV  LPTPM Y+P+SP  L+ SP    S    +
Sbjct: 54  -------------SRSTPLTVSIPTFENVQALPTPMTYTPLSPGNLSMSPIDQSS----L 96

Query: 126 NIPKRRAQYKPNLDGLIGSKP-IRIISEVVPTPDTAQQRVISLPTVSEET----TTENDK 180
           NIPKRR+  +   D L  ++P  R++SE++   + + QRV+SLPTV+EE     + ++D 
Sbjct: 97  NIPKRRSHARLLDDMLSVTQPNQRVVSELIAPANLSPQRVVSLPTVTEEALVNDSVDSDN 156

Query: 181 F---PIHHDGTALADDSNSQEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESI 237
           +   P   + ++    S  + DD +  G+ +  + + L W+KV+ IG GNFS VLLYE +
Sbjct: 157 YTKEPYFPESSS----STEKCDDDIFQGFLLDHWDRPLLWKKVRPIGSGNFSTVLLYELM 212

Query: 238 DQNDPELLQVAVKRIRYPQELKDIR--NRSANFDELLGRLDNSLTREISVLNSLNHPCIV 295
           DQ++P+L QVAVKR++YP+EL ++   N S  + E L RL+NSLTRE+ VL SLNHPCIV
Sbjct: 213 DQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIV 272

Query: 296 KLFGVNDPLFIESCRPLYDML-KLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQ 354
           KL G+N+P+F+ S +PL D++ K  + L PC++IMSYC  GDLLAA+   +G L+ WLIQ
Sbjct: 273 KLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQ 332

Query: 355 RLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLC 414
           R+FTE++L VKYLHE++IIHRDLKLENILLK    +I S +D  IY + +F+E+ADFGLC
Sbjct: 333 RIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLC 392

Query: 415 KKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLPGAS 474
           KKIE +E+CTARCGSEDYVSPEILMGVPYDGHLSDTWA+GVILYSL EDRLPFDP P AS
Sbjct: 393 KKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNAS 452

Query: 475 IRQKNRPTAHRIARFEWKWHKMIEDDSS-AKEIVNNTLTRKNQRWNCNDIFNSAFIQ 530
            RQ++R T+HRIARF+W+W+++ +  ++  K+IV NTLTRKNQRW+ N+I+ S F++
Sbjct: 453 ARQRSRATSHRIARFDWRWYRLSDYKTNVGKQIVENTLTRKNQRWSINEIYESPFVK 509

>Kwal_26.7682
          Length = 518

 Score =  415 bits (1066), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 231/499 (46%), Positives = 308/499 (61%), Gaps = 37/499 (7%)

Query: 61  VPDITMNTEVGADETEDVKV-----VTPLSVSIPTFEN--VATLPTPMVYSPMSPAVLNK 113
            P +  N     +E++ + V      TP  +S   F +  +  LPTP+VY+P SP V  +
Sbjct: 16  APKLRQNEFPALEESDSIAVSQQFATTPPKLSTSQFVDGGMNMLPTPLVYTPCSPGVAAR 75

Query: 114 SPQAIK----STEMKINIPKRRAQYKP------NLDGLIGSKPIRIISEVVP-------T 156
           SP   K     +   I   K     +P      N   ++  K  R++SE  P       T
Sbjct: 76  SPLEAKFSMTPSSSAIRSKKGYGGLQPPSAESFNRSHVLEDKQ-RMLSEYAPHSALAPAT 134

Query: 157 PDTAQQRVISLPTVSE--ETTTENDKFPIHHDGTALADDSNSQEDDIVLMGYRIGEYTKA 214
             T  QR+ SL  V +  +   E      HH G+    +  +QE    L G+ + + + A
Sbjct: 135 ASTLSQRISSLSGVDQKLDVVYEPPTSAAHHVGSQHIIEPEAQE---TLTGFALHDTSHA 191

Query: 215 LQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQEL-KDIRNRSANFDELLG 273
           LQWRKV+ IGVGNFSDV LYES++Q    L +VAVK ++YP+ L +    +S  F ELL 
Sbjct: 192 LQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSSPKSPRFRELLS 251

Query: 274 RLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCV 333
           RL++SLTREI  L+ + HPCI+ L  +ND  F+ S RPL     L + L PC++IMSYC 
Sbjct: 252 RLESSLTREIEALSGIWHPCIIHLHAINDLTFLNSPRPLSSR-DLTRGLPPCDMIMSYCA 310

Query: 334 GGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRS 393
           GGDL    SQ    L  WL++R+F E+ LGVKYLHE+ I+HRDLKLEN+L+K PL +I +
Sbjct: 311 GGDLFELASQ--NTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILA 368

Query: 394 LKD-KDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWA 452
           + + +++  +   VE+ADFGLC++IEPDE+CT RCGSEDYVSPEILMGVPYDG LSD+WA
Sbjct: 369 MHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWA 428

Query: 453 MGVILYSLLEDRLPFDPLPGAS--IRQKNRPTAHRIARFEWKWHKMIEDDSSAKEIVNNT 510
           MGVILY+LLEDRLPFDPLP A+   RQ+   TAHRI+RFEW+W KM E +  AKEIV N 
Sbjct: 429 MGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYPAKEIVENC 488

Query: 511 LTRKNQRWNCNDIFNSAFI 529
           LTRKN R N   I+ + ++
Sbjct: 489 LTRKNIRCNIEKIYENPYV 507

>Scas_336.1
          Length = 486

 Score =  400 bits (1027), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 219/483 (45%), Positives = 300/483 (62%), Gaps = 45/483 (9%)

Query: 82  TPLSVSIPTF--ENVATLPTPMVYSPMSPAVLNKSPQAIKSTEMKINIPKRRAQYKPNLD 139
           TP  ++IP+F   +V  LPTPM Y P SP  L +SP      +  + IPK+R      +D
Sbjct: 7   TPPMLTIPSFVDTDVNLLPTPMTYGPHSPVCL-RSP----VDQHPLFIPKKRIVPDKKVD 61

Query: 140 GLIGSKPI-----------------RIISEVVPTPD---------TAQQRVISLPTVSEE 173
             + S  +                 RIISE VP            +  QRV SLP V E 
Sbjct: 62  NALKSDLLATSTTLDVNQAGTNTKTRIISEYVPHSSRNTVVAHAASRAQRVASLPGVDEN 121

Query: 174 TTTENDKFPIHHDGTALADDSNSQEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLL 233
              + +      +       S + + D+ + GY I    + ++ +K+K IG GNFSDV L
Sbjct: 122 LEIKLES----QEANKSKGHSVTFDQDLTITGYDIDHPGETVKLKKIKLIGSGNFSDVYL 177

Query: 234 YESIDQNDPELLQVAVKRIRYPQELKDIRN-RSANFDELLGRLDNSLTREISVLNSLNHP 292
           YE++ ++     QVAVK IRYP EL +  N  S ++ + L RL++SLTRE+ VL S++HP
Sbjct: 178 YEALGESRSHFAQVAVKHIRYPSELVNAPNPDSPSYKDTLSRLESSLTRELDVLKSISHP 237

Query: 293 CIVKLFGVNDPLFIESCRPLYDMLKLRQKLVP-CNLIMSYCVGGDLLAAMSQCSGNLDRW 351
           CI+KL+ +ND  F E+ RPL       +  +P C+++MSYC GGDL    S+   NL +W
Sbjct: 238 CIIKLYAINDLKFFETKRPLSSRKHGDKGFLPPCDMVMSYCSGGDLFDMASK--NNLPQW 295

Query: 352 LIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADF 411
           LIQR+F E+ +G+KYLHE+ IIHRDLKLEN+LLK+PL  I ++KD  ++   + +E+ DF
Sbjct: 296 LIQRIFAELTMGMKYLHENLIIHRDLKLENVLLKLPLEQILAMKDVPLFKRQNLIELGDF 355

Query: 412 GLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLP 471
           GLCKKI+PDE+CT RCGSEDYVSPEILMG+PYDG LSD WA+GVILY+LLEDRLPFDPLP
Sbjct: 356 GLCKKIQPDEMCTTRCGSEDYVSPEILMGLPYDGRLSDAWALGVILYALLEDRLPFDPLP 415

Query: 472 --GASIRQKNRPTAHRIARFEWKWHKMIED--DSSAKEIVNNTLTRKNQRWNCNDIFNSA 527
              +  R++ R TAHRIAR+EW+W K++ D    +AKEIV + L RK +RW+   I  S 
Sbjct: 416 SHASHTRKRPRSTAHRIARYEWRWVKLLNDTEQEAAKEIVEHCLVRKIERWDIFKISQST 475

Query: 528 FIQ 530
           +++
Sbjct: 476 YVK 478

>KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces
           cerevisiae YKL116c, hypothetical start
          Length = 541

 Score =  362 bits (929), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 220/518 (42%), Positives = 293/518 (56%), Gaps = 56/518 (10%)

Query: 62  PDITMNTEVGADETEDVKVVTPLSVSIPTFE--NVATLPTPMVYSPMSPAVLNKSPQAIK 119
           P +      G D    VK   P   S    E  +V  LPTP      SP  +NKSP    
Sbjct: 18  PKLAQREFAGGDAESSVKNQLPEINSSLNREAIDVGMLPTPTANVFTSPVRVNKSPGGF- 76

Query: 120 STEMKINIPKRRAQYKPNLDGL---------------------IGSK---------PIRI 149
             +  + + KRR +   +  G+                     +G+            R+
Sbjct: 77  --DAGLQVEKRRNKDSASNSGVPSPTISSVDTHEEVLDEELSKLGTYMNRDVTHKIKGRM 134

Query: 150 ISEVVP-------TPDTAQQRVISLPTVSEETTTENDKFPIHHDGTALADDSNSQE--DD 200
           +SE +P       +   A QR ISL     E  +   +  I+   T++  D  +++  D 
Sbjct: 135 LSEYIPNNSMGDGSGGVAVQRSISLNNRVVEKPSLKKETIINEVITSVPSDKENEQKADG 194

Query: 201 IVLMGYRIGEYTK-ALQWRKVKTIGVGNFSDVLLYESIDQN-----DPELLQVAVKRIRY 254
            ++ GY        + QW K+K IG GNFS V LYE ID N     +PEL  VAVK I+Y
Sbjct: 195 TIIRGYMANTPNHISFQWSKIKEIGSGNFSTVYLYECIDDNLNINLNPELKYVAVKSIKY 254

Query: 255 PQEL-KDIRNRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLY 313
           P+EL       S  + ELL R+ +SL RE++ L S++HPCIVKLF +ND  FI    PLY
Sbjct: 255 PRELLMSSSPSSPKYKELLSRVVSSLKRELTTLISVHHPCIVKLFAINDTTFITDEHPLY 314

Query: 314 DMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNII 373
              KL   L  C++IMSYC GGDL    S+    +  WL+ R+ TE+ + +KYLH++ II
Sbjct: 315 GRRKL-SALPRCDMIMSYCTGGDLFDLASKTK--IPNWLLTRIITELSVAIKYLHDNFII 371

Query: 374 HRDLKLENILLKVPLGNIRSLK-DKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDY 432
           HRD+KLEN+LLK  L ++  LK D+  ++  +FVE+ADFGLCKKI PDE+CT RCGSEDY
Sbjct: 372 HRDIKLENVLLKYTLDDMMLLKEDESQFFSKNFVELADFGLCKKITPDEMCTTRCGSEDY 431

Query: 433 VSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLPGASIRQKNRPTAHRIARFEWK 492
           VSPEIL+G+PYDG +SD WA GVI Y+LLEDRLPFDPLPG S R + R  AHRIAR +WK
Sbjct: 432 VSPEILLGLPYDGRISDAWAFGVITYALLEDRLPFDPLPGQSSR-RTRSIAHRIARCDWK 490

Query: 493 WHKMIEDDSSAKEIVNNTLTRKNQRWNCNDIFNSAFIQ 530
           W K  + D  AKEIV NTL RK++RWN + + N+ +I+
Sbjct: 491 WLKNADTDHPAKEIVQNTLVRKSERWNMDQLCNTPYIR 528

>ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH]
           (295497..297107) [1611 bp, 536 aa]
          Length = 536

 Score =  359 bits (921), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 189/385 (49%), Positives = 255/385 (66%), Gaps = 22/385 (5%)

Query: 161 QQRVISLPTVSEETTTENDKFPIHHDG--TALAD-----DSNSQEDDIV---LMGYRIGE 210
           + RV+SLP +  E   +      H++G  T L D     D+ +  + +    L G+ +  
Sbjct: 147 RARVVSLPGIESEGDQQGSACVTHNNGEPTVLQDATGGSDAAATRNGMAEDKLTGFILPN 206

Query: 211 YTKALQWRKVKTIGVGNFSDVLLYE--SIDQNDPELLQVAVKRIRYPQELKDIRNRSA-N 267
               L WR VK +G GNFSDV LYE  S    + +  QVAVK  RYP EL++ + R+A  
Sbjct: 207 LNSQLSWRLVKLVGSGNFSDVYLYENTSASSTEEKFQQVAVKVTRYPAELQNPQARTATK 266

Query: 268 FDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNL 327
           + E+L RL++SLTRE++VL SL++PCIVKL+G+ND  F+ES RPL D +     L  C +
Sbjct: 267 YKEMLSRLESSLTRELAVLRSLDYPCIVKLYGINDCSFLESRRPLIDHIN-EPSLPSCKM 325

Query: 328 IMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVP 387
           IMSYC GGD+L    +  G L  WL+QR+FTE+   V YLHE+ +IHRDLKLEN+LLK P
Sbjct: 326 IMSYCFGGDVLDVAKR--GLLPDWLLQRVFTELAHAVLYLHENLVIHRDLKLENVLLKYP 383

Query: 388 LGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHL 447
           L  + S+++    +  +F+E+ADFGLCK+I  +ELCT RCGSEDY+SPE+LMG+PYDG L
Sbjct: 384 LEQLLSMRED---FSCNFIELADFGLCKRIRQNELCTTRCGSEDYISPEVLMGLPYDGRL 440

Query: 448 SDTWAMGVILYSLLEDRLPFDPLPGASIRQKNRP--TAHRIARFEWKWHKMIEDDSSAKE 505
            DTWA+GVILY+LLEDRLPFDPLP    R  NRP  TAHRIAR+EW+W ++I ++  AK 
Sbjct: 441 CDTWALGVILYALLEDRLPFDPLPLQGWR-GNRPRSTAHRIARYEWRWLRLINNNHHAKV 499

Query: 506 IVNNTLTRKNQRWNCNDIFNSAFIQ 530
           IV   L  +  RW+  DI  + F++
Sbjct: 500 IVEKCLVTRQHRWSIKDITEADFVR 524

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score =  124 bits (312), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 128/267 (47%), Gaps = 49/267 (18%)

Query: 203 LMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIR 262
           L G RIG       W+  +T+G G+   VLL ++ +      ++V  K +   Q    + 
Sbjct: 11  LRGDRIG------PWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVG 64

Query: 263 NRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKL 322
           +   +       L   + REI ++  LNHP +++L+ V      E+ + LY         
Sbjct: 65  SNDPDV------LPYGIEREIIIMKLLNHPNVLRLYDV-----WETAQDLY--------- 104

Query: 323 VPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENI 382
               +++ Y   G+L   + Q  G L      R F +I++G+ Y H   I+HRDLK EN+
Sbjct: 105 ----MVLEYVEKGELFNLLVQ-RGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENL 159

Query: 383 LLKVPLGNIRSLKDKDIYYEHSF-VEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGV 441
           LL                 +H F +++ADFG+      D+L    CGS  Y +PEI+ G+
Sbjct: 160 LL-----------------DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGL 202

Query: 442 PYDGHLSDTWAMGVILYSLLEDRLPFD 468
           PY G  SD W+ GVILY+LL  RLPFD
Sbjct: 203 PYHGFESDVWSCGVILYALLTGRLPFD 229

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score =  124 bits (311), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 83/256 (32%), Positives = 125/256 (48%), Gaps = 41/256 (16%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLD 276
           W+  +T+G G+   VLL      N+    Q AVK I   + + +  N S +  +    L 
Sbjct: 20  WKLGETLGSGSTGKVLLA----SNETTKQQAAVKVI--SKAVFEAMNNSESNGDATNALP 73

Query: 277 NSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGD 336
            ++ +EI ++  LNHP +++LF V      E+   LY             L++ Y   G+
Sbjct: 74  YNIEQEIIIMKLLNHPNVLRLFDV-----WETNSDLY-------------LVLEYAEKGE 115

Query: 337 LLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKD 396
           L   + +  G L      R F +I++G+ Y H   ++HRDLK EN+LL   L        
Sbjct: 116 LFNMLVE-RGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLN------- 167

Query: 397 KDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVI 456
                    ++IADFG+      D+L    CGS  Y +PEI+ G+PY+G  SD W+ GVI
Sbjct: 168 ---------IKIADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVI 218

Query: 457 LYSLLEDRLPFDPLPG 472
           L++LL  RLPFD   G
Sbjct: 219 LFALLTGRLPFDEEDG 234

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score =  123 bits (308), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 127/262 (48%), Gaps = 53/262 (20%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLD 276
           W+   T+GVG+   V++      N+ +  Q AVK I      K I N  A    ++G  D
Sbjct: 17  WKLGSTLGVGSTGKVVMA----YNETKGQQAAVKIIS-----KSIFN--AQGSTMIGGND 65

Query: 277 -----NSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSY 331
                  + REI ++  LNHP +++L+ V      E+ + LY             +++ Y
Sbjct: 66  PDVLPYGIEREIIIMKLLNHPNVLRLYDV-----WETSKDLY-------------MVLEY 107

Query: 332 CVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNI 391
              G+L   + +  G L      R F +I++G+ Y H   I+HRDLK EN+LL       
Sbjct: 108 VEKGELFNLLVE-RGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLL------- 159

Query: 392 RSLKDKDIYYEHSF-VEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDT 450
                     +H F V++ADFG+      D+L    CGS  Y +PEI+ G+PY G  SD 
Sbjct: 160 ----------DHKFNVKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDV 209

Query: 451 WAMGVILYSLLEDRLPFDPLPG 472
           W+ GVILY+LL  RLPFD   G
Sbjct: 210 WSCGVILYALLTGRLPFDEEDG 231

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score =  119 bits (297), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 84/271 (30%), Positives = 129/271 (47%), Gaps = 54/271 (19%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANF-------- 268
           W+  KT+G G+   V L ++I+      +++  KR  Y + ++D + ++A          
Sbjct: 93  WKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRT-YNRRMRDQKMKTAGGVSSGTDSK 151

Query: 269 ------DELLGRLDNSLT-----REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLK 317
                 D +    D++L      REI ++  ++HP ++ L  V      E+   LY    
Sbjct: 152 DSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLLEV-----WENKSELY---- 202

Query: 318 LRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDL 377
                    L++ Y  GG+L   +    G L        FT+I+ GV Y H  NI HRDL
Sbjct: 203 ---------LVLEYVDGGELFDYLV-SKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDL 252

Query: 378 KLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEI 437
           K EN+LL           DK    ++  ++IADFG+     P++L    CGS  Y SPEI
Sbjct: 253 KPENLLL-----------DK----KNKVIKIADFGMAALELPNKLLETSCGSPHYASPEI 297

Query: 438 LMGVPYDGHLSDTWAMGVILYSLLEDRLPFD 468
           +MG PY G  SD W+ G+IL++LL   LPF+
Sbjct: 298 VMGKPYHGGPSDVWSCGIILFALLTGHLPFN 328

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score =  115 bits (289), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 126/268 (47%), Gaps = 65/268 (24%)

Query: 204 MGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRN 263
           +G RIG+Y      + +KT+G G+F  V L   +       L++  K++    +++    
Sbjct: 32  IGQRIGKY------QVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQ---- 81

Query: 264 RSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLV 323
                    GR++    REIS L  L HP I+KL               YD++K + +++
Sbjct: 82  ---------GRIE----REISYLRLLRHPHIIKL---------------YDVIKSKDEII 113

Query: 324 PCNLIMSYCVGGDLLAAMSQ---CSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLE 380
              +++ Y  G +L   + Q    S N  R    R F +I+  V+Y H H I+HRDLK E
Sbjct: 114 ---MVIEYA-GNELFDYIVQRDKMSENEAR----RFFQQIISAVEYCHRHKIVHRDLKPE 165

Query: 381 NILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMG 440
           N+LL                 EH  V+IADFGL   +         CGS +Y +PE++ G
Sbjct: 166 NLLLD----------------EHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISG 209

Query: 441 VPYDGHLSDTWAMGVILYSLLEDRLPFD 468
             Y G   D W+ GVILY +L  RLPFD
Sbjct: 210 KLYAGPEVDVWSSGVILYVMLCRRLPFD 237

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  115 bits (288), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 123/264 (46%), Gaps = 59/264 (22%)

Query: 205 GYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNR 264
           G R+G Y      + VKT+G G+F  V L   +       L++  K++    +++     
Sbjct: 33  GSRVGNY------QIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQ----- 81

Query: 265 SANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVP 324
                   GR++    REIS L  L HP I+KL               YD++K + +++ 
Sbjct: 82  --------GRIE----REISYLRLLRHPHIIKL---------------YDVIKSKDEII- 113

Query: 325 CNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILL 384
             +++ Y  G +L   + Q    +     +R F +I+  V+Y H H I+HRDLK EN+LL
Sbjct: 114 --MVIEYA-GNELFDYIVQ-RNKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLL 169

Query: 385 KVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYD 444
                            EH  V+IADFGL   +         CGS +Y +PE++ G  Y 
Sbjct: 170 D----------------EHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYA 213

Query: 445 GHLSDTWAMGVILYSLLEDRLPFD 468
           G   D W+ GVILY +L  RLPFD
Sbjct: 214 GPEVDVWSCGVILYVMLCRRLPFD 237

>Scas_493.2
          Length = 1117

 Score =  115 bits (289), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 126/265 (47%), Gaps = 56/265 (21%)

Query: 217 WRKVKTIGVGNFSDVLLY--ESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDE--LL 272
           W+  +T+G+G+   V L   E+ +Q      Q A+K I      K I N   N +E  ++
Sbjct: 22  WKLGETLGLGSTGKVQLAFNETTNQ------QAAIKIIS-----KSIFNTKPNSNETSMV 70

Query: 273 GRLDNSL----TREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLI 328
               +SL     REI ++  L H  ++ L+ V      E+   LY             +I
Sbjct: 71  ANTPDSLPYGIEREIIIMKLLRHANVLSLYDV-----WETNSNLY-------------MI 112

Query: 329 MSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPL 388
           + Y   G+L   + +  G L      R F +I++G+ Y H   I+HRDLK EN+LL    
Sbjct: 113 LEYAEKGELFNLLVE-KGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLL---- 167

Query: 389 GNIRSLKDKDIYYEHSF-VEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHL 447
                        +H F ++IADFG+      D+L    CGS  Y +PEI+ G+PY G  
Sbjct: 168 -------------DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFE 214

Query: 448 SDTWAMGVILYSLLEDRLPFDPLPG 472
           SD W+ GVIL++LL  RLPFD   G
Sbjct: 215 SDVWSCGVILFALLTGRLPFDEEDG 239

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score =  115 bits (287), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 98/195 (50%), Gaps = 37/195 (18%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLL 338
           + REI ++  LNHP +++L+ V      E+   LY             L++ Y   G+L 
Sbjct: 78  IEREIIIMKLLNHPNVLRLYDV-----WETNTDLY-------------LVLEYAEKGELF 119

Query: 339 AAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKD 398
             + +  G L      R F +I++GV Y H   I+HRDLK EN+LL              
Sbjct: 120 NLLVE-RGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLL-------------- 164

Query: 399 IYYEHSF-VEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVIL 457
              +H + ++IADFG+       +L    CGS  Y +PEI+ G+PY G  SD W+ GVIL
Sbjct: 165 ---DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVIL 221

Query: 458 YSLLEDRLPFDPLPG 472
           ++LL  RLPFD   G
Sbjct: 222 FALLTGRLPFDEEDG 236

>Scas_660.28
          Length = 623

 Score =  113 bits (283), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 122/264 (46%), Gaps = 59/264 (22%)

Query: 205 GYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNR 264
           G  IG Y      + VKT+G G+F  V L   +       L++  K++    +++     
Sbjct: 40  GSHIGNY------QIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQ----- 88

Query: 265 SANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVP 324
                   GR++    REIS L  L HP I+KL               YD++K + +++ 
Sbjct: 89  --------GRIE----REISYLRLLRHPHIIKL---------------YDVIKSKDEII- 120

Query: 325 CNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILL 384
             ++M Y  G +L   + Q    +     +R F +I+  V+Y H H I+HRDLK EN+LL
Sbjct: 121 --MVMEYA-GNELFDYIVQ-RDKMSEDEARRFFQQIISAVEYCHRHKIVHRDLKPENLLL 176

Query: 385 KVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYD 444
                            EH  V+IADFGL   +         CGS +Y +PE++ G  Y 
Sbjct: 177 D----------------EHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYA 220

Query: 445 GHLSDTWAMGVILYSLLEDRLPFD 468
           G   D W+ GVILY +L  RLPFD
Sbjct: 221 GPEVDVWSCGVILYVMLCRRLPFD 244

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score =  114 bits (285), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/252 (32%), Positives = 121/252 (48%), Gaps = 44/252 (17%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLD 276
           W+  +T+G G+   V L     Q++    + AVK I      K I N + N       L 
Sbjct: 21  WKLGETLGFGSTGKVQLA----QHERTGHRTAVKVIS-----KSIFNNNGNHSNDDSVLP 71

Query: 277 NSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGD 336
            ++ REI ++  L+HP ++ L+ V      E+   LY             LI+ Y   G+
Sbjct: 72  YNIEREIVIMKLLSHPNVLSLYDV-----WETNNNLY-------------LILEYAEKGE 113

Query: 337 LLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKD 396
           L   +       +R  I   F +I++G+ Y H   I+HRDLK EN+LL            
Sbjct: 114 LFNLLVDHGPLPEREAIN-CFRQIIIGISYCHALGIVHRDLKPENLLL------------ 160

Query: 397 KDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVI 456
            D +Y    ++IADFG+       +L    CGS  Y +PEI+ G+PY+G  SD W+ GVI
Sbjct: 161 -DSFYN---IKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVI 216

Query: 457 LYSLLEDRLPFD 468
           L++LL  RLPFD
Sbjct: 217 LFALLTGRLPFD 228

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score =  112 bits (280), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 122/264 (46%), Gaps = 59/264 (22%)

Query: 205 GYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNR 264
           G  IG+Y      + +KT+G G+F  V L   I       L++  K++    +++     
Sbjct: 29  GQHIGKY------QIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQ----- 77

Query: 265 SANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVP 324
                   GR++    REIS L  L HP I+KL               YD++K + +++ 
Sbjct: 78  --------GRIE----REISYLRLLRHPHIIKL---------------YDVIKSKDEII- 109

Query: 325 CNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILL 384
             +++ Y  G +L   + Q    +     +R F +I+  V Y H H I+HRDLK EN+LL
Sbjct: 110 --MVIEYA-GNELFDYIVQ-RDKMPEQEARRFFQQIISAVDYCHRHKIVHRDLKPENLLL 165

Query: 385 KVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYD 444
                            EH  V+IADFGL   +         CGS +Y +PE++ G  Y 
Sbjct: 166 D----------------EHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYA 209

Query: 445 GHLSDTWAMGVILYSLLEDRLPFD 468
           G   D W+ GVILY +L  RLPFD
Sbjct: 210 GPEVDVWSSGVILYVMLCRRLPFD 233

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score =  112 bits (280), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 121/264 (45%), Gaps = 59/264 (22%)

Query: 205 GYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNR 264
           G  IG Y      + VKT+G G+F  V L           L++  K++    +++     
Sbjct: 49  GAHIGNY------QIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQ----- 97

Query: 265 SANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVP 324
                   GR++    REIS L  L HP I+KL               YD++K + +++ 
Sbjct: 98  --------GRIE----REISYLRLLRHPHIIKL---------------YDVIKSKDEII- 129

Query: 325 CNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILL 384
             +++ Y  G +L   + Q    +     +R F +I+  V+Y H H I+HRDLK EN+LL
Sbjct: 130 --MVIEYA-GNELFDYIVQ-RDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLL 185

Query: 385 KVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYD 444
                            EH  V+IADFGL   +         CGS +Y +PE++ G  Y 
Sbjct: 186 D----------------EHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYA 229

Query: 445 GHLSDTWAMGVILYSLLEDRLPFD 468
           G   D W+ GVILY +L  RLPFD
Sbjct: 230 GPEVDVWSCGVILYVMLCRRLPFD 253

>Kwal_47.18233
          Length = 598

 Score =  112 bits (279), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 124/265 (46%), Gaps = 65/265 (24%)

Query: 207 RIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSA 266
           RIG+Y      + +KT+G G+F  V L   +       L++  K++    +++       
Sbjct: 27  RIGKY------QIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQ------- 73

Query: 267 NFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCN 326
                 GR++    REIS L  L HP I+KL               YD++K + ++V   
Sbjct: 74  ------GRIE----REISYLRLLRHPHIIKL---------------YDVVKSKDEIV--- 105

Query: 327 LIMSYCVGGDLLAAMSQ---CSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENIL 383
           +++ Y  G +L   + Q    S N  R    R F +I+  V+Y H H I+HRDLK EN+L
Sbjct: 106 MVIEYA-GNELFDYIVQRDKMSENEAR----RFFQQIISAVEYCHRHKIVHRDLKPENLL 160

Query: 384 LKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPY 443
           L                 EH  V+IADFGL   +         CGS +Y +PE++ G  Y
Sbjct: 161 LD----------------EHLNVKIADFGLSNIMTDGNFLRTSCGSPNYAAPEVISGKLY 204

Query: 444 DGHLSDTWAMGVILYSLLEDRLPFD 468
            G   D W+ GVILY +L  RLPFD
Sbjct: 205 AGPEVDVWSSGVILYVMLCRRLPFD 229

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score =  111 bits (277), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 117/253 (46%), Gaps = 48/253 (18%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKR-IRYPQELKDIRNRSANFDELLGRL 275
           W+  KT+G G+   V L +++       +++  KR +R+ Q+              +  L
Sbjct: 61  WKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQ-------------VTAL 107

Query: 276 DNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG 335
              + REI ++  + HP I+ L+ V      E+   LY             L++ Y  GG
Sbjct: 108 PYGIEREIIIMKLITHPNIMALYEV-----WENKSELY-------------LVLEYVEGG 149

Query: 336 DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLK 395
           +L   +    G L        F +I+ GV Y H  NI HRDLK EN+LL           
Sbjct: 150 ELFDYLI-ARGKLPEQEAIHYFKQIVQGVSYCHNFNICHRDLKPENLLL----------- 197

Query: 396 DKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGV 455
           DK    ++  V+IADFG+      + L    CGS  Y SPEI+MG  Y G  SD W+ G+
Sbjct: 198 DK----KNKTVKIADFGMAALETTNRLLETSCGSPHYASPEIVMGQKYHGSPSDVWSCGI 253

Query: 456 ILYSLLEDRLPFD 468
           IL++LL   LPF+
Sbjct: 254 ILFALLTGHLPFN 266

>Scas_616.10
          Length = 1461

 Score =  108 bits (269), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 95/190 (50%), Gaps = 34/190 (17%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLL 338
           + REI ++  ++HP ++ L+ V      E+   LY             L++ Y  GG+L 
Sbjct: 183 IEREIVIMKLISHPNVMALYEV-----WENKSELY-------------LVLEYVDGGELF 224

Query: 339 AAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKD 398
             +    G L        F +I+ GV Y H  NI HRDLK EN+LL           DK 
Sbjct: 225 DYLV-SKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLL-----------DK- 271

Query: 399 IYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILY 458
              ++  ++IADFG+     P++L    CGS  Y SPEI+MG  Y G  SD W+ G+IL+
Sbjct: 272 ---KNKSIKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILF 328

Query: 459 SLLEDRLPFD 468
           +LL   LPF+
Sbjct: 329 ALLTGHLPFN 338

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score =  107 bits (267), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 95/190 (50%), Gaps = 34/190 (17%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLL 338
           + REI ++  ++H  ++ LF V      E+   LY             L++ Y  GG+L 
Sbjct: 161 IEREIVIMKLISHTNVMALFEV-----WENKSELY-------------LVLEYVDGGELF 202

Query: 339 AAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKD 398
             +    G L        F +I+ GV Y H  NI HRDLK EN+LL           DK 
Sbjct: 203 DYLV-SKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLL-----------DK- 249

Query: 399 IYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILY 458
              ++  ++IADFG+     P++L    CGS  Y SPEI+MG PY G  SD W+ G++L+
Sbjct: 250 ---KNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLF 306

Query: 459 SLLEDRLPFD 468
           +LL   LPF+
Sbjct: 307 ALLTGHLPFN 316

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score =  106 bits (265), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 116/252 (46%), Gaps = 48/252 (19%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLD 276
           W+  KT+G G+   V L ++++      +++  K+     ++K              +L 
Sbjct: 73  WKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIK--------------QLP 118

Query: 277 NSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGD 336
             + REI ++  ++HP ++ L+ V      E+   LY             L++ Y  GG+
Sbjct: 119 YGIEREIIIMKLISHPNVMGLYEV-----WENKSELY-------------LVLEYVEGGE 160

Query: 337 LLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKD 396
           L   +    G L        F +I+  V Y H  NI HRDLK EN+LL           D
Sbjct: 161 LFDYLV-SKGKLPESEAIHYFKQIVQAVAYCHGFNICHRDLKPENLLL-----------D 208

Query: 397 KDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVI 456
           K    +   ++IADFG+      D+L    CGS  Y SPEI++G  Y G  SD W+ G+I
Sbjct: 209 K----KKRSIKIADFGMAALETSDKLLETSCGSPHYASPEIVLGRKYHGSPSDVWSCGII 264

Query: 457 LYSLLEDRLPFD 468
           L++LL   LPF+
Sbjct: 265 LFALLTGHLPFN 276

>Scas_693.17
          Length = 1049

 Score =  102 bits (255), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 118/267 (44%), Gaps = 51/267 (19%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQV-------------AVKRIRY--PQELKDI 261
           W  V+T+G G+   V L ++   N+   +++             A K   Y  P   K++
Sbjct: 71  WDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLSEKEV 130

Query: 262 RNRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQK 321
             R  N ++   R D    RE S+   L HP I              CR LY+M  L   
Sbjct: 131 IERQKNLEKEASR-DKRTVREASLGQILYHPHI--------------CR-LYEMHTLSNH 174

Query: 322 LVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLEN 381
                ++  Y  GG LL  + Q  G+L     +    +I   +KYLH HNI+HRDLK+EN
Sbjct: 175 FY---MLFEYVSGGQLLDYIIQ-HGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIEN 230

Query: 382 ILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGV 441
           I++          KD +I       ++ DFGL    +        CGS  + +PE+L   
Sbjct: 231 IMIS---------KDGNI-------KLIDFGLSNLYDKCNKLKTYCGSLYFAAPELLKAT 274

Query: 442 PYDGHLSDTWAMGVILYSLLEDRLPFD 468
           PY G   D W+ GV+LY L+  ++PFD
Sbjct: 275 PYIGPEIDVWSFGVVLYVLVCGKVPFD 301

>Kwal_26.7788
          Length = 1267

 Score =  102 bits (254), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 116/252 (46%), Gaps = 50/252 (19%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLD 276
           W+  KT+G G+   V L ++++      +++  K        K  R          G L 
Sbjct: 58  WKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPK-------TKSSRT---------GSLP 101

Query: 277 NSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGD 336
             + REI ++  ++HP ++ L+ V      E+   L+             L++ Y  GG+
Sbjct: 102 YGIEREIIIMKLISHPNVMGLYEV-----WENKLELF-------------LVLEYVDGGE 143

Query: 337 LLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKD 396
           L   +    G L        F +I+ G  Y H  NI HRDLK EN+LL           D
Sbjct: 144 LFDYLV-SRGRLPEKEAIHYFRQIIEGTAYCHGFNICHRDLKPENLLL-----------D 191

Query: 397 KDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVI 456
           K    ++  ++IADFG+      ++L    CGS  Y SPEI+MG  Y+G  SD W+ G+I
Sbjct: 192 K----KNKRIKIADFGMAALQTSNKLLETSCGSPHYASPEIVMGKNYNGGPSDVWSCGII 247

Query: 457 LYSLLEDRLPFD 468
           L++LL   LPF+
Sbjct: 248 LFALLTGHLPFN 259

>Kwal_26.8709
          Length = 829

 Score =  100 bits (248), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 78/255 (30%), Positives = 116/255 (45%), Gaps = 53/255 (20%)

Query: 222 TIGVGNFSDVLLYESIDQNDPELL--QVAVKRIRYPQELKDIRNRSANFDELLGRLDNSL 279
           T+G G F  V L  S   N    +  QVA+K IR     K+               +  +
Sbjct: 45  TLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKN------------SEKEIKI 92

Query: 280 TREISVLNSLNHPCIVKLFGV-NDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLL 338
            REI+ L  LNHP IV+L  V  +  +I                    +++ Y  GG+  
Sbjct: 93  YREINALKHLNHPNIVRLEEVLQNSKYI-------------------GIVLEYASGGEFY 133

Query: 339 AAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKD 398
             + Q    L      RLF +++ GV Y+H   ++HRDLKLEN+LL          K+++
Sbjct: 134 KYI-QKKRRLKEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLD---------KNEN 183

Query: 399 IYYEHSFVEIADFGLCKKIEPD-ELCTARCGSEDYVSPEILMGV-PYDGHLSDTWAMGVI 456
           +        I DFG   +  P+ EL    CGS  Y +PE+++   PY+   +D W+ GVI
Sbjct: 184 LL-------ITDFGFVNEFLPENELMKTSCGSPCYAAPELVVTARPYEARKADVWSCGVI 236

Query: 457 LYSLLEDRLPFDPLP 471
           LY++L   LP+D  P
Sbjct: 237 LYAMLAGYLPWDDDP 251

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 99.8 bits (247), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 118/264 (44%), Gaps = 48/264 (18%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQV---AVKRIRYPQELKDIRNRSANFDELLG 273
           W  ++T+G G+   V L +    N+   +++   A K   + Q+L+ +    A  +ELL 
Sbjct: 54  WDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGLPP-PATEEELLE 112

Query: 274 RL---------DNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVP 324
           R          D    RE S+   L HP I +LF               +M  +      
Sbjct: 113 RRKKLEKEVSRDKRTIREASLGQILYHPHICRLF---------------EMCTMSNHFY- 156

Query: 325 CNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILL 384
             ++  Y  GG LL  + Q  G+L     ++    I   ++YLH +NI+HRDLK+ENI++
Sbjct: 157 --MLFEYVSGGQLLDYIIQ-HGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMI 213

Query: 385 KVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYD 444
               G IR               I DFGL    +P +     CGS  + +PE+L   PY 
Sbjct: 214 SSS-GEIR---------------IIDFGLSNMYDPKKQLHTFCGSLYFAAPELLKAHPYT 257

Query: 445 GHLSDTWAMGVILYSLLEDRLPFD 468
           G   D W+ GV+LY L+  ++PFD
Sbjct: 258 GPEVDIWSFGVVLYVLVCGKVPFD 281

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 124/272 (45%), Gaps = 46/272 (16%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDP---ELLQVAVKRIRY-------PQELKDIRNRSA 266
           W  ++T+G G+   V L ++ + N+    +++  A K   +       P +  + + R  
Sbjct: 67  WDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENEAKERQK 126

Query: 267 NFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCN 326
             ++ + R D    RE S+   L HP + KL               Y+M  L        
Sbjct: 127 RLNKEISR-DKRTVREASLGQILFHPNVCKL---------------YEMQTLSNHYY--- 167

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           +   +  GG LL  + Q  G+L     +++   IL  ++YLH +NI+HRDLK+ENI+L  
Sbjct: 168 MFFEFISGGQLLDYIIQ-HGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLS- 225

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
             G I+               + DFGL    +P +     CGS  + +PE+L   PY G 
Sbjct: 226 KTGEIK---------------LIDFGLSNMYDPRKSLQTFCGSLYFAAPELLKAHPYLGP 270

Query: 447 LSDTWAMGVILYSLLEDRLPFDPLPGASIRQK 478
             D W+ GV+LY L+  ++PFD    +++ +K
Sbjct: 271 EVDVWSFGVVLYVLVCGKVPFDDENSSALHEK 302

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 87/316 (27%), Positives = 131/316 (41%), Gaps = 61/316 (19%)

Query: 222 TIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLTR 281
           T+G G F  V L  S  + D +   VA+K IR     K+               +  + R
Sbjct: 50  TLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEK------------EIKIYR 97

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
           E++ L  L+HP IV+L  V                   Q      +++ Y  GG+    +
Sbjct: 98  ELNALKLLSHPNIVRLEEV------------------LQNSKYIGIVLQYASGGEFYKYI 139

Query: 342 SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYY 401
            Q    L      RLF +++ GV Y+H   + HRDLKLEN+LL                 
Sbjct: 140 -QKKRRLKEPPACRLFAQLISGVHYIHYKGLAHRDLKLENLLLD---------------- 182

Query: 402 EHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGV-PYDGHLSDTWAMGVILYSL 460
           EH  + I DFG   +   ++L    CGS  Y +PE+++   PY    +D W+ GVILY++
Sbjct: 183 EHENLIITDFGFVNEFHKNDLMRTSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAM 242

Query: 461 LEDRLPFDPLPGASIRQKNRPTAHRIAR-FEWKWHKMIEDDSSAKEIVNNTLTR-----K 514
           L   LP+D  P         P    IA+ +++  H  ++     K I  + L R      
Sbjct: 243 LAGYLPWDDDP-------ENPEGEDIAKLYQYITHTSLKFPEYIKPIPRDLLKRILVSNP 295

Query: 515 NQRWNCNDIFNSAFIQ 530
             R    DI   A++Q
Sbjct: 296 EVRLTVADIEQHAWLQ 311

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 112/255 (43%), Gaps = 55/255 (21%)

Query: 222 TIGVGNFSDVLL-YESIDQNDPELL-----QVAVKRIRYPQELKDIRNRSANFDELLGRL 275
           T+G G F  V L +       PE       QVA+K IR    +K+               
Sbjct: 49  TLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKN------------SEK 96

Query: 276 DNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG 335
           +  + REI+ L  L HP +V+L  V                   Q      +++ Y  GG
Sbjct: 97  EIKIYREINALKHLTHPNVVRLEEV------------------LQNSKYIGIVLEYASGG 138

Query: 336 DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLK 395
           +    + Q    L      RLF +++ GV Y+H  N++HRDLKLEN+LL          K
Sbjct: 139 EFYKYI-QRKRRLKESTACRLFAQLISGVTYMHSKNLVHRDLKLENLLLD---------K 188

Query: 396 DKDIYYEHSFVEIADFGLCKKIEPD-ELCTARCGSEDYVSPEILMGV-PYDGHLSDTWAM 453
           ++++        I DFG   +  PD E     CGS  Y +PE+++   PY    +D W+ 
Sbjct: 189 NENLV-------ITDFGFVNEFLPDNEYMKTSCGSPCYAAPELVISTRPYVARKADVWSC 241

Query: 454 GVILYSLLEDRLPFD 468
           G+ILY++L   LP+D
Sbjct: 242 GIILYAMLAGYLPWD 256

>Scas_640.14*
          Length = 728

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 87/190 (45%), Gaps = 37/190 (19%)

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
           REI+ L  L HP IV+L  V                   Q      +++ Y  GG+    
Sbjct: 95  REINSLKHLTHPNIVRLEEV------------------LQNSKYIGIVLEYASGGEFYKY 136

Query: 341 MSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIY 400
           + Q    L      RLF +++ GV Y+H   I+HRDLKLEN+LL           DK   
Sbjct: 137 V-QRKRRLKEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLL-----------DK--- 181

Query: 401 YEHSFVEIADFGLCKKIEPD-ELCTARCGSEDYVSPEILMGV-PYDGHLSDTWAMGVILY 458
             H  + I DFG   +   D EL    CGS  Y +PE+++   PY    +D W+ G+ILY
Sbjct: 182 --HENLIITDFGFVNEFYADNELMKTSCGSPCYAAPELVITTEPYKARKADIWSCGIILY 239

Query: 459 SLLEDRLPFD 468
            +L   LP+D
Sbjct: 240 GMLAGYLPWD 249

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 117/262 (44%), Gaps = 46/262 (17%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDP---ELLQVAVKRIRY-------PQELKDIRNRSA 266
           W  V+T+G G+   V L +    N+    +++  A K   +       P+  +D+  R  
Sbjct: 120 WEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLERQK 179

Query: 267 NFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCN 326
             ++ + R D    RE S+   L HP I              CR L++M  L        
Sbjct: 180 KLEKEISR-DKRTIREASLGQILYHPHI--------------CR-LFEMCTLSNHFY--- 220

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           ++  Y  GG LL  + Q  G++     ++    I   + YLH +NI+HRDLK+ENI++  
Sbjct: 221 MLFEYVSGGQLLDYIIQ-HGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMIS- 278

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
                          + S ++I DFGL    +  +     CGS  + +PE+L   PY G 
Sbjct: 279 ---------------DSSEIKIIDFGLSNIYDSRKQLHTFCGSLYFAAPELLKANPYTGP 323

Query: 447 LSDTWAMGVILYSLLEDRLPFD 468
             D W+ GV+L+ L+  ++PFD
Sbjct: 324 EVDVWSFGVVLFVLVCGKVPFD 345

>Scas_700.34
          Length = 864

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 89/192 (46%), Gaps = 37/192 (19%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLL 338
           + REI+ L  L HP IVKL  V                   Q      +++ Y  GG+  
Sbjct: 104 IYREINALKHLTHPNIVKLEEV------------------LQNSKYIGIVLEYASGGEFY 145

Query: 339 AAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKD 398
             + Q    L      RLF +++ GV Y+H   ++HRDLKLEN+LL           DK 
Sbjct: 146 KYI-QRKKRLKEGPACRLFAQLINGVHYIHSKGLVHRDLKLENLLL-----------DK- 192

Query: 399 IYYEHSFVEIADFGLCKKI-EPDELCTARCGSEDYVSPEILMGV-PYDGHLSDTWAMGVI 456
               H  + I DFG   +     EL    CGS  Y +PE+++   PY+   +D W+ GVI
Sbjct: 193 ----HENLIITDFGFVSEFYSHGELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVI 248

Query: 457 LYSLLEDRLPFD 468
           LY++L   LP+D
Sbjct: 249 LYAMLAGYLPWD 260

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 93.6 bits (231), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 114/262 (43%), Gaps = 46/262 (17%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRY----------PQELKDIRNRSA 266
           W  ++T+G G+   V L +     +  ++++  +  +           P+   +I  R  
Sbjct: 99  WEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQHSLPSPKNESEILERQK 158

Query: 267 NFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCN 326
             ++ + R D    RE S+   L HP I              CR L++M  +        
Sbjct: 159 RLEKEIAR-DKRTVREASLGQILYHPHI--------------CR-LFEMCTMSNHFY--- 199

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           ++  Y  GG LL  + Q  G+L     ++    I   ++YLH +NI+HRDLK+ENI++  
Sbjct: 200 MLFEYVSGGQLLDYIIQ-HGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMIS- 257

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
                              ++I DFGL    +  +     CGS  + +PE+L   PY G 
Sbjct: 258 ---------------SSGEIKIIDFGLSNIFDYRKQLHTFCGSLYFAAPELLKAQPYTGP 302

Query: 447 LSDTWAMGVILYSLLEDRLPFD 468
             D W+ G++LY L+  ++PFD
Sbjct: 303 EVDIWSFGIVLYVLVCGKVPFD 324

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 93.6 bits (231), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 83/316 (26%), Positives = 139/316 (43%), Gaps = 52/316 (16%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDP---ELLQVAVKRIRY-------PQELKDIRNRSA 266
           W  ++T+G G+   V L +    N+    +++  A K   +       P+  +++  R  
Sbjct: 98  WDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQLPPPKTEEELMERKK 157

Query: 267 NFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCN 326
             ++ L R D    RE S+   L HP I +LF               +M  +        
Sbjct: 158 KLEKELSR-DRRTIREASLGQILYHPHICRLF---------------EMCTMSNHFY--- 198

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           ++  Y  GG LL  + Q  G+L     ++    I   ++YLH +NI+HRDLK+ENI++  
Sbjct: 199 MLFEYVSGGQLLDYIIQ-HGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMIST 257

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
             G I+               I DFGL    +  +     CGS  + +PE+L   PY G 
Sbjct: 258 S-GEIK---------------IIDFGLSNLYDNKKQLHTFCGSLYFAAPELLKANPYIGP 301

Query: 447 LSDTWAMGVILYSLLEDRLPFDPLPGASIRQKNRPTAHRIARFEWKWHKMIEDDS-SAKE 505
             D W+ GV++Y L+  ++PFD    + + +K +       + E+  H  IE  S  +K 
Sbjct: 302 EVDIWSFGVVIYVLVCGKVPFDDENASVLHEKIKK-----GKVEYPQHLSIECISLLSKM 356

Query: 506 IVNNTLTRKNQRWNCN 521
           +V + L R + +  CN
Sbjct: 357 LVVDPLKRASLKQVCN 372

>Scas_564.7
          Length = 1210

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 115/262 (43%), Gaps = 46/262 (17%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRY----------PQELKDIRNRSA 266
           W  ++T+G G+   V L       +   +++  + ++           P+  +++  R  
Sbjct: 162 WDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTEQEVLERQK 221

Query: 267 NFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCN 326
             ++ + R D    RE S+   L HP I              CR L++M  +        
Sbjct: 222 KLEKEISR-DKRTIREASLGQVLYHPHI--------------CR-LFEMCTMSNHFY--- 262

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           ++  Y  GG LL  + Q  G+L     ++    I   ++Y+H +NI+HRDLK+ENI++  
Sbjct: 263 MLFEYVSGGQLLDYIIQ-HGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMIST 321

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
             G I+               I DFGL    +  +     CGS  + +PE+L   PY G 
Sbjct: 322 -SGEIK---------------IIDFGLSNVFDRKKQLHTFCGSLYFAAPELLKAHPYTGP 365

Query: 447 LSDTWAMGVILYSLLEDRLPFD 468
             D W+ GV+LY L+  ++PFD
Sbjct: 366 EVDVWSFGVVLYVLVCGKVPFD 387

>Kwal_26.8751
          Length = 848

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/255 (27%), Positives = 120/255 (47%), Gaps = 52/255 (20%)

Query: 294 IVKLFGVNDP-----LFIESCRPLYDMLKLRQKLVPCNLI---MSYCVGGDL----LAA- 340
           ++K+   NDP     +F         + KL + +V  N +   + YC G +L    LA  
Sbjct: 64  VLKMGSKNDPNVVREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKK 123

Query: 341 ---MSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDK 397
              + +CS          LF++I+  V Y H    +HRDLKLENILL           DK
Sbjct: 124 HIPLEECS---------ELFSQIVGAVYYAHSMKCVHRDLKLENILL-----------DK 163

Query: 398 DIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVIL 457
             +      ++ DFG  ++     +    CG+  Y++PE++   PY+G+  DTW++G+IL
Sbjct: 164 KGH-----AKLTDFGFTRECATKGILETICGTTVYMAPELIERKPYEGYKIDTWSLGIIL 218

Query: 458 YSLLEDRLPFDPLPGASIRQKNRPTAHRIARFEWKW-HKMIEDDSSAKEIVNNTLTRK-N 515
           Y+++   +PFD +           T ++I  +   + +  I  DS+ KE+++  L +  N
Sbjct: 219 YTMIHGTMPFDEVDEVK-------TKYKIVHYNPTYDNDYI--DSNGKELISQLLEKDPN 269

Query: 516 QRWNCNDIFNSAFIQ 530
           QR +   +    F+Q
Sbjct: 270 QRPSLTQVLQHPFLQ 284

>Scas_690.13
          Length = 354

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 120/259 (46%), Gaps = 56/259 (21%)

Query: 209 GEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANF 268
           G+YT    ++ ++T+G G+F  V L  S+          A+K ++  Q ++  +    N 
Sbjct: 37  GKYTLH-DFQVMRTLGTGSFGRVHLVRSVHNGR----YYAIKVLKKQQVVRMKQIEHTN- 90

Query: 269 DELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLI 328
                        E  +L  + HP +++++G       +  R L+             ++
Sbjct: 91  ------------DERRMLKLVEHPFLIRMWGT-----FQDSRNLF-------------MV 120

Query: 329 MSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPL 388
           M Y  GG+L + + + S      + +    E+ LG++YLH HNII+RDLK ENILL    
Sbjct: 121 MDYIEGGELFSLLRK-SQRFPNPVAKFYAAEVTLGLEYLHSHNIIYRDLKPENILLD--- 176

Query: 389 GNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLS 448
                         +  ++I DFG  K++  D +    CG  DY++PE++   PY+  + 
Sbjct: 177 -------------RNGHIKITDFGFAKEV--DTVTWTLCGPPDYIAPEVIATKPYNKSV- 220

Query: 449 DTWAMGVILYSLLEDRLPF 467
           D W++GV+++ +L    PF
Sbjct: 221 DWWSLGVLIFEMLAGYTPF 239

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 100/216 (46%), Gaps = 44/216 (20%)

Query: 276 DNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG 335
           +  + REI+ L  L+HP IVKL  V                   Q      +++ Y  GG
Sbjct: 111 ETKIYREINALKHLSHPNIVKLEEV------------------LQNSKYIGIVLEYAAGG 152

Query: 336 DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLK 395
           +    + Q    L      RLF++++  V Y+H   ++HRDLKLEN+LL           
Sbjct: 153 EFYKFI-QRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLD---------- 201

Query: 396 DKDIYYEHSFVEIADFGLCKK-IEPDELCTARCGSEDYVSPEILMG-VPYDGHLSDTWAM 453
                 E + + I DFG   + +  + +    CGS  Y +PE+++   PYD   +DTW+ 
Sbjct: 202 -----NEENLI-ITDFGFVNEFLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSC 255

Query: 454 GVILYSLLEDRLPFDPLPGASIRQKNRPTAHRIARF 489
           G+IL+++L   LP+D  P      KN P  H I+R 
Sbjct: 256 GIILFAMLAGYLPWDDDP------KN-PDGHDISRL 284

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 113/248 (45%), Gaps = 55/248 (22%)

Query: 220 VKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSL 279
           ++T+G G+F  V L  S+          A+K ++  Q +K  +    N            
Sbjct: 54  MRTLGTGSFGRVHLVRSVHNGR----YYAIKVLKKAQVVKMKQIEHTN------------ 97

Query: 280 TREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLA 339
             E  +L  + HP +++++G       +  R L+             ++M Y  GG+L  
Sbjct: 98  -DERRMLKLVEHPFLIRMWGT-----FQDSRNLF-------------MVMDYIEGGELFT 138

Query: 340 AMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDI 399
            + + S      + +    E+ L ++YLH HNII+RDLK ENILL               
Sbjct: 139 LLRK-SQRFPNPVAKFYAAEVTLALEYLHFHNIIYRDLKPENILLD-------------- 183

Query: 400 YYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYS 459
              +  ++I DFG  K++E   +    CG+ DY++PE++   PY+  + D W++GV++Y 
Sbjct: 184 --RNGHIKITDFGFAKEVE--TVTWTLCGTPDYIAPEVIATKPYNKSV-DWWSLGVLIYE 238

Query: 460 LLEDRLPF 467
           +L    PF
Sbjct: 239 MLAGYTPF 246

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 108/259 (41%), Gaps = 73/259 (28%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLD 276
           +R VK +G G+F  V L      +   +L+   K                         D
Sbjct: 37  YRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKS------------------------D 72

Query: 277 NSLTREISVLNSLNHPCIVKLFGV-----NDPLFIESC--RPLYDMLKLRQKLVPCNLIM 329
            ++ RE+       +P I KL+ V        + +E C    LYD L L+Q+ +P     
Sbjct: 73  PNVVREVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQR-IP----- 126

Query: 330 SYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLG 389
                             LD    +RLF +I+  V Y H    +HRDLKLENILL     
Sbjct: 127 ------------------LDE--TRRLFAQIVSAVFYAHSLQCVHRDLKLENILL----- 161

Query: 390 NIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSD 449
                 DK+ Y       + DFG  ++          CG+  Y++PE++    YDG+  D
Sbjct: 162 ------DKNGY-----AMLTDFGFTRECATKTQLETVCGTTVYMAPELIKREAYDGYKVD 210

Query: 450 TWAMGVILYSLLEDRLPFD 468
           TW++G+ILY++L   +PFD
Sbjct: 211 TWSLGIILYTMLHGYMPFD 229

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 91.3 bits (225), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/263 (28%), Positives = 124/263 (47%), Gaps = 57/263 (21%)

Query: 213 KALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELL 272
           K++Q+   + IG G++   ++Y++I+++  ++  VA+K + Y  +           +EL 
Sbjct: 21  KSVQYHLKQVIGRGSYG--VVYKAINKHTDQV--VAIKEVVYEND-----------EEL- 64

Query: 273 GRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYC 332
               N +  EIS+L +LNH  IVK  G     FI     LY             +++ YC
Sbjct: 65  ----NDIMAEISLLKNLNHNNIVKYHG-----FIRKSYELY-------------ILLEYC 102

Query: 333 VGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIR 392
             G L   +S+ S  L     +   T+ LLG+KYLH   +IHRD+K  NILL        
Sbjct: 103 ANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSA------ 156

Query: 393 SLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWA 452
                      + V++ADFG+   +    L  A  G+ ++++PEIL G      LSD W+
Sbjct: 157 ----------DNTVKLADFGVSTIVNSSALTLA--GTLNWMAPEIL-GNRGASTLSDIWS 203

Query: 453 MGVILYSLLEDRLPFDPLPGASI 475
           +G  +  +L    P+  L  A+I
Sbjct: 204 LGATVVEMLTKNPPYHNLTDANI 226

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 102/210 (48%), Gaps = 43/210 (20%)

Query: 267 NFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCN 326
           N  +++G +D  +TRE+ VL  LNHP IV L G     F E     Y             
Sbjct: 249 NKRKVMGNVD-GVTRELEVLRRLNHPRIVSLKG-----FYEDDESYY------------- 289

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           L+M +  GGDL+  ++   G++     + +  +IL  V+Y+HE  I HRDLK +NIL++ 
Sbjct: 290 LLMEFVSGGDLMDFVA-AHGSVGEDAGREITRQILEAVRYIHEQGISHRDLKPDNILIE- 347

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
                   +D  +      V+I DFGL K  +        CG+  YV+PE++ G   +G+
Sbjct: 348 --------QDDPV-----LVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEVIGGKNPEGN 394

Query: 447 ---------LSDTWAMGVILYSLLEDRLPF 467
                    L D W++G ++Y +L   LPF
Sbjct: 395 GANGNLYSSLVDMWSIGCLVYVILTGHLPF 424

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 88.6 bits (218), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 114/248 (45%), Gaps = 55/248 (22%)

Query: 220 VKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSL 279
           ++T+G G+F  V L  SI          A+K ++  Q ++  +    N            
Sbjct: 39  MRTLGTGSFGRVHLVRSIHNGR----YYAIKVLKKQQVIRMKQIEHTN------------ 82

Query: 280 TREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLA 339
             E  +L  + HP +++++G       +  R L+             ++M Y  GG+L +
Sbjct: 83  -DERRMLKVVEHPFLIRMWGT-----FQDARNLF-------------IVMDYIEGGELFS 123

Query: 340 AMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDI 399
            + + S      + +    E+ L ++YLH HNII+RDLK ENILL               
Sbjct: 124 LLRK-SQRFPNPVAKFYAAEVTLALEYLHAHNIIYRDLKPENILLD-------------- 168

Query: 400 YYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYS 459
              +  ++I DFG  K++  D +    CG+ DY++PE++   PY+  + D W++G++++ 
Sbjct: 169 --RNGHIKITDFGFAKEV--DTVTWTLCGTPDYIAPEVITTKPYNKSI-DWWSLGILIFE 223

Query: 460 LLEDRLPF 467
           +L    PF
Sbjct: 224 MLAGYTPF 231

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 90.9 bits (224), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 112/262 (42%), Gaps = 46/262 (17%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRY----------PQELKDIRNRSA 266
           W  ++T+G G+   V L +     +   +++  +  +           P   ++I  R  
Sbjct: 108 WDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIMERQK 167

Query: 267 NFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCN 326
             ++ + R D    RE S+     HP I              CR L++M  +        
Sbjct: 168 KLEKEISR-DKRAIREASLGQIFYHPHI--------------CR-LFEMCTMSNHFY--- 208

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           ++  Y  GG LL  + Q  G+L     ++    +   ++YLH +NI+HRDLK+ENI++  
Sbjct: 209 MLFEYVAGGQLLDYIIQ-HGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMIS- 266

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
                              ++I DFGL    +  +     CGS  + +PE+L   PY G 
Sbjct: 267 ---------------NSGEIKIIDFGLSNVYDTRKQLHTFCGSLYFAAPELLKAHPYTGP 311

Query: 447 LSDTWAMGVILYSLLEDRLPFD 468
             D W+ GV+LY L+  ++PFD
Sbjct: 312 EVDVWSFGVVLYVLVCGKVPFD 333

>Kwal_56.24059
          Length = 353

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 116/248 (46%), Gaps = 55/248 (22%)

Query: 220 VKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSL 279
           ++T+G G+F  V L  S+          A+K ++  Q ++  +    N            
Sbjct: 46  LRTLGTGSFGRVHLVRSVHNGR----YYAIKVLKKEQVIRMKQIEHTN------------ 89

Query: 280 TREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLA 339
             E  +L  ++HP +++++G       +  R L+             ++M Y  GG+L +
Sbjct: 90  -DERRMLKLVDHPFLIRMWGT-----FQDSRNLF-------------MVMDYIEGGELFS 130

Query: 340 AMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDI 399
            + + S      + +    E++L ++YLH H+II+RDLK ENILL               
Sbjct: 131 LLRK-SQRFPNPVAKFYAAEVILALEYLHSHDIIYRDLKPENILLD-------------- 175

Query: 400 YYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYS 459
              +  ++I DFG  K++  D +    CG+ DY++PE++   PY+  + D W++G++++ 
Sbjct: 176 --RNGHIKITDFGFAKEV--DTVTWTLCGTPDYIAPEVIATKPYNKSV-DWWSLGILIFE 230

Query: 460 LLEDRLPF 467
           +L    PF
Sbjct: 231 MLAGYTPF 238

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 92/312 (29%), Positives = 146/312 (46%), Gaps = 52/312 (16%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLT 280
           K +G G+++  ++ E+ ++   E   VAVK I +PQ+  D + R+  F           T
Sbjct: 105 KELGTGHYA--IVKEARNKETGE--TVAVK-IFHPQQNDDDK-RTKKF-----------T 147

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
            E  +L S+ HP IVKL       F+E          + +  +   L++     G+L   
Sbjct: 148 EETKILLSIQHPNIVKLID----RFVEP---------VSKTQIQTYLVLEKINDGELFER 194

Query: 341 MSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILL---------KVPLGNI 391
           + +   NL     + LF ++L G+KYLH  NIIHRD+K ENILL         ++ LG  
Sbjct: 195 IVR-KNNLREDETKALFRQLLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALG-- 251

Query: 392 RSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTW 451
               D ++  +   V+IADFGL K     +     CG+  YV+PE+L+   Y   + D W
Sbjct: 252 -PWDDDELDIQ---VKIADFGLAKFTGEMKFTNTLCGTPSYVAPEVLVKTGYTSRV-DMW 306

Query: 452 AMGVILYSLLEDRLPF-DPLPGASIRQKNRPTAHRIARFEWKWHKMIEDDSSAKEIVNNT 510
           + GV+LY  L    PF + L   S++++      + A +   W  +  DDS    I N  
Sbjct: 307 SAGVLLYVCLCGFPPFSEQLAPPSMKEQ--ILQGKFAFYSPYWDNI--DDSVLHLISNLL 362

Query: 511 LTRKNQRWNCND 522
           +     R++ ND
Sbjct: 363 VVNPASRFSVND 374

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 92/309 (29%), Positives = 141/309 (45%), Gaps = 40/309 (12%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLT 280
           K +G G+++  L+ E+  +N     QVAVK     Q   D + ++  F E          
Sbjct: 204 KELGAGHYA--LVKEA--KNKKTGQQVAVKIFHAQQN--DDQKKNKQFRE---------- 247

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
            E ++L  + HP IV L       F+E          + +  +   L++     G+L   
Sbjct: 248 -ETNILMRVQHPNIVNLLDS----FVEP---------ISKSQIQKYLVLEKIDDGELFER 293

Query: 341 MSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIY 400
           + + +  L +   + LF ++L G+KYLHE NIIHRD+K ENILL +      S      +
Sbjct: 294 IVRKTC-LRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPW 352

Query: 401 YEHSF---VEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVIL 457
            E      V+IADFGL K     +     CG+  YV+PE+L    Y   + D W+ GVIL
Sbjct: 353 DEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKV-DLWSAGVIL 411

Query: 458 YSLLEDRLPF-DPLPGASIRQKNRPTAHRIARFEWKWHKMIEDDSSAKEIVNNTLTRKNQ 516
           Y  L    PF D L   S+  K +    + A +   W K+  DDS    I N  +   ++
Sbjct: 412 YVCLCGFPPFSDQLGPPSL--KEQILQAKYAFYSPYWDKI--DDSVLHLISNLLVLNPDE 467

Query: 517 RWNCNDIFN 525
           R+N ++  N
Sbjct: 468 RYNIDEALN 476

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 92/313 (29%), Positives = 144/313 (46%), Gaps = 40/313 (12%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLT 280
           K +G G+++  ++ E+I++   +   VAVK I +PQ+  D + ++  F E          
Sbjct: 159 KELGSGHYA--IVKEAINKITGQ--SVAVK-IFHPQKNDDAK-KTRQFRE---------- 202

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
            E  +L  LNH  IVKL       F+E          L +  V   L++     G+L   
Sbjct: 203 -ETKILMGLNHENIVKLL----ERFVEP---------LSKSQVQTYLVLEKIQDGELFDK 248

Query: 341 MSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIY 400
           + + +  L +   + LF +IL G+KYLH+ NIIHRD+K ENILL +             +
Sbjct: 249 IVRKT-KLHQDETRALFKQILAGLKYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPW 307

Query: 401 YEHSF---VEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVIL 457
            E      V+IADFGL K     +  T  CG+  YV+ E+L    Y   + D W+ GV+L
Sbjct: 308 DEDELDITVKIADFGLAKFTGEMQFTTTLCGTPSYVAAEVLTKTGYTSKV-DLWSAGVLL 366

Query: 458 YSLLEDRLPF-DPLPGASIRQKNRPTAHRIARFEWKWHKMIEDDSSAKEIVNNTLTRKNQ 516
           Y  L    PF D L   S+  K +    + A +   W ++  DDS    I N  +    +
Sbjct: 367 YVCLCGFPPFSDQLAPPSM--KEQILQGKFAFYSPYWDEI--DDSVLHLISNLLVVDPAK 422

Query: 517 RWNCNDIFNSAFI 529
           R++  D     ++
Sbjct: 423 RYSVRDAIGHEWL 435

>Kwal_27.10581
          Length = 1154

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 87/326 (26%), Positives = 137/326 (42%), Gaps = 77/326 (23%)

Query: 147  IRIISEVVPTPDTAQQRVISLPTVSEETTTENDKFPIHHDGTALADDSNSQEDDIVLMGY 206
             +I  E +  P  + Q+   +PT SE+++ +       H          S  DD VL+  
Sbjct: 774  FKIKDESITDPHVSPQKSTGVPTKSEQSSPQASHTSTRHKRRTPKRRKISL-DDFVLL-- 830

Query: 207  RIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSA 266
                          K +G GNF  VLL ES  +N+  L  + V +  +  +  DI +  A
Sbjct: 831  --------------KVLGKGNFGKVLLAES--KNNERLCAIKVLKKDHIIKNHDIESARA 874

Query: 267  NFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCN 326
                 L            +     HP +  L+        ++   +Y             
Sbjct: 875  EKKVFL------------LATKAKHPFLTNLY-----CSFQTENRIY------------- 904

Query: 327  LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
              M +  GGDL+  +     ++ R   +    E+LL +KY H++ +I+RDLKLENILL  
Sbjct: 905  FAMEFIGGGDLMWHVQNQRLSVRR--AKFYAAEVLLALKYFHDNGVIYRDLKLENILL-T 961

Query: 387  PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDEL-----CTARCGSEDYVSPEILMGV 441
            P G+I+               IAD+GLCK    DE+      +  CG+ ++++PEIL   
Sbjct: 962  PEGHIK---------------IADYGLCK----DEMWYGNKTSTFCGTPEFMAPEILKEQ 1002

Query: 442  PYDGHLSDTWAMGVILYSLLEDRLPF 467
             Y   + D WA GV+LY +L  + PF
Sbjct: 1003 EYTKAV-DWWAFGVLLYQMLLCQSPF 1027

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 103/246 (41%), Gaps = 50/246 (20%)

Query: 222 TIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLTR 281
           T+G G F  V L  S   +D E   VA+K IR     K+               +  + R
Sbjct: 61  TLGEGEFGKVKLGWSKSNSD-ESKNVAIKLIRRDTIPKN------------SEKEVKIYR 107

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
           EI+ L  L HP IV L  V                   Q      +++ Y  GG+    +
Sbjct: 108 EINALKHLAHPNIVTLEEV------------------LQNSKYIGIVLHYASGGEFYKYI 149

Query: 342 SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYY 401
            Q    L      RLF +++ GV Y+H   + HRDLKLEN+LL                 
Sbjct: 150 -QKKRRLKEPAACRLFAQLISGVHYMHHKGLAHRDLKLENLLLD---------------- 192

Query: 402 EHSFVEIADFGLCKKIEP-DELCTARCGSEDYVSPEILMGV-PYDGHLSDTWAMGVILYS 459
           EH  + I DFG   +    ++L    CGS  Y +PE+++    Y+   +D W+ GVILY+
Sbjct: 193 EHENLIITDFGFVNEFSSRNDLMKTSCGSPCYAAPELVVTTKAYEARKADVWSCGVILYA 252

Query: 460 LLEDRL 465
           +L   L
Sbjct: 253 MLAGYL 258

>Kwal_56.23717
          Length = 858

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 72/142 (50%), Gaps = 17/142 (11%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           ++  Y  GG LL  + Q  G+L     ++    I   ++YLH +NI+HRDLK+ENI++  
Sbjct: 10  MLFEYVSGGQLLDYIIQ-HGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIST 68

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
             G I+               I DFGL     P +     CGS  + +PE+L   PY G 
Sbjct: 69  S-GEIK---------------IIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGP 112

Query: 447 LSDTWAMGVILYSLLEDRLPFD 468
             D W+ GV+L+ L+  ++PFD
Sbjct: 113 EVDVWSFGVVLFVLVCGKVPFD 134

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 87.4 bits (215), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 90/195 (46%), Gaps = 35/195 (17%)

Query: 274 RLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCV 333
           + D ++ RE+      ++P I KL               Y+++    K+    + + YC 
Sbjct: 75  KSDPNVVREVFYHRQFDYPYITKL---------------YEVIVTETKVW---MALEYCP 116

Query: 334 GGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRS 393
           G +L   +   S  L       LF +I   V Y H  N +HRDLKLEN+LL         
Sbjct: 117 GKELYDHLLSKS-RLPTLECAELFAQITGAVHYAHTLNCVHRDLKLENVLL--------- 166

Query: 394 LKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAM 453
             DK+        ++ DFG  ++     +    CG+  Y++PE++   PYDG   D W++
Sbjct: 167 --DKN-----GNAKLTDFGFTRESMTKAVLETVCGTTVYMAPEMIQHKPYDGFKVDIWSL 219

Query: 454 GVILYSLLEDRLPFD 468
           GVILY+LL   LPFD
Sbjct: 220 GVILYTLLCGCLPFD 234

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 119/259 (45%), Gaps = 56/259 (21%)

Query: 209 GEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANF 268
           G+YT    ++ ++T+G G+F  V L  S+          A+K ++  Q ++  +    N 
Sbjct: 55  GKYTLH-DFQIMRTLGTGSFGRVHLVRSVHNGR----YYAIKVLKKHQIIRMKQIEHTN- 108

Query: 269 DELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLI 328
                        E  +L  + HP +++++G       +  R L+             ++
Sbjct: 109 ------------DERRMLKLVEHPFLIRMWGT-----FQDSRNLF-------------MV 138

Query: 329 MSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPL 388
           M Y  GG+L + + + S      + +    E+ L ++YLH HNII+RDLK ENILL    
Sbjct: 139 MDYIEGGELFSLLRK-SQRFPNPVAKFYAAEVTLALEYLHSHNIIYRDLKPENILLD--- 194

Query: 389 GNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLS 448
                         +  ++I DFG  K++    +    CG+ DY++PE++   PY+  + 
Sbjct: 195 -------------RNGHIKITDFGFAKEV--ITVTWTLCGTPDYIAPEVITTKPYNKSV- 238

Query: 449 DTWAMGVILYSLLEDRLPF 467
           D W++G++++ +L    PF
Sbjct: 239 DWWSLGILIFEMLAGYTPF 257

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 111/257 (43%), Gaps = 70/257 (27%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLT 280
           KT+G G F  V    +  QN    +++ +KR     EL+ +      +DEL         
Sbjct: 60  KTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQML------YDEL--------- 104

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
              S+L  L+HP IVK                 D  + R+K     ++     GG+L   
Sbjct: 105 ---SILQKLDHPNIVKF---------------KDWFESREKFY---IVTQLATGGELF-- 141

Query: 341 MSQCSGNLDRWLIQRLFTE---------ILLGVKYLHEHNIIHRDLKLENILLKVPLGNI 391
                   DR L +  FTE         +L  V+Y+H  N++HRDLK EN+L   P    
Sbjct: 142 --------DRILKKGKFTETDAVKIVVQMLTAVEYMHSQNVVHRDLKPENVLYLDP---- 189

Query: 392 RSLKDKDIYYEHSFVEIADFGLCKKIEPD-ELCTARCGSEDYVSPEILMGVPYDGHLSDT 450
                     + S + I+DFG+ K++  + +L     GS  YV+PE+L    + G   D 
Sbjct: 190 ---------SDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVLTTSGH-GKPCDI 239

Query: 451 WAMGVILYSLLEDRLPF 467
           W++GVI Y+LL    PF
Sbjct: 240 WSLGVITYTLLCGYSPF 256

>Scas_613.5
          Length = 517

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/255 (30%), Positives = 120/255 (47%), Gaps = 35/255 (13%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLT 280
           K +G G+++ V   E I++   +   VAVK I +PQ+  D   +S  F E          
Sbjct: 208 KDLGSGHYATV--KEGINKVTGQT--VAVK-IFHPQQ-NDDEKKSKQFRE---------- 251

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
            E ++L  ++HP IV L       FIE          + +  +   L++     G+L   
Sbjct: 252 -ETNILMRIHHPNIVNLLD----FFIEP---------VSKSQIQKYLVLDKIDDGELFER 297

Query: 341 MSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIY 400
           + + +  L +   + +F +IL+G+K+LH+ NIIHRD+K ENILL +        K    +
Sbjct: 298 IVKKTC-LRQDETKAIFNQILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPW 356

Query: 401 YEHSF---VEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVIL 457
            E      V+IADFGL K     +     CG+  YV+PE+L    Y   + D W+ GVIL
Sbjct: 357 DEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKV-DMWSAGVIL 415

Query: 458 YSLLEDRLPFDPLPG 472
           Y  L    PF    G
Sbjct: 416 YVCLCGFPPFSEQLG 430

>KLLA0F23507g complement(2198603..2200066) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, start by similarity
          Length = 487

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 119/275 (43%), Gaps = 68/275 (24%)

Query: 216 QWRKV-KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGR 274
           +W+ V + +G G F  VL+ E +D N     QVA K + Y  ++             +  
Sbjct: 137 RWKIVPRIVGSGTFGHVLVAEKVDHNMKR--QVAKKTVSYAVKV-------------INT 181

Query: 275 LDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVG 334
               + +E ++L  LNHP I+++         +SC      + + Q L+    + SY   
Sbjct: 182 AKTRMVKEATILEKLNHPNIIRIH--------QSCVDALGNVYIFQDLISGGDLFSYLAK 233

Query: 335 GDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSL 394
           GD L  +S+    +       +  +ILL +K+LH + I+HRDLKL+NILL  P    +  
Sbjct: 234 GDCLVPISETESLI-------IIYQILLALKFLHSNGIVHRDLKLDNILLHTPEPCTK-- 284

Query: 395 KDKDIYYEHSFVEIADFGLCKKIEPD--ELCTARCGSEDYVSPEILMGVPYDGHL----- 447
                      V +ADFG+ K++  +  E      G+ +Y +PE+  G   D ++     
Sbjct: 285 -----------VVLADFGIAKELSQNTKERMHTVVGTPEYCAPEV--GFKADRNIYRSFS 331

Query: 448 ---------------SDTWAMGVILYSLLEDRLPF 467
                           D W++GVI + +L    PF
Sbjct: 332 RTATLDPDNNGYDSKCDIWSLGVITHIMLTGISPF 366

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/265 (26%), Positives = 122/265 (46%), Gaps = 52/265 (19%)

Query: 209  GEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANF 268
            GEY K   W K + IG G+F  V L  S++    E++  AVK++  P        +    
Sbjct: 1144 GEY-KEFAWMKGEMIGKGSFGAVYL--SLNITTGEMM--AVKQVEVP--------KYGTQ 1190

Query: 269  DELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLI 328
            +EL+  +  +L  E++ L  L+H  IV+  G                 ++R  +   +L 
Sbjct: 1191 NELVKDMVEALKSEVATLKDLDHLNIVQYLGS----------------EIRGNIY--SLF 1232

Query: 329  MSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPL 388
            + Y  GG +  ++ +  G  D  LI+ L T++L G+KYLH   I+HRD+K +N+LL    
Sbjct: 1233 LEYVAGGSV-GSLIRLYGRFDEKLIRHLNTQVLSGLKYLHSKGILHRDMKADNLLLD--- 1288

Query: 389  GNIRSLKDKDIYYEHSFVEIADFGLCKK---IEPDELCTARCGSEDYVSPEILMGVPYDG 445
                         E    +I+DFG+ KK   I  +   T R G+  +++PE++       
Sbjct: 1289 -------------EDGICKISDFGISKKSKNIYSNSDMTMR-GTVFWMAPEMVDTKQGYS 1334

Query: 446  HLSDTWAMGVILYSLLEDRLPFDPL 470
               D W++G ++  +   + P+  L
Sbjct: 1335 AKVDIWSLGCVVLEMFAGKRPWSNL 1359

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 108/248 (43%), Gaps = 50/248 (20%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLT 280
           KT+G G F  V     I   +   +++ +K        K ++ +S     L         
Sbjct: 50  KTLGAGTFGVVRQARCISSGENVAVKILLK--------KALKGQSVQLQMLYD------- 94

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
            E+S+L  LNHP IV+        + ES    Y             ++     GG+L   
Sbjct: 95  -ELSILQQLNHPNIVRF-----KDWFESKEKFY-------------IVTQLATGGELFDR 135

Query: 341 MSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIY 400
           + +  G         +  +IL GV+YLH+ NI+HRDLK ENIL          L   D  
Sbjct: 136 ILE-KGKFCEVDAVFIVKQILQGVQYLHQRNIVHRDLKPENILY---------LNKSD-- 183

Query: 401 YEHSFVEIADFGLCKKIEPD-ELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYS 459
              S + I DFG+ K+++ D EL     GS  YV+PE+L    + G   D W++GVI Y+
Sbjct: 184 --DSPLVIGDFGIAKELKDDNELIHKAAGSMGYVAPEVLTSSGH-GKPCDIWSIGVITYT 240

Query: 460 LLEDRLPF 467
           LL    PF
Sbjct: 241 LLCGYSPF 248

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 116/248 (46%), Gaps = 55/248 (22%)

Query: 220 VKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSL 279
           ++T+G G+F  V L  S        ++V  K I     LK + + +   DE L       
Sbjct: 90  LRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVV--RLKQVEHTN---DERL------- 137

Query: 280 TREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLA 339
                +L+ + HP I++++G       +  + ++             +IM Y  GG+L +
Sbjct: 138 -----MLSIVTHPFIIRMWGT-----FQDAQQIF-------------MIMDYIEGGELFS 174

Query: 340 AMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDI 399
            + + S      + +    E+ L ++YLH  +II+RDLK ENILL           DK+ 
Sbjct: 175 LLRK-SQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILL-----------DKN- 221

Query: 400 YYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYS 459
                 ++I DFG  K + PD   T  CG+ DY++PE++   PY+  + D W+ G+++Y 
Sbjct: 222 ----GHIKITDFGFAKYV-PDVTYTL-CGTPDYIAPEVVSTKPYNKSI-DWWSFGILIYE 274

Query: 460 LLEDRLPF 467
           +L    PF
Sbjct: 275 MLAGYTPF 282

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 119/267 (44%), Gaps = 52/267 (19%)

Query: 214  ALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLG 273
            +++W+K   IG G F  V  Y +I+  + E+L V   +I     +K I            
Sbjct: 1031 SMRWQKRSFIGGGTFGQV--YSAINLENGEILAVKEIKIHDTTTMKKIFPL--------- 1079

Query: 274  RLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCV 333
                 +  E++VL  LNHP IV+ +GV      E  R               N+ M YC 
Sbjct: 1080 -----IKEEMTVLEMLNHPNIVQYYGV------EVHRD------------KVNIFMEYCE 1116

Query: 334  GGDLLAAMSQCSGNLDRWLIQRLFT-EILLGVKYLHEHNIIHRDLKLENILLK------- 385
            GG L + +    G ++  ++ +++T E+L G+ YLH+  ++HRD+K ENILL        
Sbjct: 1117 GGSLASLLDH--GRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKY 1174

Query: 386  VPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDG 445
            V  G  R++         +   + DFG    +E   L     G+  Y++PE + G    G
Sbjct: 1175 VDFGTARTVVGSRTRTVRN-AAVQDFG----VETKSL-NEMMGTPMYMAPETISGSAVKG 1228

Query: 446  HLS--DTWAMGVILYSLLEDRLPFDPL 470
             L   D WA+G ++  +   R P+  L
Sbjct: 1229 KLGADDVWALGCVVLEMATGRRPWSNL 1255

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 89/303 (29%), Positives = 144/303 (47%), Gaps = 57/303 (18%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLT 280
           K +G G+++  ++ E+ ++   E   VAVK I +PQ+  D + ++  F E          
Sbjct: 197 KDLGSGHYA--IVKEAKNKTTGE--TVAVK-IFHPQQ-NDDQKKNKQFRE---------- 240

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
            E ++L  ++HP IV L       F+E          + +  +   L++     G+L   
Sbjct: 241 -ETTILMKIHHPNIVNLLDS----FVEP---------ISKTQIQKYLVLEKIDDGELFDR 286

Query: 341 MSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIY 400
           + + + +L +   + +F +IL G+KYLH  NIIHRD+K ENILL     NIR  +  D  
Sbjct: 287 IVKKT-SLPQEESKAIFKQILTGLKYLHSQNIIHRDIKPENILL-----NIRRRQSPD-- 338

Query: 401 YEHSF-----------VEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSD 449
            E              V+IADFGL K     +     CG+  YV+PE+L+   Y   + D
Sbjct: 339 -ERQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLVKKGYTSKV-D 396

Query: 450 TWAMGVILYSLLEDRLPF-DPLPGASIRQKNRPTAHRIARFEWKWHKMIEDDSSAKEIVN 508
            W+ GVILY  L    PF D L   S+  K +  + + A +   W ++   D +A  +++
Sbjct: 397 LWSAGVILYVCLCGFPPFSDQLGPPSL--KEQIMSAKYAFYSPYWDEI---DDAALHLIS 451

Query: 509 NTL 511
           N L
Sbjct: 452 NLL 454

>Kwal_26.7355
          Length = 1446

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 116/265 (43%), Gaps = 52/265 (19%)

Query: 209  GEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANF 268
            GEY K   W K + IG G+F  V L  ++   +     +AVK++  P        R  + 
Sbjct: 1139 GEY-KEFAWIKGEMIGKGSFGSVFLGLNVTTGE----MIAVKQVEVP--------RYGSQ 1185

Query: 269  DELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLI 328
            DE    +  +L  E++ L  L+H  IV+  G  +  ++ S                  L 
Sbjct: 1186 DETTLSVLEALRSEVATLKDLDHTNIVQYLGFENKNYVYS------------------LF 1227

Query: 329  MSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPL 388
            + Y  GG +  ++ +  G  D  LI+ L  ++L G+ YLH   I+HRD+K +N+LL V  
Sbjct: 1228 LEYVAGGSV-GSLIRLYGKFDENLIRFLAVQVLRGLSYLHSKKILHRDMKADNLLLDV-- 1284

Query: 389  GNIRSLKDKDIYYEHSFVEIADFGLCKK---IEPDELCTARCGSEDYVSPEILMGVPYDG 445
                              +I+DFG+ KK   I  +   T R G+  +++PE++       
Sbjct: 1285 --------------DGICKISDFGISKKSNNIYSNSDMTMR-GTVFWMAPEMVDTKQGYS 1329

Query: 446  HLSDTWAMGVILYSLLEDRLPFDPL 470
               D W++G ++  +   + P+  L
Sbjct: 1330 AKVDIWSLGCVVLEMFAGKRPWSNL 1354

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 73/142 (51%), Gaps = 17/142 (11%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           +++ YC G +L   + +    L     ++LF++I   V Y HE   +HRDLKLEN+LL  
Sbjct: 105 MVLEYCSGHELYEHLLK-EQRLSLEESKKLFSQIASAVYYAHELKCVHRDLKLENVLLD- 162

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
             GN                ++ DFG  +++         CG+  Y++PE++    YDG 
Sbjct: 163 --GN-------------GHAKLTDFGFTREMATRSQLETICGTTVYMAPELIERKCYDGF 207

Query: 447 LSDTWAMGVILYSLLEDRLPFD 468
             D W++G+ILY+++   +PFD
Sbjct: 208 KVDIWSLGIILYTMINGYMPFD 229

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 97/388 (25%), Positives = 172/388 (44%), Gaps = 73/388 (18%)

Query: 99   TPMVYSPMSPAVLNK--SPQAIKSTEMKINIPKR----RAQYKPNLDGLIG-SKPIRIIS 151
            T  + SP SP  L+   SP+ + S+  + + P R     + Y+   DGL G +KP+    
Sbjct: 1053 TEGIASPTSPKSLDSLLSPKNVASSRTEPSTPSRPVPPDSSYEFIQDGLNGKNKPL---- 1108

Query: 152  EVVPTPDTAQQRVISLPTVSEETT-TENDKFPIHHD-----GTALADDSNSQEDDIVLMG 205
                TP    +R  ++ T++ E +    +   +        GT + + + +    I    
Sbjct: 1109 NQAKTP----KRTKTIRTIAHEASLARKNSVKLKRQNTKMWGTRMVEVTENHMVSINKAK 1164

Query: 206  YRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRS 265
               GEY K   W K + IG G+F  V L  ++   +     +AVK++  P+        S
Sbjct: 1165 NSKGEY-KEFAWMKGEMIGKGSFGAVYLCLNVTTGE----MMAVKQVEVPK-------YS 1212

Query: 266  ANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPC 325
            +  + +L  ++ +L  E+S L  L+H  IV+  G       E+   +Y            
Sbjct: 1213 SQNEAILSTVE-ALRSEVSTLKDLDHLNIVQYLG------FENKNNIY------------ 1253

Query: 326  NLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLK 385
            +L + Y  GG +  ++ +  G  D  LI+ L T++L G+ YLH   I+HRD+K +N+LL 
Sbjct: 1254 SLFLEYVAGGSV-GSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLL- 1311

Query: 386  VPLGNIRSLKDKDIYYEHSFVEIADFGLCKK---IEPDELCTARCGSEDYVSPEILMGVP 442
                      D+D        +I+DFG+ +K   I  +   T R G+  +++PE++    
Sbjct: 1312 ----------DQD-----GICKISDFGISRKSKDIYSNSDMTMR-GTVFWMAPEMVDTKQ 1355

Query: 443  YDGHLSDTWAMGVILYSLLEDRLPFDPL 470
                  D W++G I+  +   + P+  L
Sbjct: 1356 GYSAKVDIWSLGCIVLEMFAGKRPWSNL 1383

>Scas_700.28
          Length = 896

 Score = 84.3 bits (207), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 89/194 (45%), Gaps = 37/194 (19%)

Query: 276 DNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG 335
           D ++ RE+      ++P I KL+ V   +  E+                  + + YC G 
Sbjct: 73  DPNIVREVFYHRQFDYPYITKLYEV---IITET---------------KVWMALEYCPGK 114

Query: 336 DLL-AAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSL 394
           +L    +S      D  +  +LF +I+ GV Y H  N +HRDLKLENILL          
Sbjct: 115 ELYDRVLSMHRVPTDECV--QLFAQIVGGVHYAHSLNCVHRDLKLENILLD--------- 163

Query: 395 KDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMG 454
           K  D        ++ DFG  ++          CG+  Y++PE++    YDG   D W++G
Sbjct: 164 KSGD-------AKLTDFGFTRECMTKTTLETICGTTVYMAPELIERKSYDGFKIDIWSLG 216

Query: 455 VILYSLLEDRLPFD 468
           VILY+++   +PFD
Sbjct: 217 VILYTMINGSMPFD 230

>Scas_700.54
          Length = 698

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 103/223 (46%), Gaps = 42/223 (18%)

Query: 270 ELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIM 329
           +++G ++  ++RE+ VL  L+HP IV+L G     F E     Y             ++M
Sbjct: 258 KVMGNME-GVSRELEVLQQLDHPRIVRLKG-----FYEDKDSYY-------------MVM 298

Query: 330 SYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLG 389
            +  GGDL+  ++   G +     + +  +IL  VKY+H   I HRDLK +NIL++    
Sbjct: 299 EFVSGGDLMDFVA-AHGAVGEEAGKEISRQILEAVKYIHSKGISHRDLKPDNILIE---- 353

Query: 390 NIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH--- 446
                +D  +      V+I DFGL K           CG+  YV+PE++ G         
Sbjct: 354 -----QDDPV-----LVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIGGKGETNEERN 403

Query: 447 ----LSDTWAMGVILYSLLEDRLPFDPLPGASI-RQKNRPTAH 484
               L D W+MG ++Y +L   LPF       + +Q +R + H
Sbjct: 404 EYSSLVDMWSMGCLVYVILTGHLPFSGSTQEQLYKQISRGSYH 446

>Scas_707.34
          Length = 905

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 90/343 (26%), Positives = 142/343 (41%), Gaps = 63/343 (18%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAV--KRIRYPQ--ELKDI-RNRSANFDELLGRL 275
           K IG G+F+ V     I    P L Q  V    I  P    +K + R++  N      +L
Sbjct: 42  KEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPRSKLKN-----KKL 96

Query: 276 DNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG 335
             +L  EI++L  ++HP IVKL       F  + +  Y             LIM YC  G
Sbjct: 97  LENLEIEIAILKKISHPHIVKLID-----FERTSKDFY-------------LIMEYCSLG 138

Query: 336 DL---LAAMSQCSGN--------------------LDRWLIQRLFTEILLGVKYLHEHNI 372
           DL   +    Q   N                    L +  I     ++   +K+L   N+
Sbjct: 139 DLTFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNL 198

Query: 373 IHRDLKLENILLKVPLGNI---RSLKDKDIY--YEHSFVEIADFGLCKKIEPDELCTARC 427
           +HRD+K +N+LL  PL N    +S  D      Y    ++IADFG  + +    +    C
Sbjct: 199 VHRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFARFLPNTSMAETLC 258

Query: 428 GSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLPGASIRQKNRPTAHRIA 487
           GS  Y++PEIL    Y+   +D W++G +LY +     PF       + +K +     I 
Sbjct: 259 GSPLYMAPEILNYQKYNAK-ADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKANDLIY 317

Query: 488 RFEWKWHKMIEDDSSAKEIVNNTLTRKNQ-RWNCNDIFNSAFI 529
                +   IE D++ K +++  LT   Q R   ++ FN+  +
Sbjct: 318 -----FPTYIEIDNNLKSLISKLLTFDPQERIEFDEFFNNELV 355

>Scas_651.18
          Length = 371

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 121/259 (46%), Gaps = 56/259 (21%)

Query: 209 GEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANF 268
           G+YT    ++ ++T+G G+F  V L  S   ++     + V +     +LK + + +   
Sbjct: 52  GKYTLN-DFQILRTLGTGSFGRVHLIRS--NHNGRFYALKVLKKHTIVKLKQVEHTN--- 105

Query: 269 DELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLI 328
           DE L            +L+ ++HP +V+++G                    Q      +I
Sbjct: 106 DERL------------MLSVVSHPFLVRMWGT------------------FQDFEQVFMI 135

Query: 329 MSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPL 388
           M Y  GG+L + + + S      + +    E+ L ++YLH  +II+RDLK ENILL    
Sbjct: 136 MDYIEGGELFSLLRK-SQRFPNPVAKFYAAEVCLALEYLHSMDIIYRDLKPENILL---- 190

Query: 389 GNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLS 448
                  DK+       ++I DFG  K + PD +    CG+ DY++PE++   PY+  + 
Sbjct: 191 -------DKN-----GHIKITDFGFAKYV-PD-ITYTLCGTPDYIAPEVVSTKPYNKSV- 235

Query: 449 DTWAMGVILYSLLEDRLPF 467
           D W+ G+++Y +L    PF
Sbjct: 236 DWWSFGILIYEMLAGYTPF 254

>Kwal_55.20326
          Length = 750

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 131/295 (44%), Gaps = 57/295 (19%)

Query: 191 ADDSNSQEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLL--------YESIDQNDP 242
           + D + +++D++ +  +I        W K   IG G+F  V L          ++ Q + 
Sbjct: 435 SGDLDEEDEDVISLPTKIA---TPKNWLKGARIGSGSFGSVYLGMNAQTGELMAVKQVEL 491

Query: 243 ELLQVAVKRIRYPQELKDIRNRSAN------FDELLGRLDNSLTREISVLNSLNHPCIVK 296
           +   VA   +  P E+K   N++AN        ++  ++ ++L  E+ +L  L H  IV 
Sbjct: 492 QPTAVAAGVVSVPDEVKKQYNQNANGSAVKNSSQVHRKMVDALQHEMGLLKELQHENIVT 551

Query: 297 LFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRL 356
            +G +                  Q+    N+ + Y  GG + ++M    G  +  LI+  
Sbjct: 552 YYGSS------------------QEGGNLNIFLEYVPGGSV-SSMLNSYGPFEEPLIRNF 592

Query: 357 FTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKK 416
             +IL+G+ YLH  +IIHRD+K  NIL+ +                   V+I DFG+ KK
Sbjct: 593 TRQILIGLSYLHRKDIIHRDIKGANILIDI----------------KGCVKITDFGISKK 636

Query: 417 IEP-DELCTARC---GSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           + P ++    R    GS  +++PE++  V      +D W++G ++  +   + PF
Sbjct: 637 LSPLNQQQNKRASLQGSVYWMAPEVVKQV-VTTKKADIWSVGCVIIEMFTGKHPF 690

>Kwal_23.3590
          Length = 499

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 118/258 (45%), Gaps = 51/258 (19%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLT 280
           K +G G+++  ++ E+ID++  +++ V +    +  +  D + ++  F E          
Sbjct: 190 KELGSGHYA--IVKEAIDKDSGDVVAVKI----FHAQHNDDQKKTKQFRE---------- 233

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
            E  +L S+ H  IVKL       F+E          + +  +   L++     G+L   
Sbjct: 234 -ETKILMSIQHKNIVKLID----RFVEP---------VSKAQIQTFLVLEKVSDGELFDR 279

Query: 341 MSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIY 400
           + + +  L       +F +IL G++YLH  NIIHRD+K ENILL     +IR  +  D  
Sbjct: 280 IVRKT-RLREDETNAIFKQILNGLRYLHAKNIIHRDIKPENILL-----SIRKRRHSD-- 331

Query: 401 YEHSF-----------VEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSD 449
            E              ++IADFGL K I   +     CG+  YV+PE+L    Y   + D
Sbjct: 332 -EQQLGPWDDDEIDITIKIADFGLAKFIGEMQFTNTLCGTPSYVAPEVLTKTGYTSRV-D 389

Query: 450 TWAMGVILYSLLEDRLPF 467
            W+ GV+LY  L    PF
Sbjct: 390 MWSAGVLLYVCLCGFPPF 407

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 118/278 (42%), Gaps = 69/278 (24%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLT 280
           K IG G+F+ V  Y      DP+   +AVK +   +    ++N+         +L  +L 
Sbjct: 15  KEIGKGSFATV--YRGHVTTDPKS-HIAVKAVARSK----LKNK---------KLLENLE 58

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
            EI++L  + HP IV L        I+  R   D            L+M YC  GDL   
Sbjct: 59  IEIAILKKIKHPHIVGL--------IDCERTTTDFY----------LVMDYCALGDLTFL 100

Query: 341 M-----------------------SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDL 377
           +                       S+    L+R  +     ++   +K+L   N++HRD+
Sbjct: 101 IKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDI 160

Query: 378 KLENILLKVPLGNIRSLKDKDIYYEHSFV--------EIADFGLCKKIEPDELCTARCGS 429
           K +N+LL  PL N R   D   ++E  +V        +IADFG  + +    L    CGS
Sbjct: 161 KPQNLLLATPLTNYR---DSKTFHELGYVGIYNLPILKIADFGFARFLPSTSLAETLCGS 217

Query: 430 EDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
             Y++PEIL    Y+   +D W++G +L+ +     PF
Sbjct: 218 PLYMAPEILNYQKYNAK-ADLWSVGTVLFEMCCGVPPF 254

>Scas_711.25
          Length = 1515

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 118/262 (45%), Gaps = 52/262 (19%)

Query: 209  GEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANF 268
            GEY K   W K + IG G+F  V L  ++   +     +AVK++  P        + ++ 
Sbjct: 1207 GEY-KEFAWMKGEMIGKGSFGAVYLCLNVTTGE----MMAVKQVEVP--------KYSSQ 1253

Query: 269  DELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLI 328
            DE +     +L  E+S L  L+H  IV+  G  +   I S                  L 
Sbjct: 1254 DEAIISTVEALRSEVSTLKDLDHLNIVQYLGFENKDNIYS------------------LF 1295

Query: 329  MSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPL 388
            + Y  GG +  ++ +  G  D  LI+ L T++L G+ YLH   I+HRD+K +N+LL    
Sbjct: 1296 LEYVAGGSV-GSLIRMYGRFDEPLIRHLNTQVLRGLAYLHSRGILHRDMKADNLLL---- 1350

Query: 389  GNIRSLKDKDIYYEHSFVEIADFGLCKK---IEPDELCTARCGSEDYVSPEILMGVPYDG 445
                   D+D        +I+DFG+ +K   I  +   T R G+  +++PE++       
Sbjct: 1351 -------DQD-----GVCKISDFGISRKSKDIYSNSDMTMR-GTVFWMAPEMVDTKQGYS 1397

Query: 446  HLSDTWAMGVILYSLLEDRLPF 467
               D W++G I+  +   + P+
Sbjct: 1398 AKVDIWSLGCIVLEMFAGKRPW 1419

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 118/248 (47%), Gaps = 55/248 (22%)

Query: 220 VKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSL 279
           ++T+G G+F  V L  S   ++     + V +     +LK + + +              
Sbjct: 148 LRTLGTGSFGRVHLVRS--NHNGRFYAMKVLKKNTVVKLKQVEHTND------------- 192

Query: 280 TREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLA 339
             E ++L+ ++HP I++++G     F +S           Q+L    +IM Y  GG+L +
Sbjct: 193 --ERNMLSIVSHPFIIRMWGT----FQDS-----------QQLF---MIMDYIEGGELFS 232

Query: 340 AMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDI 399
            + + S      + +    E+ L ++YLH   II+RDLK ENILL           DK+ 
Sbjct: 233 LLRK-SQRFPNPVAKFYAAEVCLALEYLHSKGIIYRDLKPENILL-----------DKN- 279

Query: 400 YYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYS 459
                 +++ DFG  K + PD   T  CG+ DY++PE++   PY+  + D W+ GV++Y 
Sbjct: 280 ----GHIKLTDFGFAKYV-PDVTYTL-CGTPDYIAPEVVSTKPYNKSV-DWWSFGVLIYE 332

Query: 460 LLEDRLPF 467
           +L    PF
Sbjct: 333 MLAGYTPF 340

>Kwal_33.13846
          Length = 375

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 114/248 (45%), Gaps = 55/248 (22%)

Query: 220 VKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSL 279
           ++T+G G+F  V L  S   ++     + V + R   +LK + +             N  
Sbjct: 68  LRTLGTGSFGRVHLVRS--NHNGRFYAMKVLKKRTIVKLKQVEH------------TNDE 113

Query: 280 TREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLA 339
            R +SV++   HP I++++G                    Q      +IM Y  GG+L +
Sbjct: 114 RRMLSVVS---HPFIIRMWGT------------------FQDAEHVFMIMDYIEGGELFS 152

Query: 340 AMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDI 399
            + + S      + +    E+ L ++YLH  +II+RDLK EN+LL           DK+ 
Sbjct: 153 LLRK-SQRFPNPVAKFYAAEVCLALEYLHAQDIIYRDLKPENVLL-----------DKN- 199

Query: 400 YYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYS 459
                 V+I DFG  K + PD   T  CG+ DY++PE++   PY+  + D W+ G++++ 
Sbjct: 200 ----GHVKITDFGFAKFV-PDVTYTL-CGTPDYIAPEVVSTKPYNKSV-DWWSFGILIFE 252

Query: 460 LLEDRLPF 467
           +L    PF
Sbjct: 253 MLAGYTPF 260

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 133/310 (42%), Gaps = 62/310 (20%)

Query: 178 NDKFPIHHDGTALADDSNSQEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESI 237
           NDK  ++   T    + +  ED I L      +      W K   IG G+F  V  Y  +
Sbjct: 404 NDKIELYSTDTDTEGEEDDAEDTISLPT----KVEAPKSWLKGARIGSGSFGSV--YLGM 457

Query: 238 DQNDPELL---QVAVKRIRYPQELKDIRNRSA-------------NFDELLGRLDNSLTR 281
           +    EL+   QV +K       +  I + S              N  ++  ++ ++L  
Sbjct: 458 NAETGELMAVKQVELKPTAVTAGVVSIADESKKAHSPGGGNTAVKNTSQIHRKMIDALQH 517

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
           E+++L  L+H  IV  +G +                  Q+    N+ + Y  GG + ++M
Sbjct: 518 EMNILKELHHENIVTYYGSS------------------QEGGNLNIFLEYVPGGSV-SSM 558

Query: 342 SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYY 401
               G  D  L++    +IL+G+ YLH+ NIIHRD+K  NIL+ +  G            
Sbjct: 559 LNNYGPFDEPLVKNFTRQILIGLAYLHKRNIIHRDIKGANILIDIKGG------------ 606

Query: 402 EHSFVEIADFGLCKKIEP-DELCTARC---GSEDYVSPEILMGVPYDGHLSDTWAMGVIL 457
               V+I DFG+ KK+ P ++    R    GS  +++PE++  V      +D W++G ++
Sbjct: 607 ----VKITDFGISKKLSPLNKQQNKRASLQGSVYWMAPEVVKQV-VTTEKADIWSVGCVI 661

Query: 458 YSLLEDRLPF 467
             +   + PF
Sbjct: 662 VEMFTGKHPF 671

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 149/331 (45%), Gaps = 67/331 (20%)

Query: 145 KPIRIISEVVPTPDTAQQRV-ISLPTVSEETTTENDKFPIHHDGTALADDSNSQEDDIVL 203
           + + I ++   TPD   Q + ++  +V EE ++     P+  +G             I L
Sbjct: 12  RKLSITAKTETTPDNVGQDIPVNAHSVHEECSSNT---PVEINGRNSGKLKEEASAGICL 68

Query: 204 -----MGYR--IGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQ 256
                + YR   G+Y+ +  ++ ++T+G G+F  V L  S   ++     +   +     
Sbjct: 69  VKKPMLQYRDTSGKYSLS-DFQILRTLGTGSFGRVHLIRS--NHNGRFYALKTLKKHTIV 125

Query: 257 ELKDIRNRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDML 316
           +LK + + +                E  +L+ ++HP I++++G     F +S +      
Sbjct: 126 KLKQVEHTND---------------ERRMLSIVSHPFIIRMWGT----FQDSQQVF---- 162

Query: 317 KLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRD 376
                     ++M Y  GG+L + + + S      + +    E+ L ++YLH  +II+RD
Sbjct: 163 ----------MVMDYIEGGELFSLLRK-SQRFPNPVAKFYAAEVCLALEYLHSKDIIYRD 211

Query: 377 LKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPE 436
           LK ENILL           DK+       ++I DFG  K + PD   T  CG+ DY++PE
Sbjct: 212 LKPENILL-----------DKN-----GHIKITDFGFAKYV-PDVTYTL-CGTPDYIAPE 253

Query: 437 ILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           ++   PY+  + D W+ GV++Y +L    PF
Sbjct: 254 VVSTKPYNKSV-DWWSFGVLIYEMLAGYTPF 283

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 92/199 (46%), Gaps = 41/199 (20%)

Query: 277 NSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGD 336
           + + RE+ VL  LNHP IVKL       F E     Y             ++M +  GGD
Sbjct: 233 DGVKRELDVLQKLNHPRIVKL-----KDFFEDNDNYY-------------MLMEFVSGGD 274

Query: 337 LLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKD 396
           L+  ++   G +     + +  ++L  VKY+H+  I HRDLK +NI+++         +D
Sbjct: 275 LMDFVA-AHGTVGEDAGREITRQVLEAVKYMHDQGISHRDLKPDNIMIE---------QD 324

Query: 397 KDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYD--------GHLS 448
             +      ++I DFGL K    +      CG+  YV+PE++ G   +          L 
Sbjct: 325 DPV-----LIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEVIDGKNAEDKTNRDLYSSLV 379

Query: 449 DTWAMGVILYSLLEDRLPF 467
           D W++G ++Y +L   LPF
Sbjct: 380 DMWSIGCLVYVILTGHLPF 398

>Kwal_26.8796
          Length = 796

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 98/205 (47%), Gaps = 41/205 (20%)

Query: 270 ELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIM 329
           +++G +D  + RE+ VL  L+HP IV L G     F E     Y             L+M
Sbjct: 223 KVVGVMDG-VARELEVLQRLDHPRIVSLKG-----FYEDKDSHY-------------LVM 263

Query: 330 SYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLG 389
            +  GGDL+  ++   G++     + +  +IL  VKY+H   I HRDLK +NIL++    
Sbjct: 264 EFVSGGDLMDFVA-AHGSVGEDAGREITRQILEAVKYIHSMGISHRDLKPDNILIE---- 318

Query: 390 NIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGV---PYDGH 446
                +D  +      V+I DFGL K           CG+  YV+PE++ G      +G+
Sbjct: 319 -----RDDPV-----LVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVISGKNSGEKEGN 368

Query: 447 ----LSDTWAMGVILYSLLEDRLPF 467
               L D W++G ++Y +L   LPF
Sbjct: 369 TYSSLVDMWSIGCLVYVILTGHLPF 393

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 123/269 (45%), Gaps = 64/269 (23%)

Query: 214  ALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLG 273
            +++W+K   IG G+F  V  Y +++ +  ++L  AVK I++            N  + + 
Sbjct: 1188 SIKWQKRSFIGGGSFGSV--YSAVNLDTGDIL--AVKEIKF------------NDRKTIK 1231

Query: 274  RLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCV 333
            ++  S+  E++VL  LNHP +V+ +GV     +   R               N+ M YC 
Sbjct: 1232 QVFPSIRDEMTVLEMLNHPNVVQYYGVE----VHRDR--------------VNIFMEYCE 1273

Query: 334  GGDLLAAMSQCSGNLDRWLIQRLFT-EILLGVKYLHEHNIIHRDLKLENILLKVPLGNIR 392
            GG L + ++   G ++  ++ ++++ ++L G+ YLHE  + HRD+K ENILL        
Sbjct: 1274 GGSLASLLAH--GRIEDEMVTQVYSLQMLEGLAYLHESGVDHRDIKPENILLDF------ 1325

Query: 393  SLKDKDIYYEHSFVEIADFGLCK----------KIEPDELCTARCGSEDYVSPEILMGVP 442
                      +  ++  DFG  K           +E         G+  Y+SPE + G  
Sbjct: 1326 ----------NGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAISGTG 1375

Query: 443  YDGHLS-DTWAMGVILYSLLEDRLPFDPL 470
            Y    S D W++G ++  ++  R P+  L
Sbjct: 1376 YGKFGSDDIWSLGCVILEMVTGRRPWANL 1404

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 129/305 (42%), Gaps = 74/305 (24%)

Query: 194 SNSQEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIR 253
           S+   D +V    R+     +++    K IG G+F+  ++Y+ +   D     +A+K + 
Sbjct: 2   SSESHDKVVAKAIRLPTENYSVE----KEIGKGSFA--VVYKGLSLRDGR--NIAIKAVS 53

Query: 254 YPQELKDIRNRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLY 313
             +    ++N+         +L  +L  EI++L  + HP IV L        I+  R   
Sbjct: 54  RSK----LKNK---------KLLENLEVEIAILKKIKHPHIVGL--------IDCERTSS 92

Query: 314 DMLKLRQKLVPCNLIMSYCVGGDLLAAM-----------------------SQCSGNLDR 350
           D            LIM YC  GDL   +                       S     L+R
Sbjct: 93  DFY----------LIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPPSTEHNGLNR 142

Query: 351 WLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFV---- 406
            L+     ++   +K+L   N++HRD+K +N+LL  PL +     D   ++E  FV    
Sbjct: 143 VLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDY---NDPKTFHELGFVGIYN 199

Query: 407 ----EIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLE 462
               +IADFG  + +    L    CGS  Y++PEIL    Y+   +D W++G +LY +  
Sbjct: 200 LPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNAK-ADLWSVGTVLYEMCC 258

Query: 463 DRLPF 467
            R PF
Sbjct: 259 GRPPF 263

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 106/247 (42%), Gaps = 60/247 (24%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLT 280
           KT+G G F  V   ++ +  +   +++ +K        K ++      + L   LD    
Sbjct: 41  KTLGAGTFGVVRQAKNTETGEDVAVKILIK--------KALKGNKVQLEALYDELD---- 88

Query: 281 REISVLNSLNHPCIVKL---FGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDL 337
               +L  L+HP IV     F   D  +I                     I     GG+L
Sbjct: 89  ----ILQRLHHPNIVAFKDWFESKDKFYI---------------------ITQLAKGGEL 123

Query: 338 LAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDK 397
              + +  G        R+  EIL  VKY+H  NI+HRDLK EN+L            DK
Sbjct: 124 FDRILK-KGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLL----------YIDK 172

Query: 398 DIYYEHSFVEIADFGLCKKIEPD-ELCTARCGSEDYVSPEILMGVPYDGHLS--DTWAMG 454
               + S + +ADFG+ K+++ D EL     GS  YV+PE+L     DGH    D W++G
Sbjct: 173 S---DESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLT---QDGHGKPCDIWSIG 226

Query: 455 VILYSLL 461
           VI Y+LL
Sbjct: 227 VITYTLL 233

>Scas_627.7
          Length = 349

 Score = 79.7 bits (195), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 89/195 (45%), Gaps = 38/195 (19%)

Query: 275 LDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVG 334
           L     RE+ +  SLNHP + KL+G     F +  R                L+M Y V 
Sbjct: 132 LQKQFRREVEIQTSLNHPNLTKLYG----HFHDEKR--------------VYLLMEYLVY 173

Query: 335 GDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSL 394
           G+L   + +  G  +  +  R   +I   + YLH+  IIHRDLK ENIL+          
Sbjct: 174 GELYKLL-RSHGPFNDVIASRFVFQIADALNYLHDKQIIHRDLKPENILIGF-------- 224

Query: 395 KDKDIYYEHSFVEIADFGLCKKIEPDELC-TARCGSEDYVSPEILMGVPYDGHLSDTWAM 453
                   ++ +++ DFG    I P  +     CG+ DY+SPE++    YD  + D WA+
Sbjct: 225 --------NNVIKLTDFGWS-IINPRGVKRKTLCGTIDYLSPEMIRSREYDDKV-DVWAL 274

Query: 454 GVILYSLLEDRLPFD 468
           GV+ Y L+    PF+
Sbjct: 275 GVLTYELIVGSPPFE 289

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 81.6 bits (200), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 118/262 (45%), Gaps = 52/262 (19%)

Query: 209  GEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANF 268
            GEY K   W K + IG G+F  V  Y +++    E+L  AVK++  P+         ++ 
Sbjct: 1031 GEY-KEFAWIKGEIIGKGSFGAV--YLALNVTTGEML--AVKQVTVPE--------FSSQ 1077

Query: 269  DELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLI 328
            DE    +  +L  E+S L  LNH  IV+  G  +   I S                  L 
Sbjct: 1078 DESAISMVEALKSEVSTLKDLNHVNIVQYLGFEEKNGIYS------------------LF 1119

Query: 329  MSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPL 388
            + Y  GG +  ++ +  G  D  LI+ L  ++L G+ YLH   I+HRD+K +N+LL    
Sbjct: 1120 LEYVAGGSV-GSLIRMYGRFDDQLIRHLTKQVLEGLAYLHSKGILHRDMKADNLLL---- 1174

Query: 389  GNIRSLKDKDIYYEHSFVEIADFGLCKK---IEPDELCTARCGSEDYVSPEILMGVPYDG 445
                   D D        +I+DFG+ +K   I  +   T R G+  +++PE++       
Sbjct: 1175 -------DND-----GVCKISDFGISRKSNNIYSNSDMTMR-GTVFWMAPEMVDTAHGYS 1221

Query: 446  HLSDTWAMGVILYSLLEDRLPF 467
               D W++G ++  +   + P+
Sbjct: 1222 AKVDIWSLGCVVLEMFAGKRPW 1243

>Kwal_47.17252
          Length = 872

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 96/225 (42%), Gaps = 53/225 (23%)

Query: 274 RLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCV 333
           +L  +L  EI++L  + HP IV L            R   D            LIM YC 
Sbjct: 63  KLLENLEIEIAILKKIKHPHIVGLMDCE--------RTGADFF----------LIMEYCA 104

Query: 334 GGDLLAAMSQCSG-----------------------NLDRWLIQRLFTEILLGVKYLHEH 370
            GDL   + +  G                        L+R ++     ++   + +L   
Sbjct: 105 LGDLTFLIKKRGGLIEKHPLVRTMFEKYPPPSESHNGLNRVVVVSYLQQLSSALMFLRSK 164

Query: 371 NIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFV--------EIADFGLCKKIEPDEL 422
           N++HRD+K +N+LL  PL N     D++ +++  FV        +IADFG  + +    L
Sbjct: 165 NLVHRDIKPQNLLLSTPLVN---YSDRETFHKMGFVGIYNLPILKIADFGFARFLPNTSL 221

Query: 423 CTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
               CGS  Y++PEIL    Y+   +D W++G +LY +   R PF
Sbjct: 222 AETLCGSPLYMAPEILDYQKYNAK-ADLWSVGTVLYEMCCGRPPF 265

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 92/186 (49%), Gaps = 38/186 (20%)

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
           E  +L+ ++HP I++++G     F +S                  ++M Y  GG+L + +
Sbjct: 200 ERRMLSIVSHPFIIRMWGT----FQDSQHVF--------------MVMDYIEGGELFSLL 241

Query: 342 SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYY 401
            + S      + +    E+ L ++YLH   II+RDLK ENILL           DK+   
Sbjct: 242 RK-SQRFPNPVAKFYAAEVCLALEYLHSKEIIYRDLKPENILL-----------DKN--- 286

Query: 402 EHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLL 461
               ++I DFG  K + PD   T  CG+ DY++PE++   PY+  + D W+ G+++Y +L
Sbjct: 287 --GHIKITDFGFAKYV-PDVTYTL-CGTPDYIAPEVVSTKPYNKSV-DWWSFGILIYEML 341

Query: 462 EDRLPF 467
               PF
Sbjct: 342 AGYTPF 347

>Scas_593.14d
          Length = 495

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 119/270 (44%), Gaps = 59/270 (21%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDEL-LGRL 275
           +R V+ +G G +  V+L +    N       A+K+++  + L     +S   D++ LG+ 
Sbjct: 136 FRPVRVLGQGAYGKVILVKDKLTNK----LYAMKQLKKAEILITESPKSNEEDDVNLGKR 191

Query: 276 DNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG 335
                 E S+L  L HP IVKLF              +D  KL        L++ Y  GG
Sbjct: 192 IERTFAEKSILAELEHPNIVKLF-----------YSFHDNSKLY-------LLLQYIPGG 233

Query: 336 DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLK 395
           +L   + +  G LD   +     EI   +K+LH+  I++RDLK EN LL           
Sbjct: 234 ELFFHLKE-QGTLDEDTVAFYAAEISCALKFLHDKGIVYRDLKPENCLLN---------- 282

Query: 396 DKDIYYEHSFVEIADFGLCKK------IEPDELCTARCGSED------------YVSPEI 437
                 +   + + DFGL KK        P E+ +    SED            Y +PEI
Sbjct: 283 ------DKGHLVLTDFGLSKKSVTQNSANPSEVTSLNEPSEDLSTLHSIIGTPEYCAPEI 336

Query: 438 LMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           L G+PY+ +  D +++G ++Y +L  + P+
Sbjct: 337 LQGLPYNKN-CDWYSLGCLIYDMLSGKPPY 365

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 78/146 (53%), Gaps = 28/146 (19%)

Query: 327  LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
              M +  GGDL+  +     ++ R   +    E+LL +KY H++ +I+RDLKLENILL  
Sbjct: 902  FAMEFIGGGDLMWHVQNQRLSVRR--AKFYAAEVLLALKYFHDNGVIYRDLKLENILL-T 958

Query: 387  PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDEL-----CTARCGSEDYVSPEILMGV 441
            P G+I+               IAD+GLCK    DE+      +  CG+ ++++PEIL   
Sbjct: 959  PEGHIK---------------IADYGLCK----DEMWYGNRTSTFCGTPEFMAPEILKEQ 999

Query: 442  PYDGHLSDTWAMGVILYSLLEDRLPF 467
             Y   + D WA GV+LY +L  + PF
Sbjct: 1000 EYTKAV-DWWAFGVLLYQMLLCQSPF 1024

>Kwal_23.6325
          Length = 1542

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 124/269 (46%), Gaps = 67/269 (24%)

Query: 214  ALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLG 273
            +++W+K + +G G F  V  + +++ +  E+L  AVK I+       I++R +     + 
Sbjct: 1246 SIRWQKRQFVGGGAFGTV--FSAVNLDTGEIL--AVKEIK-------IQDRKS-----MK 1289

Query: 274  RLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCV 333
            ++  ++  E+SVL  LNHP +V+ +GV                  R K+   NL M YC 
Sbjct: 1290 QVFPAIKEEMSVLEMLNHPNVVQYYGVEVH---------------RDKV---NLFMEYCE 1331

Query: 334  GGDLLAAMSQCSGNLDRWLIQRLFT-EILLGVKYLHEHNIIHRDLKLENILLKVPLGNIR 392
            GG L   +    G ++  ++ +++  ++L G+ YLH+ +++HRD+K ENILL        
Sbjct: 1332 GGSLAQLLEH--GRIEDEMVTQIYALQMLEGLAYLHQSSVVHRDIKPENILLDF------ 1383

Query: 393  SLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSED-------------YVSPEILM 439
                      +  ++  DFG  + +  +       G+E              Y+SPE + 
Sbjct: 1384 ----------NGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPESIT 1433

Query: 440  GVPYDGHLS-DTWAMGVILYSLLEDRLPF 467
            G       S D W++G ++  ++  R P+
Sbjct: 1434 GAKKGKFGSGDIWSLGCVILEMVTGRRPW 1462

>KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183
           Saccharomyces cerevisiae YDL025c, hypothetical start
          Length = 292

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 105/266 (39%), Gaps = 74/266 (27%)

Query: 280 TREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLA 339
            +E  +L  LNH CI++    N                 ++K        SY V    L 
Sbjct: 61  VKEYELLKKLNHKCIIEALDCN-----------------KRKHTITFPYYSYTVL--YLM 101

Query: 340 AMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDI 399
            MS      +R L    F +I  G+ YLH HNI+HRDLKLENI++   L NI+       
Sbjct: 102 KMSMLPTFEERAL---WFCQICEGIAYLHSHNIVHRDLKLENIMVDESLCNIK------- 151

Query: 400 YYEHSFVEIADFGLCKKIEPD-ELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILY 458
                   I DFG    + P+ E C    GSE  ++PE+   + Y+G   D W++G++++
Sbjct: 152 --------IIDFGSAVDVGPNKEACHGIRGSEQLMAPEVFQRLKYEGTPVDMWSLGIMMF 203

Query: 459 SLLEDRLPFDPLPGASIRQKNRPTAHRIARFEWKWHKMIEDDSSAKEIVNNTLTRK---- 514
               +               N+P       F WK  K+  DD + +    N  T      
Sbjct: 204 EFFNN--------------SNKPA------FPWKIAKI--DDVAFEAYTKNPTTLNISID 241

Query: 515 ----------NQRWNCNDIFNSAFIQ 530
                      QR +  D+ N +F Q
Sbjct: 242 LCMKLLSVDVKQRLSIQDVINDSFFQ 267

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 91/186 (48%), Gaps = 38/186 (20%)

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
           E  +L+ ++HP I++++G                    Q      +IM Y  GG+L + +
Sbjct: 124 ERKMLSVVSHPFIIRMWGT------------------FQDAHQVFMIMDYIEGGELFSLL 165

Query: 342 SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYY 401
            + S      + +    E+ L ++YLH  +II+RDLK ENILL           DK+   
Sbjct: 166 RK-SQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILL-----------DKN--- 210

Query: 402 EHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLL 461
               +++ DFG  K + PD   T  CG+ DY++PE++   PY+  + D W+ G+++Y +L
Sbjct: 211 --GHIKLTDFGFAKYV-PDVTYTL-CGTPDYIAPEVVSTKPYNKSV-DWWSFGILIYEML 265

Query: 462 EDRLPF 467
               PF
Sbjct: 266 AGYTPF 271

>Scas_715.34
          Length = 1150

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 78/142 (54%), Gaps = 20/142 (14%)

Query: 327  LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
              M +  GGDL+  +     ++ R   +    E+LL +KY H++ +I+RDLKLENILL  
Sbjct: 901  FAMEFIGGGDLMWHVQNQRLSVRR--AKFYAAEVLLALKYFHDNGVIYRDLKLENILL-T 957

Query: 387  PLGNIRSLKDKDIYYEHSFVEIADFGLCK-KIEPDELCTARCGSEDYVSPEILMGVPYDG 445
            P G+I+               IAD+GLCK ++  +   +  CG+ ++++PEIL    Y  
Sbjct: 958  PQGHIK---------------IADYGLCKDEMWYNNKTSTFCGTPEFMAPEILKEQGYTR 1002

Query: 446  HLSDTWAMGVILYSLLEDRLPF 467
             + D WA GV+LY +L  + PF
Sbjct: 1003 AV-DWWAFGVLLYQMLLCQSPF 1023

>Kwal_0.96
          Length = 427

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 109/257 (42%), Gaps = 68/257 (26%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLT 280
           KT+G G+F  V     +   +   +++ +K+    +++           EL       L 
Sbjct: 50  KTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDV-----------EL-----QMLY 93

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
            E+S+L  L+HP IVK        + ES    Y             ++     GG+L   
Sbjct: 94  DELSILQKLDHPNIVKF-----KDWFESKDKFY-------------IVTQLATGGEL--- 132

Query: 341 MSQCSGNLDRWLIQRLFTE---------ILLGVKYLHEHNIIHRDLKLENILLKVPLGNI 391
                   DR L Q  FTE         IL  V+YLH  NI+HRDLK EN+L      + 
Sbjct: 133 -------FDRILKQGKFTEEDAVRIVYQILKAVEYLHSRNIVHRDLKPENLLYLTEAAD- 184

Query: 392 RSLKDKDIYYEHSFVEIADFGLCKKIE-PDELCTARCGSEDYVSPEILMGVPYDGHLSDT 450
                       S + + DFG+ K+++  DEL     GS  YV+PE++    + G   D 
Sbjct: 185 ------------SQLVLGDFGIAKELKNDDELIHKAAGSMGYVAPEVVTTSGH-GKPCDI 231

Query: 451 WAMGVILYSLLEDRLPF 467
           W++GV+ Y+LL    PF
Sbjct: 232 WSLGVVTYTLLCGYSPF 248

>Kwal_56.24091
          Length = 381

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 85/190 (44%), Gaps = 36/190 (18%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLL 338
             RE+ + +SL HP + +L+G     +    + +Y             L+M Y V G+L 
Sbjct: 168 FRREVEIQSSLKHPNLTRLYG-----YFHDEKRVY-------------LLMEYLVNGELY 209

Query: 339 AAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKD 398
             + +  G  +         ++   + Y+H  NI+HRD+K ENIL    LG   +LK   
Sbjct: 210 KHL-RSHGPFNDITASHFVHQMADALNYMHSKNILHRDIKPENIL----LGFQNTLK--- 261

Query: 399 IYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILY 458
                    + DFG       +      CG+ DY+SPE++    YD  + D WA+GV+ Y
Sbjct: 262 ---------LTDFGWSVSNVGNSKRKTLCGTMDYLSPELIKSREYDNKV-DVWALGVLTY 311

Query: 459 SLLEDRLPFD 468
            LL    PF+
Sbjct: 312 ELLVGSPPFE 321

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 119/262 (45%), Gaps = 37/262 (14%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLT 280
           K IG G+F+ V      D +   +   AV R +       +RN+         +L  +L 
Sbjct: 22  KEIGRGSFAVVYKGHLADSSAGNVAIKAVSRSK-------LRNK---------KLLENLE 65

Query: 281 REISVLNSLNHPCIVKLF-----GVNDPLFIESCR--PLYDMLKLRQKLVPCNLIMSYCV 333
            EI++L  + HP IV L      G +  L +E C    L   +K R+ L+  + ++    
Sbjct: 66  IEIAILKKIKHPHIVGLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLF 125

Query: 334 GGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRS 393
             +     S+    L+R L+     ++   +K+L   N++HRD+K +N+LL  PL +   
Sbjct: 126 --EKYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTPLVDY-- 181

Query: 394 LKDKDIYYEHSFV--------EIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDG 445
             D   ++   FV        +IADFG  + +    L    CGS  Y++PEIL    Y+ 
Sbjct: 182 -NDPAEFHARGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNA 240

Query: 446 HLSDTWAMGVILYSLLEDRLPF 467
             +D W++G +LY +   + PF
Sbjct: 241 K-ADLWSVGTVLYEMCCGKPPF 261

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 110/253 (43%), Gaps = 60/253 (23%)

Query: 220  VKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSL 279
            +K +G GNF  VLL  S  +N   L  + V +  +  +  DI +  A     L       
Sbjct: 825  LKVLGKGNFGKVLLARS--KNTDRLCAIKVLKKDHIIQNHDIESARAEKKVFL------- 875

Query: 280  TREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLA 339
                 +     HP +  L+        ++   +Y               M +  GGDL+ 
Sbjct: 876  -----LATKAKHPFLTNLY-----CSFQTENRIY-------------FAMEFIGGGDLMW 912

Query: 340  AMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDI 399
             +     ++ R   +    E+LL +KY H++ II+RDLKLENILL +             
Sbjct: 913  HVQNQRLSVRR--AKFYAAEVLLALKYFHDNGIIYRDLKLENILLTL------------- 957

Query: 400  YYEHSFVEIADFGLCKKIEPDEL-----CTARCGSEDYVSPEILMGVPYDGHLSDTWAMG 454
                  ++IAD+GLCK    DE+      +  CG+ ++++PEIL    Y   + D WA G
Sbjct: 958  ---EGHIKIADYGLCK----DEMWFGNRTSTFCGTPEFMAPEILREQAYTKAV-DWWAFG 1009

Query: 455  VILYSLLEDRLPF 467
            V+LY +L  + PF
Sbjct: 1010 VLLYQMLLCQSPF 1022

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 76/142 (53%), Gaps = 20/142 (14%)

Query: 327  LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
              M +  GGDL+  +     ++ R   +    E+LL +KY H++ +I+RDLKLENILL  
Sbjct: 912  FAMEFIGGGDLMWHVQNRRLSVRR--AKFYAAEVLLSLKYFHDNGVIYRDLKLENILL-T 968

Query: 387  PLGNIRSLKDKDIYYEHSFVEIADFGLCK-KIEPDELCTARCGSEDYVSPEILMGVPYDG 445
            P G+I+               IAD+GLCK  +      +  CG+ ++++PEIL G  Y  
Sbjct: 969  PEGHIK---------------IADYGLCKDNMWYGNKTSTFCGTPEFMAPEILKGQAYTK 1013

Query: 446  HLSDTWAMGVILYSLLEDRLPF 467
             + D W  GV+LY +L  + PF
Sbjct: 1014 AV-DWWTFGVLLYQMLLCQSPF 1034

>Scas_689.25*
          Length = 409

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 81/313 (25%), Positives = 135/313 (43%), Gaps = 69/313 (22%)

Query: 168 PTVSEETTTENDKFPIH----HDGTALADDS-----NSQEDDIVL---MGYRI-GEYTKA 214
           P  + E   + + F IH     D   L++ S     NS++ D  L   +G +  G+YT  
Sbjct: 38  PEENHEEKDQQENFTIHTTKRRDANELSESSQNPSGNSEKRDTQLQKVLGKKTSGKYTID 97

Query: 215 LQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGR 274
             +  ++T G G+F  V L  S+       L+V  K+      LK + + +         
Sbjct: 98  -DFNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVV--RLKQVEHTN--------- 145

Query: 275 LDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVG 334
            D      +SV     H  IV+L+G       +    L+             +IM Y  G
Sbjct: 146 -DERRMLSVSV-----HAFIVRLWGT-----FQDSEHLF-------------MIMDYVEG 181

Query: 335 GDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSL 394
           G+L + + + S      + +    E+ L + YLH  +II+RDLK EN+LL          
Sbjct: 182 GELFSLLRR-SQRFPNPVAKFYAAEVCLALDYLHSLDIIYRDLKPENLLLD--------- 231

Query: 395 KDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMG 454
                   +  +++ DFG  K + PD   T  CG+ DY++PE++   PY+  + D W+ G
Sbjct: 232 -------RNGHIKVTDFGFAKYV-PDVTYTL-CGTPDYIAPEVISAKPYNKSV-DWWSFG 281

Query: 455 VILYSLLEDRLPF 467
           +++Y +L    PF
Sbjct: 282 ILIYEMLSGHTPF 294

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 118/280 (42%), Gaps = 72/280 (25%)

Query: 207 RIGEYTKALQWRKVK------TIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKD 260
           + GE  K +  + +K       +G G +S V+L  + D       + AVK +     +K 
Sbjct: 166 KTGEREKKIIRKGIKDFKFGEMVGDGAYSTVMLATAKDSGK----KYAVKVLNKEYLIKQ 221

Query: 261 IRNRSANFDE-LLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLR 319
            + +  N ++  L RL+NS               IVKLF        +    LY      
Sbjct: 222 KKVKYVNIEKNALQRLNNSR-------------GIVKLF-----FTFQDESSLY------ 257

Query: 320 QKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKL 379
                   ++ Y   GD L+ M +  G+L     +    +I+ G+KYLH   IIHRD+K 
Sbjct: 258 -------FLLEYAPNGDFLSVMKKY-GSLSEDCTRYYSAQIIDGIKYLHSKGIIHRDIKP 309

Query: 380 ENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEP---DE---------LCTARC 427
           ENILL           DKD+      V+I DFG  K +EP   DE            +  
Sbjct: 310 ENILL-----------DKDMK-----VKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFV 353

Query: 428 GSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           G+ +YVSPE+L     D    D WA G +++ ++  + PF
Sbjct: 354 GTAEYVSPELLNDSYVDARC-DIWAFGCMVFQMIAGKPPF 392

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 96/214 (44%), Gaps = 47/214 (21%)

Query: 267 NFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCN 326
           N  +++G +D  ++RE+ VL  LNHP IV L       F E     Y             
Sbjct: 220 NKRKVVGNMD-GVSRELEVLQKLNHPRIVSL-----KAFYEDEANYY------------- 260

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           ++M +  GGDL+  ++   G +     + +  +IL  ++Y+H   I HRDLK +NIL++ 
Sbjct: 261 MVMEFISGGDLMDFVA-AHGAVGEEAGREISRQILEAIQYIHSKGISHRDLKPDNILIE- 318

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYD-- 444
                   +D  +      V+I DFGL K      +    CG+  YV+PE++ G      
Sbjct: 319 --------QDDPV-----LVKITDFGLAKVQGNGSIMKTFCGTLAYVAPEVIGGFTGATG 365

Query: 445 -----------GHLSDTWAMGVILYSLLEDRLPF 467
                        L D W+MG +++ +L   LPF
Sbjct: 366 EEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF 399

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 111/249 (44%), Gaps = 54/249 (21%)

Query: 220 VKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSL 279
           +K IG G+F  V+     D N  ++  +   R  Y     ++ +  A             
Sbjct: 385 LKVIGKGSFGKVMQVRKRDTN--KIYALKAIRKSYIVSKSEVTHTLA------------- 429

Query: 280 TREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLA 339
             E +VL  +++P IV L         +S   LY             L++++  GG+L  
Sbjct: 430 --ERTVLARVDNPFIVPL-----KFSFQSSEKLY-------------LVLAFINGGELFY 469

Query: 340 AMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDI 399
            + Q  G  D    +    E+L  ++ LH+ +II+RDLK ENILL               
Sbjct: 470 HL-QREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLD-------------- 514

Query: 400 YYEHSFVEIADFGLCK-KIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILY 458
           Y  H  + + DFGLCK  ++  E  T  CG+ +Y++PE+L+G  Y   + D W +GV+LY
Sbjct: 515 YQGH--IALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY-TKVVDWWTLGVLLY 571

Query: 459 SLLEDRLPF 467
            +L    P+
Sbjct: 572 EMLTGLPPY 580

>Scas_201.1*
          Length = 274

 Score = 75.9 bits (185), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 87/190 (45%), Gaps = 34/190 (17%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLL 338
           L  E+S+L  L+HP IV                  D  + R K     ++     GG+L 
Sbjct: 81  LYDELSILQRLHHPNIV---------------AFKDWFESRDKFY---IVTQLATGGELF 122

Query: 339 AAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKD 398
             + +  G         +  ++L  VKY+H  NI+HRDLK EN+L   P           
Sbjct: 123 DRIIK-KGKFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPENVLYLDP----------- 170

Query: 399 IYYEHSFVEIADFGLCKKIEP-DELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVIL 457
              + S + IADFG+ K+++  D+L     GS  YV+PE+L    + G   D W++GVI 
Sbjct: 171 --SDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVLTKEGH-GKPCDIWSLGVIT 227

Query: 458 YSLLEDRLPF 467
           Y+LL    PF
Sbjct: 228 YTLLSGYSPF 237

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 117/265 (44%), Gaps = 52/265 (19%)

Query: 209  GEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANF 268
            GEY +   W K + IG G+F  V L  ++   +     +AVK++  P        +  + 
Sbjct: 1117 GEY-REFAWIKGEMIGKGSFGAVYLGLNVTTGE----MMAVKQVEVP--------KFGSQ 1163

Query: 269  DELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLI 328
            DE       +L  E+S L  L+H  IV+  G  +   I S                  L 
Sbjct: 1164 DETTVNNAEALISEVSTLKDLDHLNIVQYLGFENKNCIYS------------------LF 1205

Query: 329  MSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPL 388
            + Y  GG +  ++ +  G+ D  LI+ L T++L G+ YLH   I+HRD+K +N+LL    
Sbjct: 1206 LEYVAGGSV-GSLIRLYGHFDEQLIRFLTTQVLEGLAYLHLRGILHRDMKADNLLL---- 1260

Query: 389  GNIRSLKDKDIYYEHSFVEIADFGLCKK---IEPDELCTARCGSEDYVSPEILMGVPYDG 445
                   D D        +I+DFG+ +K   I  +   T R G+  +++PE++       
Sbjct: 1261 -------DND-----GVCKISDFGISRKSNNIYSNSEMTMR-GTVFWMAPEMVDTTQGYS 1307

Query: 446  HLSDTWAMGVILYSLLEDRLPFDPL 470
               D W++G ++  +   + P+  L
Sbjct: 1308 AKVDIWSLGCVVLEMFAGKRPWSNL 1332

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 121/263 (46%), Gaps = 58/263 (22%)

Query: 213 KALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELL 272
           K++Q++  + IG G++   ++Y++ ++   +  +VA+K + Y  +           DEL+
Sbjct: 18  KSVQYQLRQIIGRGSYG--VVYKATNKKTAQ--EVAIKEVNYQDD-----------DELV 62

Query: 273 GRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYC 332
                 +  EI +L +LNH  IVK  G     FI+    LY             +I+ YC
Sbjct: 63  -----DIMSEIDLLKNLNHINIVKYHG-----FIQKQHNLY-------------IILEYC 99

Query: 333 VGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIR 392
             G L   +S+ +  +     +    + L G+ YLHE  +IHRD+K  NILL        
Sbjct: 100 AKGSLKNLISR-NRPMSEHEAKPYVRQTLNGLNYLHEQGVIHRDIKAANILLD------- 151

Query: 393 SLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWA 452
                      + V++ADFG+  K+    +  A  GS ++++PEI+ G      LSD W+
Sbjct: 152 ---------SENVVKLADFGVSTKVNNTAMTLA--GSLNWMAPEII-GNRGASTLSDIWS 199

Query: 453 MGVILYSLLEDRLPFDPLPGASI 475
           +G  +  LL    PF  L   +I
Sbjct: 200 LGATVVELLTGNPPFHNLIDMNI 222

>Scas_628.9
          Length = 621

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 104/256 (40%), Gaps = 51/256 (19%)

Query: 218 RKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDN 277
           R  + +G G F  V +    D    + L  AVK  +        +  S  F++   RL  
Sbjct: 336 RCQEVLGKGAFGTVRICHKKDPKQEKELLFAVKEFK--------KKSSEPFEKYSKRL-- 385

Query: 278 SLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDL 337
             T E  + +SL+H  IV    +      E C                  +M YC GGDL
Sbjct: 386 --TSEFCISSSLHHINIVTTLDLFQDAKGEYCE-----------------VMEYCSGGDL 426

Query: 338 LAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDK 397
            + +   +G L+       F +++ GV Y+H+  + HRDLK EN+LL             
Sbjct: 427 FSLIVS-AGKLEYAEADCFFKQLMRGVVYMHDMGVSHRDLKPENLLLT------------ 473

Query: 398 DIYYEHSFVEIADFG--LCKKI--EPD-ELCTARCGSEDYVSPEILMGVPYDGHLSDTWA 452
                   ++I DFG   C K+  E D  L    CGS  Y++PE  +   +D    D WA
Sbjct: 474 ----SDGVLKITDFGNSECFKMAWEDDIHLSGGVCGSSPYIAPEEYIKEEFDPRCVDIWA 529

Query: 453 MGVILYSLLEDRLPFD 468
            GVI  ++   R  +D
Sbjct: 530 CGVIYMAMRTGRQLWD 545

>CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1336

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 61/112 (54%), Gaps = 17/112 (15%)

Query: 356  LFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCK 415
            LF +++ GVK+LH+  I+HRD+K ENI++                    FV+I DFG   
Sbjct: 1190 LFKQVVSGVKHLHDQGIVHRDIKDENIIVD----------------SQGFVKIIDFGSAA 1233

Query: 416  KIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
             ++         G+ DY +PE+L G PY+G   D WA+G++LY+++    PF
Sbjct: 1234 YVKSGPF-DVFVGTIDYAAPEVLGGSPYEGKPQDIWAIGILLYTIVFKENPF 1284

>YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine protein
            kinase involved in the regulation of carbohydrate
            storage, has similarity to human PIM-1 oncogene [4071 bp,
            1356 aa]
          Length = 1356

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 125/289 (43%), Gaps = 62/289 (21%)

Query: 198  EDDIVLMGYRIGEYTKALQWRKVKTIG----VGNFSDVLLYESIDQNDPELLQVAV-KRI 252
            ED I++   R  +          K IG    V  FSD +  + + +     + + + K+ 
Sbjct: 1059 EDGIIMTNKRGNQPVSTFLRTPEKNIGAQKHVKKFSDFVSLQKMGEGAYGKVNLCIHKKN 1118

Query: 253  RYPQELKDIRNRSANFDELL-GRLDNSLTREISVLNSLN---HPCIVKL---FGVNDPLF 305
            RY   +K I       D  +  R   ++  EI ++ +LN   H  I++L   F  +D  +
Sbjct: 1119 RYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMATLNKKPHENILRLLDFFEDDDYYY 1178

Query: 306  IES-------CRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFT 358
            IE+       C  L+D+++ +                           N+  +  + +F 
Sbjct: 1179 IETPVHGETGCIDLFDLIEFKT--------------------------NMTEFEAKLIFK 1212

Query: 359  EILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIE 418
            +++ G+K+LH+  I+HRD+K EN+++                    FV+I DFG    ++
Sbjct: 1213 QVVAGIKHLHDQGIVHRDIKDENVIVD----------------SKGFVKIIDFGSAAYVK 1256

Query: 419  PDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
                     G+ DY +PE+L G PY+G   D WA+G++LY+++    PF
Sbjct: 1257 SGPF-DVFVGTIDYAAPEVLGGNPYEGQPQDIWAIGILLYTVVFKENPF 1304

>Scas_713.7
          Length = 983

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 119/263 (45%), Gaps = 57/263 (21%)

Query: 213 KALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELL 272
           K++Q++  + IG G++   ++Y+++++   ++  VA+K + Y  +           DEL+
Sbjct: 22  KSVQYQLKQVIGKGSYG--VVYKAVNKKTLQI--VAIKEVNYDND-----------DELI 66

Query: 273 GRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYC 332
                 +  EI +L +LNH  IVK  G     FI+    LY             +I+ +C
Sbjct: 67  -----EIMTEIDLLKNLNHVNIVKYHG-----FIQKSSNLY-------------IILEFC 103

Query: 333 VGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIR 392
             G L   ++     +     +    + L G+ YLHE  +IHRD+K  N+LL        
Sbjct: 104 SKGSLKNLLTGYKDGIPELDAKVYIRQTLNGLVYLHEQGVIHRDIKAANLLLD------- 156

Query: 393 SLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWA 452
                     +  V++ADFG+  K+    +  A  GS  ++SPEI+ G      LSD W+
Sbjct: 157 ---------SNDVVKLADFGVSTKVSNTAMTLA--GSLHWMSPEII-GNRGASTLSDIWS 204

Query: 453 MGVILYSLLEDRLPFDPLPGASI 475
           +G  +  L+    PF  L   +I
Sbjct: 205 LGATVVELVTGNPPFYKLVDVNI 227

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 63/193 (32%), Positives = 89/193 (46%), Gaps = 52/193 (26%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLL 338
           L  E+S+L  L HP IV+        + ES    Y             ++    VGG+L 
Sbjct: 91  LYDELSILQMLKHPNIVEF-----KDWFESKDKFY-------------IVTQLAVGGELF 132

Query: 339 AAMSQCSGNLDRWLIQRLFTE---------ILLGVKYLHEHNIIHRDLKLENILLKVPLG 389
                     DR L +  FTE         IL  V Y+H  N++HRDLK EN+L      
Sbjct: 133 ----------DRILAKGKFTERDAVSITMQILSAVDYMHSKNVVHRDLKPENVL------ 176

Query: 390 NIRSLKDKDIYYEHSFVEIADFGLCKKIEP-DELCTARCGSEDYVSPEILMGVPYDGHLS 448
                 DK    + S + IADFG+ K+++  D+L     GS  YV+PE+L    + G   
Sbjct: 177 ----YIDKS---DDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEVLTNNGH-GKPC 228

Query: 449 DTWAMGVILYSLL 461
           D W++GVI+Y+LL
Sbjct: 229 DIWSIGVIVYTLL 241

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 115/266 (43%), Gaps = 53/266 (19%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELL---QVAVKRIRYPQELKDIRNRSANFD---- 269
           W K   IG G+F  V  Y  ++    EL+   QV +K         ++ +++A  +    
Sbjct: 389 WLKGARIGSGSFGTV--YLGMNAQTGELMAVKQVEIKPAIAATADANVEDKNAEKNVAKA 446

Query: 270 ---ELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCN 326
               L  ++ ++L  E+S+L  L H  IV  +G +                  Q+    N
Sbjct: 447 PSTNLHRKMIDALQHEMSLLKELQHENIVTYYGSS------------------QEGGNLN 488

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           + + Y  GG + + +S   G  +  LI     +IL+GV YLH  NIIHRD+K  NIL+ +
Sbjct: 489 IFLEYVPGGSVSSMLSNY-GPFEEPLIVNFTRQILIGVAYLHRKNIIHRDIKGANILIDI 547

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEP-----DELCTARCGSEDYVSPEILMGV 441
                              V+I DFG+ KK+ P      +  T+  GS  ++SPE++   
Sbjct: 548 K----------------GCVKITDFGISKKLSPLNQENQDKRTSLQGSVYWMSPEVVKQT 591

Query: 442 PYDGHLSDTWAMGVILYSLLEDRLPF 467
                 +D W+ G ++  +   + P+
Sbjct: 592 ATTSK-ADIWSTGCVVIEMFTGKHPY 616

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 80/162 (49%), Gaps = 42/162 (25%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILL-GVKYLHEHNIIHRDLKLENILLK 385
            ++ +  GG+LL+ + +     D W   R FT  L+  ++++H H IIHRDLK EN+LL 
Sbjct: 90  FVLDFAPGGELLSLLHKMGTFNDIWT--RHFTAQLIDALEFIHSHGIIHRDLKPENVLL- 146

Query: 386 VPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEP------------------DELCTARC 427
                     D+D       + I DFG    I+P                  ++ C +  
Sbjct: 147 ----------DRD-----GRLMITDFGAAATIDPSLSGDSAKFNSDSNGSKDNQNCASFV 191

Query: 428 GSEDYVSPEILMGVPYD--GHLSDTWAMGVILYSLLEDRLPF 467
           G+ +YVSPE+L+   Y+  G+ SD WA+G ++Y  ++ + PF
Sbjct: 192 GTAEYVSPELLL---YNQCGYGSDIWALGCMIYQFVQGQPPF 230

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/249 (28%), Positives = 111/249 (44%), Gaps = 54/249 (21%)

Query: 220 VKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSL 279
           +K IG G+F  V+  +  D N       A+K IR       I ++S     L  R     
Sbjct: 392 LKVIGKGSFGKVMQVKKKDTNK----IYALKAIRKSY----IVSKSEVTHTLAER----- 438

Query: 280 TREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLA 339
               +VL  +++P IV L         +S   LY             L++++  GG+L  
Sbjct: 439 ----TVLARVDNPFIVPL-----KFSFQSPEKLY-------------LVLAFINGGELFF 476

Query: 340 AMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDI 399
            + Q  G  D    +    E+L  ++ LH  N+I+RDLK ENILL               
Sbjct: 477 HL-QKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLD-------------- 521

Query: 400 YYEHSFVEIADFGLCK-KIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILY 458
           Y  H  + + DFGLCK  ++  +     CG+ +Y++PE+L+G  Y   + D W +GV+LY
Sbjct: 522 YQGH--IALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLY 578

Query: 459 SLLEDRLPF 467
            +L    P+
Sbjct: 579 EMLTGLPPY 587

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 66/125 (52%), Gaps = 17/125 (13%)

Query: 343  QCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYE 402
            +   N+  +  + +F +I+ G+K+LH+  I+HRD+K EN+++                  
Sbjct: 1047 EFKSNMTEFEAKLIFKQIVSGIKHLHDQGIVHRDIKDENVIVD----------------S 1090

Query: 403  HSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLE 462
              FV++ DFG    ++         G+ DY +PE+L G PY+G   D WA+G++LY+L+ 
Sbjct: 1091 KGFVKLIDFGSAAYVKSGPF-DVFVGTIDYAAPEVLGGNPYEGKSQDIWAIGILLYTLIY 1149

Query: 463  DRLPF 467
               PF
Sbjct: 1150 KENPF 1154

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 76/148 (51%), Gaps = 21/148 (14%)

Query: 323 VPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENI 382
           V   +++  C  G L+  + +    +    ++   T+I  G++Y+H + +IHRDLKL NI
Sbjct: 151 VNVYILLEICPNGSLMELIKK-RKTITEPEVRFFMTQICGGIQYMHSNRVIHRDLKLGNI 209

Query: 383 LLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPD-ELCTARCGSEDYVSPEILMGV 441
                              EH  ++I DFGL   +  D E     CG+ +Y++PE+LMG 
Sbjct: 210 FFD----------------EHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPEVLMG- 252

Query: 442 PYDGHLS--DTWAMGVILYSLLEDRLPF 467
            + GH    D W++GV+LY+LL  + PF
Sbjct: 253 KHSGHSYEVDIWSIGVMLYALLIGKPPF 280

>KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1229

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 65/121 (53%), Gaps = 17/121 (14%)

Query: 347  NLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFV 406
            N+  +  + LF ++  G+K+LH++ I+HRD+K EN+++                    FV
Sbjct: 1074 NMTEFEAKLLFKQVASGIKHLHDNGIVHRDIKDENVIVD----------------NKGFV 1117

Query: 407  EIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLP 466
            ++ DFG    ++         G+ DY +PE+L G PY+G   D WA+GV+LY+++    P
Sbjct: 1118 KLIDFGSAAYVKSGPF-DVFVGTIDYAAPEVLGGEPYEGKPQDIWAIGVLLYTIIYKENP 1176

Query: 467  F 467
            F
Sbjct: 1177 F 1177

>Kwal_0.307
          Length = 490

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 119/293 (40%), Gaps = 61/293 (20%)

Query: 180 KFPIHHDGTALADDSNS---QEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYES 236
           KF ++  G  ++ D+ +    + D+V    + G        R  + +G G F  V +   
Sbjct: 235 KFYLNESGGEMSSDNTAIAPPKKDLVSFAEKYG--------RCQEVVGKGAFGVVRICHK 286

Query: 237 IDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLTREISVLNSLNHPCIVK 296
             Q+DP   ++          +K+ R + +   E   R    LT E  + +SL H  I+ 
Sbjct: 287 KSQDDPNGEKLYA--------VKEFRRKPSESPEKYSR---RLTSEFCISSSLKHTNIIM 335

Query: 297 LFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRL 356
              +      + C+                 +M YC GGDL   +   +G L+       
Sbjct: 336 TLDLFQDAKGDYCQ-----------------VMEYCFGGDLFTLII-AAGKLEYMEADCF 377

Query: 357 FTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFG--LC 414
           F +++ GV Y+H+  + HRDLK EN+LL                  +  ++I DFG   C
Sbjct: 378 FKQLIRGVVYMHDMGVCHRDLKPENLLLS----------------SNGTLKITDFGNSEC 421

Query: 415 KKI--EPD-ELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDR 464
            ++  E D  L    CGS  Y++PE  +   +D    D WA GVI  ++   R
Sbjct: 422 FRMAWEKDIHLSGGVCGSSPYIAPEEYVHEEFDPRPVDIWACGVIYMAMRTGR 474

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 118/261 (45%), Gaps = 55/261 (21%)

Query: 220 VKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQEL--KDIRNRSANFDELLGRLDN 277
           ++ +G G +  VLL +  D    +L   A+K+++  + L  +D   + AN   +  R++ 
Sbjct: 173 IRCLGEGAYGKVLLVK--DSLSSKL--YAMKQLKKAEILISEDSIEKDAN-TTVEKRIER 227

Query: 278 SLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDL 337
           +   E ++L+ L HP IVKLF              +D  KL        L++ Y  GG+L
Sbjct: 228 TFA-ERTILSQLEHPNIVKLF-----------YSFHDNHKLY-------LVLQYIPGGEL 268

Query: 338 LAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDK 397
              + +  G LD   +     E+   +K+LH   I++RDLK EN LL             
Sbjct: 269 FYHLKE-QGTLDEGTVAFYAAELSCALKFLHSKGIVYRDLKPENCLLN------------ 315

Query: 398 DIYYEHSFVEIADFGLCKKIEPDELCTAR-----------CGSEDYVSPEILMGVPYDGH 446
               E   + + DFGL KK   D+  T              G+ +Y +PEIL G PY  +
Sbjct: 316 ----ERGHLVLTDFGLSKKSVFDDAATPEEGENVNQLYSIIGTPEYCAPEILAGEPYTQN 371

Query: 447 LSDTWAMGVILYSLLEDRLPF 467
             D +++G ++Y +L  + PF
Sbjct: 372 -CDWYSLGCLVYDMLIGKPPF 391

>Kwal_47.18307
          Length = 621

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 82/173 (47%), Gaps = 32/173 (18%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
            ++ Y  GG+LLA + +  G L   L + +  +++  V Y+H   +IHRDLK EN+LL  
Sbjct: 89  FVLEYVSGGELLALIQRL-GRLTEDLSRHITAQLVDTVDYMHSKGVIHRDLKPENVLLS- 146

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLC-----KKIEPDELCTARCGSEDYVSPEILMGV 441
                          +   V I DFG       +K E  +   +  G+ +YVSPE+L+  
Sbjct: 147 ---------------QEGRVVITDFGAACTAADRKFENTKRTASFVGTAEYVSPELLLHS 191

Query: 442 PYDGHLSDTWAMGVILYSLLEDRLPFDPLPGASIRQKNR-PTAHRIARFEWKW 493
              G  SD WA+G I+Y L + + PF        R +N   T  +I   ++KW
Sbjct: 192 QC-GFSSDIWALGCIIYQLNQGKPPF--------RGENELQTFEKIVALDYKW 235

>Kwal_27.9773
          Length = 406

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 122/266 (45%), Gaps = 40/266 (15%)

Query: 216 QWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRL 275
           +++ ++ IG G+F  V           +++ V   R+   +E+K        +  +  + 
Sbjct: 18  EYQVLEEIGRGSFGSV----------RKVVHVPTNRVLVRKEIK--------YGHMNSKE 59

Query: 276 DNSLTREISVLNSLNHPCIVKLFGVNDP-----LFIESCR-----PLYDMLKLRQKLVPC 325
              L  E ++L+ L H  IV+ +  +        ++E C       +    K  +K +P 
Sbjct: 60  RQQLISECAILSQLKHENIVEFYEWDSDVDVLYFYMEYCSNGDLSQMISHFKKERKYIPE 119

Query: 326 NLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILL- 384
            L+ S  V   +L A+ +C    D   ++ ++  +   VK    + +IHRDLK  NI L 
Sbjct: 120 RLVWSVMV--QVLVALYRCHYGSDLAPLETIYDRMKPPVK--GSNVVIHRDLKPGNIFLS 175

Query: 385 --KVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPD-ELCTARCGSEDYVSPEILMGV 441
             +VP   + +L+  D  Y    V++ DFGL K +    E  T   G+  Y+SPE+LM  
Sbjct: 176 TERVPDARV-ALQAFD--YSKISVKLGDFGLAKSLGASVEFATTYVGTPYYMSPEVLMDQ 232

Query: 442 PYDGHLSDTWAMGVILYSLLEDRLPF 467
           PY   LSD W++G ++Y +   R PF
Sbjct: 233 PYSP-LSDIWSLGCVIYEMCTLRPPF 257

>Scas_720.94
          Length = 1683

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 117/286 (40%), Gaps = 81/286 (28%)

Query: 214  ALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLG 273
            +++W+K   IG G F  V  Y +++ ++ E+L V   +I+  + +K I            
Sbjct: 1358 SIRWQKRNFIGGGTFGTV--YSAVNLDNGEILAVKEIKIQDSKTMKKIFPL--------- 1406

Query: 274  RLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCV 333
                 +  E++VL  LNHP IV+ +GV      E  R               N+ M YC 
Sbjct: 1407 -----VKEEMTVLEMLNHPNIVQYYGV------EVHRD------------KVNIFMEYCE 1443

Query: 334  GGDLLAAMSQCSGNLDRWLIQRLFT-EILLGVKYLHEHNIIHRDLKLENILLKVPLGNIR 392
            GG + + +    G ++  ++ +++T E+L G+ YLH+  ++HRD+K ENILL        
Sbjct: 1444 GGSMASLLEH--GRIEDEMVTQVYTLELLEGLAYLHQAGVVHRDIKPENILLDF------ 1495

Query: 393  SLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSED--------------------- 431
                      +  ++  DFG  +KI  +        S+                      
Sbjct: 1496 ----------NGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEGGANSVHDM 1545

Query: 432  -----YVSPEILMGVPYDGHLS--DTWAMGVILYSLLEDRLPFDPL 470
                 Y++PE + G          D W+ G ++  ++  R P+  L
Sbjct: 1546 LGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPWANL 1591

>Scas_618.8
          Length = 427

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 91/195 (46%), Gaps = 44/195 (22%)

Query: 279 LTREISVLNSLNHPCIVKL---FGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG 335
           L  E+++L  L+HP IV+    F  +D ++I                     +     GG
Sbjct: 73  LYDELTILKKLHHPNIVEFKNWFETDDKIYI---------------------VTQLATGG 111

Query: 336 DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLK 395
           +L   + +  G        ++  +IL  V+Y+H  +I+HRDLK EN+L          L 
Sbjct: 112 ELFDRIIK-KGRFSEDDAVKILIQILSAVEYIHSRDIVHRDLKPENLLY---------LT 161

Query: 396 DKDIYYEHSFVEIADFGLCKKIEPDE-LCTARCGSEDYVSPEILMGVPYDGHLS--DTWA 452
           +K    E S + IADFG+ K+++  E L     GS  YV+PE+L     DGH    D W+
Sbjct: 162 EK----EDSELVIADFGIAKELKKGEQLIFKAAGSLGYVAPEVLT---VDGHGKPCDIWS 214

Query: 453 MGVILYSLLEDRLPF 467
           +GVI Y+LL     F
Sbjct: 215 IGVITYTLLSGYAAF 229

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/306 (23%), Positives = 132/306 (43%), Gaps = 69/306 (22%)

Query: 180  KFPIHHDGTALADDSNSQEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQ 239
            K   H+    + DD+++Q   +  +   I     +++W+K   IG G+F  V  Y +++ 
Sbjct: 1224 KVKRHYSVGKVIDDTDNQSKLLKSLASSISNL--SIRWQKRSFIGSGSFGTV--YSAVNL 1279

Query: 240  NDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFG 299
            +  ++L V   +I+  + +K I                SL  E+ V+  LNHP IV+ +G
Sbjct: 1280 DTGDILAVKEIKIQDAKSMKQIFP--------------SLKEEMRVMEILNHPNIVQYYG 1325

Query: 300  VNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFT- 358
            V      E  R               N+ M +C G  L + +    G ++  ++ +++T 
Sbjct: 1326 V------EVHRD------------KVNIFMEFCEGSSLASLLEH--GRIEDEMVTQVYTL 1365

Query: 359  EILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIE 418
            ++L G+  LH+  ++HRD+K ENILL                  +  ++  DFG  K I 
Sbjct: 1366 QLLEGLACLHQSGVVHRDIKPENILLD----------------RNGVIKYVDFGAAKLIA 1409

Query: 419  PD-------ELCTARCGSED------YVSPEILMGVPYDGHLS-DTWAMGVILYSLLEDR 464
             +       +      G +D      Y++PE + G  +    S D W++G ++  ++  R
Sbjct: 1410 KNGSKRISLDANNKSTGGKDMIGTPMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGR 1469

Query: 465  LPFDPL 470
             P+  L
Sbjct: 1470 RPWANL 1475

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 76/142 (53%), Gaps = 20/142 (14%)

Query: 327  LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
              M +  GGDL+  +     ++ R   +    E+LL +K+ H++ +I+RDLKLENILL  
Sbjct: 895  FAMEFIGGGDLMWHVQNQRLSVRR--AKFYAAEVLLALKFFHDNGVIYRDLKLENILL-T 951

Query: 387  PLGNIRSLKDKDIYYEHSFVEIADFGLCKK-IEPDELCTARCGSEDYVSPEILMGVPYDG 445
            P G+I+               IAD+GLCK  +      +  CG+ ++++PE+L    Y  
Sbjct: 952  PEGHIK---------------IADYGLCKDGMWYGNKTSTFCGTPEFMAPELLREQDYTK 996

Query: 446  HLSDTWAMGVILYSLLEDRLPF 467
             + D WA GV+LY +L  + PF
Sbjct: 997  AV-DWWAFGVLLYQMLLCQSPF 1017

>Kwal_26.7154
          Length = 1213

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 61/112 (54%), Gaps = 17/112 (15%)

Query: 356  LFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCK 415
            +F +I  G+K LH++ I+HRD+K EN+++                  + FV+I DFG   
Sbjct: 1067 IFKQIASGIKNLHDNGIVHRDIKDENVIVDC----------------NGFVKIVDFGSAA 1110

Query: 416  KIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
             ++         G+ DY +PE+L G PY+G   D WA+GV+LY+++    PF
Sbjct: 1111 YVKSGPF-DVFVGTIDYAAPEVLGGEPYEGKPQDIWAIGVLLYTIIYKENPF 1161

>Scas_721.124
          Length = 684

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 69/137 (50%), Gaps = 18/137 (13%)

Query: 332 CVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNI 391
           C+ G  L    Q  G  D    +    E+L  ++ LH  N+I+RDLK ENILL       
Sbjct: 430 CINGGELFYHLQKEGRFDLSRSRFYAAELLCALETLHNLNVIYRDLKPENILLD------ 483

Query: 392 RSLKDKDIYYEHSFVEIADFGLCK-KIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDT 450
                   Y  H  + + DFGLCK  ++ D+     CG+ +Y++PE+L+G  Y   + D 
Sbjct: 484 --------YQGH--IALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGQGYT-KVVDW 532

Query: 451 WAMGVILYSLLEDRLPF 467
           W +GV+LY +L    P+
Sbjct: 533 WTLGVLLYEMLTGLPPY 549

>Kwal_23.4276
          Length = 521

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 90/175 (51%), Gaps = 23/175 (13%)

Query: 312 LYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILL-GVKYLHEH 370
           L+D  +  + +V   L+   C  GDL   + + +G+LD     + +T  LL  + +LHE+
Sbjct: 106 LFDYFETPKNIV---LVTQLCSHGDLYEKIIE-AGSLDISKQVKSYTACLLSALDFLHEN 161

Query: 371 NIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVE--IADFGLCKKIEPDELCTARC- 427
            ++HRD+K EN+L +  +  +     +  +Y+H+  +  +ADFGL  + +  +     C 
Sbjct: 162 KVVHRDVKAENVLFRCRVSELSEFSRRGSHYDHTSHDLILADFGLATRCDSKDDERRECV 221

Query: 428 GSEDYVSPEILM--GV------------PYDGHLSDTWAMGVILYSLLEDRLPFD 468
           G+  Y++PE++   G+            PY   + D WA+GV+ Y ++   +PFD
Sbjct: 222 GTISYIAPEVVRCSGIARLAPSQAKLIKPYGASI-DIWALGVLAYFMMTGYMPFD 275

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 114/278 (41%), Gaps = 69/278 (24%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLT 280
           K IG G+F+ V  Y     +D     VA+K +   +    ++N+         +L  +L 
Sbjct: 28  KEIGKGSFATV--YRGHLTSDKSQ-HVAIKEVSRAK----LKNK---------KLLENLE 71

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
            EI++L  + HP IV L        I+  R   D            LIM YC  GDL   
Sbjct: 72  IEIAILKKIKHPHIVGL--------IDCERTSTDFY----------LIMEYCALGDLTFL 113

Query: 341 M-----------------------SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDL 377
           +                       S+    L R  +     ++   +K+L   N++HRD+
Sbjct: 114 LKRRKELMENHPLLRTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDI 173

Query: 378 KLENILLKVPLGNIRSLKDKDIYYEHSFV--------EIADFGLCKKIEPDELCTARCGS 429
           K +N+LL  PL       D   ++E  FV        +IADFG  + +    L    CGS
Sbjct: 174 KPQNLLLSTPLIGYH---DSKSFHELGFVGIYNLPILKIADFGFARFLPNTSLAETLCGS 230

Query: 430 EDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
             Y++PEIL    Y+   +D W++G +++ +     PF
Sbjct: 231 PLYMAPEILNYQKYNAK-ADLWSVGTVVFEMCCGTPPF 267

>YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine
           protein kinase and positive regulator of early, middle,
           and late meiotic genes, may act as a meiosis-specific
           regulator of the anaphase promoting complex [1938 bp,
           645 aa]
          Length = 645

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 65/123 (52%), Gaps = 4/123 (3%)

Query: 353 IQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFV-EIADF 411
           ++ + ++IL G+K++HEHN  HRDLK ENIL+              I Y+ ++V ++ADF
Sbjct: 170 LKSILSQILAGLKHIHEHNFFHRDLKPENILITPSTQYFEKEYMNQIGYQDNYVIKLADF 229

Query: 412 GLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLP 471
           GL + +E     TA   +  Y SPEIL+   Y     D WA G +   +   R  F   P
Sbjct: 230 GLARHVENKNPYTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCVAVEVTVFRALF---P 286

Query: 472 GAS 474
           GA+
Sbjct: 287 GAN 289

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 73.6 bits (179), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 88/194 (45%), Gaps = 36/194 (18%)

Query: 275 LDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVG 334
           ++    RE+ + +SL HP + +L+G     +    + +Y             L+M Y V 
Sbjct: 150 IEKQFRREVEIQSSLRHPNLTQLYG-----YFHDEKRVY-------------LLMEYLVN 191

Query: 335 GDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSL 394
           G+L   +   S + +  +      ++   + Y+HE NI+HRD+K ENI++          
Sbjct: 192 GELYKHLKGRS-HFNDVVASYYVYQMADALDYMHERNILHRDIKPENIIIGF-------- 242

Query: 395 KDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMG 454
                   ++ +++ DFG              CG+ DY+SPE++    Y+  + D WA+G
Sbjct: 243 --------NNTIKLTDFGWSVITPKGSKRKTLCGTVDYLSPELIRSREYNEKV-DVWALG 293

Query: 455 VILYSLLEDRLPFD 468
           V+ Y LL    PF+
Sbjct: 294 VLTYELLVGSPPFE 307

>Scas_580.6
          Length = 1015

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 72/143 (50%), Gaps = 21/143 (14%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           +IM YC GG L + +    G +D   I  +  E+L+ +KY+H+ N+IHRD+K  N+L+  
Sbjct: 111 IIMEYCAGGSLRSLLR--PGKIDEKYIGVIMRELLVALKYIHKDNVIHRDIKAANVLIT- 167

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDEL-CTARCGSEDYVSPEILM-GVPYD 444
                              V++ DFG+  ++    L      G+  +++PE++M GV YD
Sbjct: 168 ---------------NEGSVKLCDFGVAAQLNQSTLRRQTMAGTPYWMAPEVIMEGVYYD 212

Query: 445 GHLSDTWAMGVILYSLLEDRLPF 467
             + D W++G+  Y +     P+
Sbjct: 213 TKV-DIWSLGITAYEIATGNPPY 234

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 75/142 (52%), Gaps = 19/142 (13%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
            ++++  GG+L   + Q  G  D    +    E+L  +  LH+ ++++RDLK ENILL  
Sbjct: 422 FVLAFINGGELFYHL-QKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLD- 479

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCK-KIEPDELCTARCGSEDYVSPEILMGVPYDG 445
                        Y  H  + + DFGLCK  ++ D+     CG+ +Y++PE+L+G+ Y  
Sbjct: 480 -------------YQGH--IALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTK 524

Query: 446 HLSDTWAMGVILYSLLEDRLPF 467
            + D W +GV+LY +L    P+
Sbjct: 525 AV-DWWTLGVLLYEMLTGLPPY 545

>CAGL0J04972g 472984..474003 some similarities with tr|Q12100
           Saccharomyces cerevisiae YDL025c, hypothetical start
          Length = 339

 Score = 73.2 bits (178), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 75/157 (47%), Gaps = 27/157 (17%)

Query: 357 FTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLC-K 415
           F +I   V+YLH   I+HRDLKLENI+L      I+               + DFG+   
Sbjct: 147 FLQICEAVQYLHSRGIVHRDLKLENIMLCADACQIK---------------LIDFGVAVN 191

Query: 416 KIEPDEL---CTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLPG 472
           + +P  L   C   CG+E  ++PE+L  + Y G  +D W++G+I++ +         +  
Sbjct: 192 RQDPQSLTTACKGMCGTEALMAPEVLGSISYVGEYADCWSVGIIMFQIFN-------ISN 244

Query: 473 ASIRQKNRPTAHRIARFEWKWHKMIEDDSSAKEIVNN 509
            S+R K R      ARF    +K+  +++    ++ N
Sbjct: 245 DSVRWKPRYPWES-ARFSNSIYKIYSEEADTSVVLTN 280

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 89/192 (46%), Gaps = 39/192 (20%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLL 338
           L  EI +  S+ HP IV+          E    +Y +L++             C  G L+
Sbjct: 117 LLSEIQIHKSMKHPNIVQFTDC-----FEDDTNVYILLEI-------------CPNGSLM 158

Query: 339 AAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKD 398
             + Q    L    ++   T+I+  +KY+H   IIHRDLKL NI             DK 
Sbjct: 159 DLLKQ-RKQLTEPEVRFFTTQIVGAIKYMHSRRIIHRDLKLGNIFF-----------DK- 205

Query: 399 IYYEHSFVEIADFGLCKKIEPD-ELCTARCGSEDYVSPEILMGVPYDGHL--SDTWAMGV 455
               H  ++I DFGL   +  D E     CG+ +Y++PE+L G  + GH    D W++GV
Sbjct: 206 ----HFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTG-KHTGHSFEVDIWSIGV 260

Query: 456 ILYSLLEDRLPF 467
           ++Y+LL  + PF
Sbjct: 261 MIYALLIGKPPF 272

>Scas_644.15
          Length = 726

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 87/189 (46%), Gaps = 39/189 (20%)

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
           EI +  S+ HP IV           E    +Y +L++             C  G L+  M
Sbjct: 139 EIQIHKSMKHPNIVHFVDC-----FEDDTNVYILLEI-------------CSNGSLMDLM 180

Query: 342 SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYY 401
            +    L    ++   T+I   VKY+H   +IHRDLKL NI             DKD   
Sbjct: 181 KK-RKTLTEPEVRFFTTQICGAVKYMHSRRVIHRDLKLGNIFF-----------DKDYN- 227

Query: 402 EHSFVEIADFGLCKKIEPD-ELCTARCGSEDYVSPEILMGVPYDGHL--SDTWAMGVILY 458
               +++ DFGL   +  + E     CG+ +Y++PE+LMG  + GH    D W++GV++Y
Sbjct: 228 ----LKVGDFGLAAVLANNRERKYTVCGTPNYIAPEVLMG-KHAGHSFEVDIWSIGVMIY 282

Query: 459 SLLEDRLPF 467
           +LL  + PF
Sbjct: 283 ALLVGKPPF 291

>Scas_548.6
          Length = 1382

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 64/121 (52%), Gaps = 17/121 (14%)

Query: 347  NLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFV 406
            N+  +  + +F +I+ G+K+LH+  I+HRD+K EN+++                     V
Sbjct: 1227 NMTEFEAKLIFKQIVSGIKHLHDQGIVHRDIKDENVIVD----------------SKGCV 1270

Query: 407  EIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLP 466
            +I DFG    ++         G+ DY +PE+L G PY+G   D WA+G++LY+++    P
Sbjct: 1271 KIIDFGSAAYVKSGPF-DVFVGTIDYAAPEVLSGEPYEGKPQDIWAIGILLYTIVFKENP 1329

Query: 467  F 467
            F
Sbjct: 1330 F 1330

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 88/189 (46%), Gaps = 38/189 (20%)

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
           E++++  L+HP IVK        + E+    Y             ++     GG+L   +
Sbjct: 113 ELNIIQHLDHPNIVKFKD-----WFETESKFY-------------IVTQLASGGELFDRI 154

Query: 342 SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYY 401
               G         +  +IL  V+YLH  NIIHRDLK EN+L           K KD   
Sbjct: 155 MH-DGKYTEEDAVNIVVQILKAVEYLHSQNIIHRDLKPENLLYLD--------KSKD--- 202

Query: 402 EHSFVEIADFGLCKKIEPDELCTAR-CGSEDYVSPEILMGVPYDGHL--SDTWAMGVILY 458
             S + +ADFG+ +++E D+    R  GS  YV+PE+      DGH   SD W++GVI Y
Sbjct: 203 --SRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEVFTS---DGHGKPSDIWSVGVITY 257

Query: 459 SLLEDRLPF 467
           +LL    PF
Sbjct: 258 TLLCGYSPF 266

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 18/137 (13%)

Query: 332 CVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNI 391
           C+ G  L    Q  G  D    +   +E+LL +  LH+ ++++RDLK ENILL       
Sbjct: 456 CINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLD------ 509

Query: 392 RSLKDKDIYYEHSFVEIADFGLCK-KIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDT 450
                         + + DFGLCK  ++ +E  +  CG+ +Y++PE+L+G  Y   + D 
Sbjct: 510 ----------SQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGY-TKVVDW 558

Query: 451 WAMGVILYSLLEDRLPF 467
           W +GV+LY +L    P+
Sbjct: 559 WTLGVLLYEMLTGLPPY 575

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 85/194 (43%), Gaps = 36/194 (18%)

Query: 275 LDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVG 334
           +     RE+ +  S  H  + +L+G             YD  ++        L+M Y   
Sbjct: 141 IQKQFRREVEIQGSFKHKNLTQLYGF-----------FYDEKRVY-------LLMEYVYY 182

Query: 335 GDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSL 394
           G+L   +   +G L+  L      ++   + Y+H  NI+HRD+K ENIL+          
Sbjct: 183 GELYKFLKN-NGPLNETLASYFVYQMANALDYMHSKNILHRDIKPENILIGF-------- 233

Query: 395 KDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMG 454
                   ++ +++ DFG     E  +     CG+ DY+SPE++    Y+  + D WA+G
Sbjct: 234 --------NNTIKLTDFGWSVYNEDGQKRKTLCGTIDYLSPELIKSREYNNKV-DVWALG 284

Query: 455 VILYSLLEDRLPFD 468
           V+ Y LL    PF+
Sbjct: 285 VLTYELLVGSPPFE 298

>KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces
           cerevisiae YAR018c KIN3 ser/thr protein kinase,
           hypothetical start
          Length = 394

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 108/236 (45%), Gaps = 24/236 (10%)

Query: 248 AVKRIRYPQELKDIRNRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDP---- 303
           +V+++    + K +  +   +  +  +    L  E ++L+ L H  IV+ F  +      
Sbjct: 23  SVRKVVREADNKVMVRKEVRYGHMNAKERQQLISECAILSQLKHDNIVEFFHWDHDAKSN 82

Query: 304 ---LFIESCRP--LYDML---KLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQR 355
              L++E C    L  M+   K ++K VP   +    V   +L A+ +C    D   +Q 
Sbjct: 83  TLFLYMEYCSKGDLSQMIRYYKHQRKYVPEEYVWRIMV--QILMALFKCHYGRDLSKLQT 140

Query: 356 LF---TEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFG 412
           ++    E L    Y+    +IHRDLK  NI L     +  +    D+ Y    +++ DFG
Sbjct: 141 IYDAMEEPLKSKGYV----VIHRDLKPGNIFL-TGYDDEFNQNASDVDYSKVIIKLGDFG 195

Query: 413 LCKKIEPD-ELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           L K ++   E  T   G+  Y+SPE+L   PY   LSD W++G ILY L    +PF
Sbjct: 196 LAKSLQASIEFATTYVGTPYYMSPEVLRDQPYSP-LSDIWSLGCILYELCSLHVPF 250

>Kwal_56.22693
          Length = 984

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 72/150 (48%), Gaps = 27/150 (18%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
            ++ Y   GD L+ + +  G+L +        +IL  + YLH   I+HRD+K ENILL  
Sbjct: 234 FLLEYAPNGDFLSVIKKF-GSLSQECAVYYSAQILDAIDYLHHKGIVHRDIKPENILL-- 290

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDEL---------CTARCGSEDYVSPEI 437
                    DKD+      V++ DFG  + +E DE            +  G+ +YVSPE 
Sbjct: 291 ---------DKDMK-----VKLTDFGTARILEKDETTQTFNLLERSKSFVGTAEYVSPE- 335

Query: 438 LMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           L+   Y  +  D WA G IL+ ++  + PF
Sbjct: 336 LLNDNYVDYKCDIWAFGCILFQMIAGKPPF 365

>YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase
           kinase (MAPKKK or MEKK), component of pheromone
           response, filamentous growth, high-osmolarity sensing,
           and STE vegetative growth pathways [2154 bp, 717 aa]
          Length = 717

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 121/285 (42%), Gaps = 76/285 (26%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELL---QVAVKR--IRYPQELKDIRNRSANFD-- 269
           W K   IG G+F  V  Y  ++ +  EL+   QV +K   I  P +     N+ AN D  
Sbjct: 415 WLKGACIGSGSFGSV--YLGMNAHTGELMAVKQVEIKNNNIGVPTD----NNKQANSDEN 468

Query: 270 ----------ELLG-------------RLDNSLTREISVLNSLNHPCIVKLFGVNDPLFI 306
                     E +G             ++ ++L  E+++L  L+H  IV  +G +     
Sbjct: 469 NEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGAS----- 523

Query: 307 ESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKY 366
                        Q+    N+ + Y  GG + ++M    G  +  LI     +IL+GV Y
Sbjct: 524 -------------QEGGNLNIFLEYVPGGSV-SSMLNNYGPFEESLITNFTRQILIGVAY 569

Query: 367 LHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEP-DELCTA 425
           LH+ NIIHRD+K  NIL+ +                   V+I DFG+ KK+ P ++    
Sbjct: 570 LHKKNIIHRDIKGANILIDIK----------------GCVKITDFGISKKLSPLNKKQNK 613

Query: 426 RC---GSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           R    GS  ++SPE++         +D W+ G ++  +   + PF
Sbjct: 614 RASLQGSVFWMSPEVVKQTATTAK-ADIWSTGCVVIEMFTGKHPF 657

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 86/363 (23%), Positives = 158/363 (43%), Gaps = 69/363 (19%)

Query: 192 DDSNSQEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKR 251
           D+++++  D     ++  E  +   ++ +  IG G FS V     I+ +D          
Sbjct: 96  DETSNKSTDYSSSNHQYPEQLELHNYKLLNKIGEGAFSRVFKAVGINTDD---------- 145

Query: 252 IRYPQELKDIRNRSANFDELLG---RLDNSLTREISVLNSLNHPCIVKLFGVNDP----- 303
            + P  +K I  +  + D +L    R+  S  +++     LN   I KL   N+P     
Sbjct: 146 -QAPVAIKAIIKKGISSDAILKGNDRIQGSSRKKV-----LNEVAIHKLVSKNNPHCTKF 199

Query: 304 -LFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILL 362
             F ES    Y             L+     GG++   + Q +      L + + T++ +
Sbjct: 200 IAFQESANYYY-------------LVTELVTGGEIFDRIVQLTC-FSEDLARHVITQVAI 245

Query: 363 GVKYLHEHNIIHRDLKLENILLK-VPLGNIRSLKDKDIYYEHSFV-----------EIAD 410
            +K++H   I+HRD+K EN+L + +P   +    D D+  E  F            ++ D
Sbjct: 246 AIKHMHYMGIVHRDVKPENLLFEPIPFYGL----DGDMQKEDEFTLGVGGGGIGLVKLMD 301

Query: 411 FGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPL 470
           FGL KK+  +   T  CG+ +YV+ E+     Y   + D W++G +L++LL    PF   
Sbjct: 302 FGLAKKLRNNTAKTP-CGTIEYVASEVFTSKRYSMKV-DMWSIGCVLFTLLCGYPPF--- 356

Query: 471 PGASIRQKNRPT-AHRIARFEWKWHKMIEDD--SSAKEIVNNTL-TRKNQRWNCNDIFNS 526
                 +KN  T   +I+R ++++     D+  S AK  V + L    N+R++ +D  N 
Sbjct: 357 -----YEKNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHLLEVDPNKRYDIDDFLND 411

Query: 527 AFI 529
            ++
Sbjct: 412 PWL 414

>Scas_477.5
          Length = 703

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 111/276 (40%), Gaps = 63/276 (22%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDE------ 270
           W K   IG G+F  V  Y  ++    EL+ V    I  P     + ++S N +       
Sbjct: 406 WLKGARIGSGSFGTV--YLGMNAQTGELMAVKQVGITAPPTPSAVVDKSKNSNSNGSGKN 463

Query: 271 ----------------LLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYD 314
                           +  ++ ++L  E+++L  L+H  IV  +G +             
Sbjct: 464 NSNGKIANDQAKNSPNMHKKMVDALQHEMNLLKELHHENIVTYYGSS------------- 510

Query: 315 MLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIH 374
                Q+    N+ + Y  GG + ++M    G  +  LI     ++L+GV YLH  NIIH
Sbjct: 511 -----QEGPNLNIFLEYVPGGSV-SSMLNNYGPFEESLIVNFIRQVLIGVAYLHNKNIIH 564

Query: 375 RDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARC---GSED 431
           RD+K  NIL+                     V+I DFG+ KK+ P      R    GS  
Sbjct: 565 RDIKGANILIDTK----------------GCVKITDFGISKKLSPLSKQDKRASLQGSVY 608

Query: 432 YVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           +++PE++         +D W+ G ++  +   + PF
Sbjct: 609 WMAPEVVKQTA-TTEKADIWSTGCVVIEMFTGKHPF 643

>Scas_502.2
          Length = 1116

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/255 (27%), Positives = 113/255 (44%), Gaps = 63/255 (24%)

Query: 223 IGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDEL-LGRLDNSLTR 281
           +G G +S V+L  S D       + AVK +     ++  + +  N ++L L RL+NS + 
Sbjct: 180 LGDGAYSTVMLATSNDSGK----KYAVKVLNKEYLIRQKKVKYVNIEKLALQRLNNSRS- 234

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
                       I++LF        +    LY              ++ Y   GDLL+ M
Sbjct: 235 ------------IIRLF-----FTFQDEASLY-------------FLLEYAPNGDLLSLM 264

Query: 342 SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYY 401
            +  G+L+         +I+  +K++H   IIHRD+K ENILL           DKD+  
Sbjct: 265 KKF-GSLNEECCCYYGAQIIDAIKFMHSKGIIHRDIKPENILL-----------DKDMK- 311

Query: 402 EHSFVEIADFGLCKKIEP-------DELCTARC--GSEDYVSPEILMGVPYDGHLSDTWA 452
               V+I DFG  K ++        D L  ++   G+ +YVSPE L+   Y    SD WA
Sbjct: 312 ----VKITDFGTAKILDNKPPGTSYDLLTRSKSFVGTAEYVSPE-LLNDNYTDARSDIWA 366

Query: 453 MGVILYSLLEDRLPF 467
            G I++ ++  + PF
Sbjct: 367 FGCIVFQMIAGKPPF 381

>YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain
           (CTD) kinase alpha subunit, cyclin-dependent protein
           kinase that phosphorylates C-terminal domain of RNA
           polymerase II large subunit Rpo21p [1587 bp, 528 aa]
          Length = 528

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 110/251 (43%), Gaps = 52/251 (20%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLD 276
           + ++  +G G +  V  Y++ + N  +L  VA+K++R   E +     S           
Sbjct: 183 YLRIMQVGEGTYGKV--YKAKNTNTEKL--VALKKLRLQGEREGFPITS----------- 227

Query: 277 NSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGD 336
               REI +L S +HP +  +      + +ES + +Y + +        N +    +  +
Sbjct: 228 ---IREIKLLQSFDHPNVSTI----KEIMVESQKTVYMIFEYAD-----NDLSGLLLNKE 275

Query: 337 LLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKD 396
           +  + SQC         + LF ++LLG++YLH++ I+HRD+K  NIL+    GN++    
Sbjct: 276 VQISHSQC---------KHLFKQLLLGMEYLHDNKILHRDVKGSNILIDNQ-GNLK---- 321

Query: 397 KDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVI 456
                      I DFGL +K+      T R  +  Y  PE+L+G    G   D W  G +
Sbjct: 322 -----------ITDFGLARKMNSRADYTNRVITLWYRPPELLLGTTNYGTEVDMWGCGCL 370

Query: 457 LYSLLEDRLPF 467
           L  L      F
Sbjct: 371 LVELFNKTAIF 381

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 101/216 (46%), Gaps = 47/216 (21%)

Query: 311 PLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEH 370
           PL    + ++KL    L+++   GG+L   + Q  G  D    +    E+L  +  LH+ 
Sbjct: 432 PLKFSFQSQEKLY---LVLACINGGELFYHL-QREGRFDLSRSRFYAAELLCALDTLHKM 487

Query: 371 NIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCT-ARCGS 429
           ++I+RDLK ENILL               Y  H  + + DFGLCK    DE  T   CG+
Sbjct: 488 DVIYRDLKPENILLD--------------YQGH--IALCDFGLCKLNMKDEDKTDTFCGT 531

Query: 430 EDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLPGASIRQKNRPTAHRIARF 489
            +Y++PE+L+G  Y   + D W +GV+LY +L    P+          +N P  ++    
Sbjct: 532 PEYLAPELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPY--------YDENVPKMYK---- 578

Query: 490 EWKWHKMIED--------DSSAKEIVNNTLTRKNQR 517
                K+++D        D  AK+++   L+R  QR
Sbjct: 579 -----KILQDPLVFPDGFDRDAKDLLIGLLSRDPQR 609

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 117/276 (42%), Gaps = 66/276 (23%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQEL-KDIRNRSANFDE----- 270
           ++ V+ +G G +  VLL +  D N  +L   A+K++R  + L       S   DE     
Sbjct: 128 FKPVRVLGQGAYGKVLLVK--DVNTSKL--YAMKQLRKAEILISQTATDSKREDEDKNDG 183

Query: 271 --------LLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKL 322
                   L  RL+ +   E S+L+ + HP IVKLF              +D  KL    
Sbjct: 184 NNNDNDDGLSKRLERTFA-ERSILSEIEHPNIVKLF-----------YSFHDNSKLY--- 228

Query: 323 VPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENI 382
               L++ Y  GG+L   + +  G LD   +     EI   +++LH   +++RDLK EN 
Sbjct: 229 ----LLLQYIPGGELFYHLKE-HGTLDETTVSFYAAEISCALRFLHTKGVVYRDLKPENC 283

Query: 383 LLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTAR-----------CGSED 431
           LL                 +   + + DFGL KK   D                  G+ +
Sbjct: 284 LLN----------------QRGHLVLTDFGLSKKSANDSAVDEEDPENVNALYSIIGTPE 327

Query: 432 YVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           Y +PEIL+G  Y  +  D +++G +LY +L  + P+
Sbjct: 328 YCAPEILLGKAYSQN-CDWYSLGCLLYDMLVGKPPY 362

>YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699)
           Cyclin-dependent serine/threonine protein kinase,
           component of TFIIK subcomplex of transcription factor
           TFIIH, phosphorylates C-terminal domain (CTD) of Rpo21p
           [921 bp, 306 aa]
          Length = 306

 Score = 70.5 bits (171), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 113/259 (43%), Gaps = 57/259 (22%)

Query: 215 LQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGR 274
           +++ K K +G G ++ V L            ++A+K I+   E KD              
Sbjct: 5   MEYTKEKKVGEGTYAVVYLGCQHSTGR----KIAIKEIK-TSEFKD-------------G 46

Query: 275 LDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVG 334
           LD S  RE+  L  + HP +++L  +    F+      YD L L  + +P +L +     
Sbjct: 47  LDMSAIREVKYLQEMQHPNVIELIDI----FMA-----YDNLNLVLEFLPTDLEVVIKDK 97

Query: 335 GDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSL 394
             L         ++  W++       L GV + H + I+HRDLK  N+L   P G I+  
Sbjct: 98  SILFT-----PADIKAWMLM-----TLRGVYHCHRNFILHRDLKPNNLLFS-PDGQIK-- 144

Query: 395 KDKDIYYEHSFVEIADFGLCKKI-EPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAM 453
                        +ADFGL + I  P E+ T+   +  Y +PE+L G  +     D W++
Sbjct: 145 -------------VADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSV 191

Query: 454 GVILYSLLEDRLPFDPLPG 472
           GVI   L+  R+P+  LPG
Sbjct: 192 GVIFAELML-RIPY--LPG 207

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 111/265 (41%), Gaps = 60/265 (22%)

Query: 223 IGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLTRE 282
           IG GNF DV  Y+++D+   E++ + V  + +  E  DI        ELL +       E
Sbjct: 24  IGRGNFGDV--YKAVDRVTQEIVAIKVVNLEHSDE--DI--------ELLAQ-------E 64

Query: 283 ISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMS 342
           I  L  L  P I                    ML+     V   ++M YC GG     + 
Sbjct: 65  IFFLAELKSPLITNYIAT--------------MLED----VSMWIVMEYCGGGSCSDLLK 106

Query: 343 QCSGN-LDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYY 401
           +   N L    +  +  E+ LG+KYLHE   IHRD+K  NILL                 
Sbjct: 107 RSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLN---------------- 150

Query: 402 EHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH--LSDTWAMGVILYS 459
           E   V++ DFG+   I          G+  +++PE++     DG+   +D W++G+  Y 
Sbjct: 151 EEGMVKLGDFGVSGHIRSTLKRDTFVGTPYWMAPEVVC-CEVDGYNEKADIWSLGITTYE 209

Query: 460 LLEDRLP---FDPLPGASIRQKNRP 481
           LL+   P   +DP+   +   K +P
Sbjct: 210 LLKGLPPLSKYDPMKVMTNLPKRKP 234

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score = 70.5 bits (171), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 113/260 (43%), Gaps = 57/260 (21%)

Query: 214 ALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLG 273
           A+ + K K +G G ++  ++Y    Q D    Q+A+K I+  Q  KD             
Sbjct: 3   AVNYTKEKKVGEGTYA--VVYLGHRQTDGR--QIAIKEIKTSQ-FKD------------- 44

Query: 274 RLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCV 333
            LD S  RE+  L  + H  +++L      LF+       + L L  + +P +L M    
Sbjct: 45  GLDMSAIREVKYLQEIRHANVIELVD----LFMAQ-----ENLNLVLEFLPADLEMLIKD 95

Query: 334 GGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRS 393
              L         ++  WL+       L GV + H   I+HRDLK  N+LL  P G ++ 
Sbjct: 96  SSLLF-----TQADIKSWLLM-----TLRGVHHCHRSFILHRDLKPNNLLL-APDGQLK- 143

Query: 394 LKDKDIYYEHSFVEIADFGLCKKIE-PDELCTARCGSEDYVSPEILMGVPYDGHLSDTWA 452
                         IADFGL + +  P E  T+   +  Y +PE+L G  +     D W+
Sbjct: 144 --------------IADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWS 189

Query: 453 MGVILYSLLEDRLPFDPLPG 472
           +GVI   L+  R+P+  LPG
Sbjct: 190 VGVIFAELML-RIPY--LPG 206

>Scas_613.13*
          Length = 312

 Score = 70.5 bits (171), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 74/264 (28%), Positives = 116/264 (43%), Gaps = 63/264 (23%)

Query: 210 EYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFD 269
           EYTK       K +G G ++  ++Y    Q+     Q+AVK I+   E KD         
Sbjct: 13  EYTKG------KKVGEGTYA--VVYLGTKQSTGR--QIAVKEIK-TSEFKD--------- 52

Query: 270 ELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIM 329
                LD S  RE+  L  + H  +++L  +    F+      YD L L  + +P +L +
Sbjct: 53  ----GLDMSAIREVKYLQEIQHDNVIELVDI----FMA-----YDNLNLVLEFLPSDLEV 99

Query: 330 SYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLG 389
                  L         ++  W++       L GV + H + I+HRDLK  N+LL  P G
Sbjct: 100 IIKDRSILFTP-----ADIKSWMLM-----TLRGVHHCHRNFILHRDLKPNNLLLS-PDG 148

Query: 390 NIRSLKDKDIYYEHSFVEIADFGLCKKI-EPDELCTARCGSEDYVSPEILMGVPYDGHLS 448
            I+               +ADFGL + +  P E+ T+   +  Y +PE+L G  +     
Sbjct: 149 VIK---------------VADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAI 193

Query: 449 DTWAMGVILYSLLEDRLPFDPLPG 472
           D W++GVI   L+  R+P+  LPG
Sbjct: 194 DIWSVGVIFAELML-RIPY--LPG 214

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 89/192 (46%), Gaps = 39/192 (20%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLL 338
           L  EI +  S++HP IV+          E    +Y +L++             C  G L+
Sbjct: 126 LLSEIQIHKSMSHPNIVQFIDC-----FEDDSNVYILLEI-------------CPNGSLM 167

Query: 339 AAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKD 398
             + +    L    ++   T+I   +KY+H   +IHRDLKL NI               D
Sbjct: 168 ELLKR-RKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFF-------------D 213

Query: 399 IYYEHSFVEIADFGLCKKIEPD-ELCTARCGSEDYVSPEILMGVPYDGHL--SDTWAMGV 455
             Y    ++I DFGL   +  + E     CG+ +Y++PE+LMG  + GH    D W++GV
Sbjct: 214 SNYN---LKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMG-KHSGHSFEVDIWSLGV 269

Query: 456 ILYSLLEDRLPF 467
           +LY+LL  + PF
Sbjct: 270 MLYALLIGKPPF 281

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 71/143 (49%), Gaps = 21/143 (14%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           +IM YC GG L + +    G +D   I  +  E+L+ +K +H+ N+IHRD+K  N+L+  
Sbjct: 90  IIMEYCAGGSLRSLLR--PGKIDEKYIGVIMRELLVALKVIHKDNVIHRDIKAANVLIT- 146

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDEL-CTARCGSEDYVSPEILM-GVPYD 444
                              V++ DFG+  ++    L      G+  +++PE++M GV YD
Sbjct: 147 ---------------NEGQVKLCDFGVAAQLNQTSLRRQTMAGTPYWMAPEVIMEGVYYD 191

Query: 445 GHLSDTWAMGVILYSLLEDRLPF 467
             + D W++G+  Y +     P+
Sbjct: 192 TKV-DIWSLGITAYEIATGNPPY 213

>Scas_675.2
          Length = 527

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 79/160 (49%), Gaps = 29/160 (18%)

Query: 321 KLVPCN-------LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEH-NI 372
           +L+ CN       +IM    GGDL   +    G +D  + Q  F +++  + YLHE   +
Sbjct: 80  RLIDCNIAKDYMWMIMEMADGGDLFDKIEPDVG-VDSEVAQFYFQQLVRAISYLHEECGV 138

Query: 373 IHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDE----LCTARCG 428
            HRD+K ENILL    GN++               +ADFGL  +    +    + T + G
Sbjct: 139 AHRDIKPENILLDKN-GNLK---------------LADFGLSSQYRRKDGTLRISTDQRG 182

Query: 429 SEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFD 468
           S  Y++PEIL    Y  H +D W++G++L+ LL    P++
Sbjct: 183 SPPYMAPEILHSRGYYAHSTDIWSIGILLFVLLTGETPWE 222

>CAGL0L07810g complement(857656..859446) similar to sp|P25333
           Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, start by
           similarity
          Length = 596

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 81/196 (41%), Gaps = 39/196 (19%)

Query: 274 RLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCV 333
           +    LT E  + +SL+H  IV    +      + C                  +M YC 
Sbjct: 340 KFAKRLTSEFCISSSLHHTNIVDTLDLFQDANGDYCE-----------------VMEYCA 382

Query: 334 GGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRS 393
           GGDL   +   +G L+       F ++L GV Y+H+  + HRDLK EN++L         
Sbjct: 383 GGDLFTLII-AAGKLEYMEADCFFKQLLRGVVYMHDMGVCHRDLKPENLILT-------- 433

Query: 394 LKDKDIYYEHSFVEIADFG--LCKKIEPDE---LCTARCGSEDYVSPEILMGVPYDGHLS 448
                       ++I DFG   C K+  +E   L    CGS  Y++PE  +   +D    
Sbjct: 434 --------HDGVLKITDFGNSECFKMAWEEDIHLSGGVCGSSPYIAPEEYVLEEFDPRPV 485

Query: 449 DTWAMGVILYSLLEDR 464
           D WA GVI  ++   R
Sbjct: 486 DIWACGVIYMAMRTGR 501

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 87/192 (45%), Gaps = 43/192 (22%)

Query: 283 ISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMS 342
           +++L   NHP I+KL+              +D   L         +M    GG+LL  + 
Sbjct: 62  LNLLGQANHPGIIKLYYT-----------FHDQENLY-------FVMDLAPGGELLQLLR 103

Query: 343 QCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYE 402
           +     + W  +    +++  V+Y+H   +IHRDLK EN+LL           DK+    
Sbjct: 104 RQRVFSEAW-ARHYMCQLVDTVEYIHSMGVIHRDLKPENVLL-----------DKE---- 147

Query: 403 HSFVEIADFGLCKKI-------EPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGV 455
              + IADFG    +       + D+  T+  G+ +YVSPE+L+      + SD WA+G 
Sbjct: 148 -GRLMIADFGAAYTVGQSDAGSDGDKPATSFVGTAEYVSPELLLENK-SYYSSDVWALGC 205

Query: 456 ILYSLLEDRLPF 467
           +LY  L+   PF
Sbjct: 206 MLYQFLQGTPPF 217

>AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH]
           (1005431..1006945) [1515 bp, 504 aa]
          Length = 504

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 99/252 (39%), Gaps = 52/252 (20%)

Query: 218 RKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDN 277
           R  + IG G F  V +    D N  E L            +K+ + R +   E   R   
Sbjct: 223 RCQEVIGKGAFGVVRICHKKDANGTEALYA----------VKEFKKRPSEDQEKYSR--- 269

Query: 278 SLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDL 337
            LT E  + +SL H  I+    +      + C                  +M YC GGDL
Sbjct: 270 RLTSEFCLSSSLKHTNIINTLDLFQDAKGDYCE-----------------VMEYCSGGDL 312

Query: 338 LAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDK 397
            + +   +G L+       F +++ GV Y+H+  + HRDLK EN++L             
Sbjct: 313 FSLIVT-AGKLEYMEADCFFKQMIRGVVYMHDMGVCHRDLKPENLILTA----------- 360

Query: 398 DIYYEHSFVEIADF--GLCKKI--EPD-ELCTARCGSEDYVSPEILMGVPYDGHLSDTWA 452
                +  ++I DF  G C ++  E D  L    CGS  Y++PE      +D    D WA
Sbjct: 361 -----NGVLKITDFGNGECFRMAWEKDIHLSGGVCGSSPYIAPEEYSMEEFDPRPVDIWA 415

Query: 453 MGVILYSLLEDR 464
            G I  ++   R
Sbjct: 416 CGTIYMAMRTGR 427

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 72/142 (50%), Gaps = 20/142 (14%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           ++M Y  GG L   ++ C   L    I  +  E L G+++LH   ++HRD+K +NILL +
Sbjct: 692 IVMEYMEGGSLTDVVTHCL--LSEGQIGAVCRETLKGLQFLHSKGVLHRDIKSDNILLSL 749

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELC-TARCGSEDYVSPEILMGVPYDG 445
             GNI+               + DFG C +I  + L  T   G+  +++PE++    Y G
Sbjct: 750 K-GNIK---------------LTDFGFCAQINENNLKRTTMVGTPYWMAPEVVSRKEY-G 792

Query: 446 HLSDTWAMGVILYSLLEDRLPF 467
              D W++G+++  ++E   P+
Sbjct: 793 PKVDIWSLGIMIIEMIEGEPPY 814

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 63/121 (52%), Gaps = 17/121 (14%)

Query: 347  NLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFV 406
            N+     + LF ++  G+++LHE+ I+HRD+K EN+++                     V
Sbjct: 1104 NMTEHEAKLLFKQVASGLRHLHENGIVHRDIKDENVIVD----------------NRGRV 1147

Query: 407  EIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLP 466
            +I DFG    ++         G+ DY +PE+L G PY+G   D WA+GV+LY+++    P
Sbjct: 1148 KIIDFGSAAYVKRGPF-DVFVGTIDYAAPEVLGGDPYEGKPQDVWAVGVLLYTIIYKENP 1206

Query: 467  F 467
            F
Sbjct: 1207 F 1207

>Scas_618.15
          Length = 620

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 101/221 (45%), Gaps = 35/221 (15%)

Query: 327 LIMSYCVGG---DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENIL 383
           ++  Y  GG   D +  ++  S +L R +I++L       VK+LH   IIHRD+K EN+L
Sbjct: 254 IVQEYLHGGEIYDQIVRLTYFSEDLTRHVIRQL----AHAVKHLHSMGIIHRDIKPENLL 309

Query: 384 LKVPLGNIRSLKDKDIYYEHSF-------------------VEIADFGLCKKIEPDELCT 424
            + P+ +I S   K    ++ F                   V++ DFGL K++   E   
Sbjct: 310 FE-PIQHIPSTHVKLRKTDNPFTKVDEGMFRPAIGGGGIGAVKLTDFGLSKQLST-ETTN 367

Query: 425 ARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLPGASIRQKNRPTAH 484
             CG+  Y +PE++    YD  + D W +G +LY+LL    PF      S+ +K R   +
Sbjct: 368 TPCGTISYAAPELIRNHQYDNKI-DLWGIGCVLYTLLCGFPPFYADQHKSVTRKIRHGEY 426

Query: 485 RIARFEWKWHKMIEDDSSAKEIVNNTL-TRKNQRWNCNDIF 524
                 W      E  S AK  V + L    ++R+N +D+ 
Sbjct: 427 HFLSPWWD-----EISSGAKNCVKHLLEVDVSKRYNIDDLL 462

>Scas_720.103
          Length = 804

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 94/393 (23%), Positives = 160/393 (40%), Gaps = 80/393 (20%)

Query: 104 SPMSPAV--LNKSPQAIKSTEMKINIPKRRAQYKPNLDGLIGSKPIRIISEVVPTPDTAQ 161
           +P S A     +SP A  S  M+ +I       + N     GS+P  + +  +P      
Sbjct: 291 TPASTAASTTTRSPSASNSPTME-SISTANESIRTNTRTRSGSRPQTLRTHSIPI----V 345

Query: 162 QRVISLPTVSEETTTENDKFPIHHDGTALADDSNSQEDDIVLMGYRIGEYTKALQ----- 216
           +R +S+P    +      +  I  D    + DS  +     L     G   + ++     
Sbjct: 346 KRALSVPNTESDINHTQSEVQISKDKRTYSIDSEPKRSQ-RLRNKSFGNKFQDIKVNPQS 404

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLD 276
           + K+K +G G+   V L +    N    +++  K        KD+  R     E + R+ 
Sbjct: 405 FEKIKLLGQGDVGKVFLVKEKKTNGLYAMKIYNK--------KDMIKR-----EKIKRV- 450

Query: 277 NSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGD 336
                E  +L + NHP IV L               Y   +    L  C   M YC+GG+
Sbjct: 451 ---ITEQEILATSNHPFIVTL---------------YHSFQTEDYLYLC---MEYCMGGE 489

Query: 337 LLAAM----SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIR 392
              A+    S+C    D        +E+L  ++YLH    I+RDLK ENILL    G+I 
Sbjct: 490 FFRALQTRDSKCICEDDARFYA---SEVLAALEYLHLLGFIYRDLKPENILLHKS-GHIM 545

Query: 393 ------SLKDKD----IYYEHSFVEIADFGLCKKIEPDELCT------ARCGSEDYVSPE 436
                 S+  KD    I+ +   +   +  L   I   ++C+      +  G+E+Y++PE
Sbjct: 546 LSDFDLSVHAKDSKNPIFMKDGILPTTNSNL---IVDTKICSEGFRTNSFVGTEEYIAPE 602

Query: 437 ILMGVPYDGH--LSDTWAMGVILYSLLEDRLPF 467
           ++ G   +GH    D W +G++++ +L  + PF
Sbjct: 603 VIRG---NGHTVAVDWWTLGILIFEMLFGKTPF 632

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 96/237 (40%), Gaps = 80/237 (33%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG--- 335
           + REI+++   +H  +VKL  V D +     R +Y             L++ YC  G   
Sbjct: 162 IRREIAIMKKCDHEHVVKLIEVLDDM---KSRKIY-------------LVLEYCSKGEVK 205

Query: 336 ----DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNI 391
               D L A ++    L     + +   ++LG++YLH   IIHRD+K  N+LL       
Sbjct: 206 WCPGDQLEAAARGPPLLTFQRTREILRGVVLGLEYLHYQGIIHRDIKPANLLLS------ 259

Query: 392 RSLKDKDIYYEHSFVEIADFGLCKKIE-----------------------PDELCTAR-C 427
                     EH  V+I+DFG+                            PD+L  A+  
Sbjct: 260 ----------EHDIVKISDFGVSLASSNSGTPSSRSSSSSSVKGVLGAEGPDDLELAKTA 309

Query: 428 GSEDYVSPEILMGV-------------PYDG----HLSDTWAMGVILYSLLEDRLPF 467
           G+  + +PEI +G              P  G    ++ D WA+GV LY LL  +LPF
Sbjct: 310 GTPAFFAPEICLGSDAYEKLNIDRQSNPCSGSLISYMIDIWALGVTLYCLLFGKLPF 366

>Kwal_33.13222
          Length = 148

 Score = 66.2 bits (160), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 63/130 (48%), Gaps = 22/130 (16%)

Query: 312 LYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHN 371
           LYD+ +    L    +++ Y   G+L   + +  G L      R F +I++G+ Y H   
Sbjct: 12  LYDVWETNSNLY---MVLEYVEKGELFNLLVE-RGPLPENEAVRFFRQIIIGISYCHALG 67

Query: 372 IIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSF-VEIADFGLCKKIEPDELCTARCGSE 430
           I+HRDLK EN+LL                 +H F ++IADFG+      D+L    CGS 
Sbjct: 68  IVHRDLKPENLLL-----------------DHKFNIKIADFGMAALESKDKLLETSCGSP 110

Query: 431 DYVSPEILMG 440
            Y +PEI+ G
Sbjct: 111 HYAAPEIVSG 120

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/296 (23%), Positives = 128/296 (43%), Gaps = 69/296 (23%)

Query: 201 IVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQEL-- 258
           IV    R G   +   ++ ++ +G G +  V+L +  D+   +L   A+K+++  + L  
Sbjct: 129 IVGGDVRTGISREISDFKPIRVLGQGAYGKVILVK--DKQTSKL--YAMKQLKKAEILIA 184

Query: 259 -----KDIRNRSANFDELLGRLDNSLTREI-------SVLNSLNHPCIVKLFGVNDPLFI 306
                 +  ++ A  D+ +   D  L++ I       ++L+ L HP IVKLF        
Sbjct: 185 PTDANTESMDKLAELDKPVDSEDEKLSKRIERTFAERTILSQLEHPNIVKLF-------- 236

Query: 307 ESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKY 366
                 +D  KL        L++ Y  GG+L   + +  G L+   +     EI   +K+
Sbjct: 237 ---YSFHDTSKLY-------LLLQYIPGGELFFHLKE-HGTLEEDTVAFYAAEISCALKF 285

Query: 367 LHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKK----IEPDEL 422
           LH   +++RDLK EN LL                 ++  + + DFGL K        ++L
Sbjct: 286 LHSKGVVYRDLKPENCLLN----------------QNGHLVLTDFGLSKSSASNASQEDL 329

Query: 423 CTAR-----------CGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
                           G+ +Y +PEIL+G PY  +  D +++G +LY +L  + P+
Sbjct: 330 GAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTAN-CDWYSLGCLLYDMLTGKPPY 384

>Kwal_56.22788
          Length = 515

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 119/269 (44%), Gaps = 63/269 (23%)

Query: 220 VKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSL 279
           V+ +G G +  VLL +  D +   L   A+K+++  + L  I + S+   +    L+  L
Sbjct: 128 VRVLGRGAYGKVLLVK--DSHTSRL--YAMKQLKKAEIL--IHDGSSEEGQPDSNLEKRL 181

Query: 280 TR---EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGD 336
            R   E ++L+ L HP IVKLF              +D  KL        LI+ +  GG+
Sbjct: 182 ERTFAERTILSQLEHPNIVKLF-----------YSFHDHHKLY-------LILQFIPGGE 223

Query: 337 LLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKD 396
           L   + +  G LD   +     EI   +++LH+  +++RDLK EN LL            
Sbjct: 224 LFYHLKE-QGTLDEDTVAFYAAEISCALRFLHKRGVVYRDLKPENCLLD----------- 271

Query: 397 KDIYYEHSFVEIADFGLCKKIEPDE----------------LCTARC--GSEDYVSPEIL 438
                E   + + DFGL K    D+                +CT     G+ +Y +PEIL
Sbjct: 272 -----ERGHLVLTDFGLSKVSASDDSADGGDVNTNGHEGESVCTLHSIIGTPEYCAPEIL 326

Query: 439 MGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
            G PY  +  D +++G +++ +L  + P+
Sbjct: 327 EGKPYTQN-CDWYSLGCLIFDMLIGKPPY 354

>Scas_707.36
          Length = 915

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 96/221 (43%), Gaps = 62/221 (28%)

Query: 277 NSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG- 335
           N + +EI+++   N+  +VKL  + D L   S R +Y             L++ YC  G 
Sbjct: 142 NKIKKEIAIMKKCNNKHVVKLIEILDDL---SSRKIY-------------LVLEYCEKGP 185

Query: 336 ------DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLG 389
                 D L   S+    L     + +F +++LG++YLH   IIHRD+K  N+L+     
Sbjct: 186 ILWCPRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLHSQGIIHRDIKPANLLM----- 240

Query: 390 NIRSLKDKDIYYEHSFVEIADFGLCKK------IEPDEL-CTARCGSEDYVSPEILMGVP 442
                 DK+       V+I+DFG+            DEL  T   G+  + +PEI +G  
Sbjct: 241 ------DKN-----GVVKISDFGVSLAANGNIDTNDDELELTKTVGTPVFYAPEICLGAA 289

Query: 443 ------------YDGHL----SDTWAMGVILYSLLEDRLPF 467
                       ++G       D WA+G+ LY LL   LPF
Sbjct: 290 AMERFNLDKDELFNGSCISFKIDIWALGITLYCLLFGMLPF 330

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 80/330 (24%), Positives = 139/330 (42%), Gaps = 61/330 (18%)

Query: 156 TPDTAQQRVISLPTVSEETTTENDKFPIHHDGTALADDSNSQEDDIVLMGYRIGEYTKAL 215
           TP  +++R       +  T     +FP+  D  A  D +  +    +   ++  +  + L
Sbjct: 87  TPARSRRRSSLYNKFAVSTPPNTTRFPVSVDAEAFLDPTLPEG---MSPSFQKRQTPRKL 143

Query: 216 Q-WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIR-------YPQELKDIRNRSAN 267
           + ++ V+ +G G +  VLL +  DQ   +L   A+K+++        P+E       +  
Sbjct: 144 EDFKPVRVLGRGAYGKVLLVK--DQLTSKLF--AMKQLKKAEIVVTAPEEESTDGEDAVL 199

Query: 268 FDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNL 327
              ++ +       E ++L+ L HP IVKLF              +D  KL        L
Sbjct: 200 LPAVVEKRVERTFAERTILSQLEHPNIVKLF-----------YSFHDHHKLY-------L 241

Query: 328 IMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVP 387
           ++ Y  GG+L   + +  G LD   +     EI   +K+LH   I++RDLK EN LL   
Sbjct: 242 VLQYIPGGELFYHLKE-QGTLDEVTVSFYAAEISCALKFLHSKGIVYRDLKPENCLLD-- 298

Query: 388 LGNIRSLKDKDIYYEHSFVEIADFGLCKK----------IEPDELCTARCGSEDYVSPEI 437
                         +   + + DFGL K+           E  E   +  G+ +Y +PEI
Sbjct: 299 --------------DKGHLVLTDFGLSKRGVNQADSPLGGEQVEELYSIIGTPEYCAPEI 344

Query: 438 LMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           L G PY  +  D +++G + Y +L  + PF
Sbjct: 345 LCGQPYTQN-CDWYSLGSLTYDMLIGKPPF 373

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 74/142 (52%), Gaps = 19/142 (13%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           L++++  GG+L   + Q  G       +    E+L  +  LH+ ++I+RDLK ENILL  
Sbjct: 419 LVLAFINGGELFYHL-QHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLD- 476

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCK-KIEPDELCTARCGSEDYVSPEILMGVPYDG 445
                        Y  H  + + DFGLCK  ++ ++     CG+ +Y++PEIL+G  Y  
Sbjct: 477 -------------YQGH--IALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTK 521

Query: 446 HLSDTWAMGVILYSLLEDRLPF 467
            + D W +G++LY ++    P+
Sbjct: 522 TV-DWWTLGILLYEMMTGLPPY 542

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 112/258 (43%), Gaps = 64/258 (24%)

Query: 221 KTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDE-LLGRLDNSL 279
           +T+G G++S VLL  SI+ N     + AVK +     +K  + +  N ++  L RL N+ 
Sbjct: 159 ETLGDGSYSTVLLATSIESNK----KYAVKILNKEYLIKQKKVKYVNIEKNTLQRLKNT- 213

Query: 280 TREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLA 339
                         I+ L+        +    LY              ++ Y   GDLL+
Sbjct: 214 ------------KGIISLY-----FTFQDESSLY-------------FLLEYAPNGDLLS 243

Query: 340 AMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDI 399
            M +  G+++    Q    +I+  + ++H+  +IHRDLK ENILL V +           
Sbjct: 244 LMRK-HGSVNEKCTQYYAAQIIDALGFMHDKGVIHRDLKPENILLDVDMK---------- 292

Query: 400 YYEHSFVEIADFGLCKKIEP---DEL-------CTARCGSEDYVSPEILMGVPYDGHLSD 449
                 V++ DFG  + ++    D+L         +  G+ +YVSPE L+   Y     D
Sbjct: 293 ------VKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVGTAEYVSPE-LLNDNYVDFRCD 345

Query: 450 TWAMGVILYSLLEDRLPF 467
            WA G IL+ ++  + PF
Sbjct: 346 IWAFGCILFQMIAGKPPF 363

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 69.3 bits (168), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 86/190 (45%), Gaps = 36/190 (18%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLL 338
           L RE+ +   ++HP I+KL+           + +Y             L+M + + G+L 
Sbjct: 145 LKREVDIQLGMDHPNIIKLYA-----HFHDEKRVY-------------LLMEHSINGELY 186

Query: 339 AAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKD 398
            ++   +G  +  L      +I   + Y+H+  IIHRD+K EN+L  +   N+       
Sbjct: 187 KSLKN-NGPFNDVLASHYIYQIADALHYMHKKRIIHRDVKPENVL--IGFDNV------- 236

Query: 399 IYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILY 458
                  V++ADFG              CG+ DY+SPE++    YD  + D WA+GV+ Y
Sbjct: 237 -------VKLADFGWSILNPEGSKRKTLCGTIDYLSPEMITPREYDEQV-DVWALGVLAY 288

Query: 459 SLLEDRLPFD 468
            L+    PF+
Sbjct: 289 ELVVGVPPFE 298

>Kwal_26.7635
          Length = 691

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 113/251 (45%), Gaps = 58/251 (23%)

Query: 220 VKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSL 279
           +K IG G+F  V+     D N       A+K IR        ++   +  E++  L    
Sbjct: 361 LKVIGKGSFGKVMQVRKKDTNK----VYALKAIR--------KSYIVSKSEVIHTL---- 404

Query: 280 TREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLA 339
             E +VL  + +P IV L         +S   LY             +++++  GG+L  
Sbjct: 405 -AERTVLARVENPFIVPL-----KFTFQSPDKLY-------------IVLAFINGGELFY 445

Query: 340 AMS-QCSGNLDRWLIQRLFT-EILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDK 397
            +  +   +L R    RL+T E+L  ++ LH  ++I+RDLK ENILL             
Sbjct: 446 HLQREGRFSLSR---ARLYTAELLCALETLHNLDVIYRDLKPENILLD------------ 490

Query: 398 DIYYEHSFVEIADFGLCK-KIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVI 456
                   + + DFGLCK  ++  +     CG+ +Y++PE+L+G  Y   + D W +GV+
Sbjct: 491 ----HQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVL 545

Query: 457 LYSLLEDRLPF 467
           LY ++    P+
Sbjct: 546 LYEMMTGLPPY 556

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 119/276 (43%), Gaps = 65/276 (23%)

Query: 207 RIGEYTKALQWRKVK------TIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKD 260
           + G+ T+ L  + +K       +G G++S V+L   I+       + A K +     +K 
Sbjct: 184 QTGQITRQLIKKGIKDFKFGEALGDGSYSTVVLATCIESGK----KYAAKILNKEYLIKQ 239

Query: 261 IRNRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQ 320
            + +  N ++      N+L R    LNS   P ++KL+        +    LY       
Sbjct: 240 KKVKYVNIEK------NTLQR----LNSSRVPGVIKLY-----FTFQDEANLY------- 277

Query: 321 KLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLE 380
                  ++ Y   GD L+ M +  G L     +    +IL  + +LH+  IIHRD+K E
Sbjct: 278 ------FLLEYAPNGDFLSVMKRF-GTLSEECTKYYGAQILDAIHHLHKQGIIHRDVKPE 330

Query: 381 NILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKI------EPDELCT---ARCGSED 431
           NILL           DK +      +++ DFG  K I      +P +L T   +  G+ +
Sbjct: 331 NILL-----------DKTMK-----IKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAE 374

Query: 432 YVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           YVSPE+L     D    D WA G IL+ ++  + PF
Sbjct: 375 YVSPELLNDNYVDSRC-DIWAFGCILFQMVAGKPPF 409

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 85/193 (44%), Gaps = 39/193 (20%)

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
           EI +L +L H  IV+  G     FI+    LY             +I+ YC  G L   +
Sbjct: 55  EIDLLKNLRHQNIVEYRG-----FIQKAHELY-------------IILEYCARGSLRDIL 96

Query: 342 SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYY 401
               G L         T+ L G++YLHE  +IHRD+K  N+LL                 
Sbjct: 97  KH--GPLLEDDTVNYVTQTLYGLQYLHEQGVIHRDIKAANLLLT---------------- 138

Query: 402 EHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLL 461
           E   V++ADFG+  +I  + +     GS ++++PE++ G      +SD W++G  +  LL
Sbjct: 139 EEGIVKLADFGVSTRI--NRMAMTYAGSPNWMAPEVMTGQGAST-VSDIWSLGATVVELL 195

Query: 462 EDRLPFDPLPGAS 474
               PF  L   S
Sbjct: 196 TGNPPFHNLVNES 208

>Scas_711.15
          Length = 727

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 60/109 (55%), Gaps = 9/109 (8%)

Query: 353 IQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKD-----IYYEHSFVE 407
           ++ +  +IL G+K++H+HN  HRD+K ENIL+     N R   DK+      Y ++  V+
Sbjct: 170 LKSILAQILAGIKHIHDHNFFHRDIKPENILVS---PNKRYF-DKERLELGFYPDNYVVK 225

Query: 408 IADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVI 456
           +ADFGL + +E     TA   +  Y SPEIL+   Y     D WA G +
Sbjct: 226 LADFGLARHVENKNTYTAYVSTRWYRSPEILLRNGYYSTPLDIWAFGCV 274

>Kwal_56.22476
          Length = 697

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 63/117 (53%), Gaps = 21/117 (17%)

Query: 355 RLFTEILLG-VKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGL 413
           R FT  ++G VKY+H   +IHRDLKL NI             DK     H  +++ DFGL
Sbjct: 179 RFFTTQIVGAVKYMHSRRVIHRDLKLGNIFF-----------DK-----HYNLKVGDFGL 222

Query: 414 CKKIEPD-ELCTARCGSEDYVSPEILMGVPYDGHLS--DTWAMGVILYSLLEDRLPF 467
              +  D E     CG+ +Y++PE+L G  + GH    D W+ GV++Y+LL  + PF
Sbjct: 223 AAVLANDRERKYTVCGTPNYIAPEVLTG-KHTGHSYEVDIWSCGVMIYALLIGKPPF 278

>Kwal_55.20189
          Length = 812

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 76/149 (51%), Gaps = 25/149 (16%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           ++M YC GGDL  A+          +I  + ++I+  ++++H+  I HRDLK ENIL++ 
Sbjct: 131 IVMEYCSGGDLYEAIKADLIPKRTKVITHIASQIMEAIEFVHQKGIYHRDLKPENILIE- 189

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEIL-------- 438
             G+  ++K            + D+GL    EP  L  +  GSE Y++PE+         
Sbjct: 190 --GSDWTIK------------LTDWGLA-TTEPTSLDRS-VGSERYMAPELFEENLDRDE 233

Query: 439 MGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
              PYD    D WA+G++L +++  + PF
Sbjct: 234 RSEPYDCSKVDLWAIGIVLLNIVFQKNPF 262

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 90/198 (45%), Gaps = 36/198 (18%)

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
           E  +L + NHP +V L+        +S   LY             L M YC+GG+   A+
Sbjct: 545 EQEILATSNHPFVVTLYHS-----FQSEDYLY-------------LCMEYCMGGEFFRAL 586

Query: 342 ----SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDK 397
               S+C    D        +E+   ++YLH    I+RDLK ENILL      + S  D 
Sbjct: 587 QTRKSKCISEEDAKFYA---SEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDL 643

Query: 398 DIYYEHSFVEIADFGLCKKIEPDELCT------ARCGSEDYVSPEILMGVPYDGHLS--D 449
            I  + + V +        +   ++C+      +  G+E+Y++PE++ G   +GH +  D
Sbjct: 644 SIQAKDAKVPVVKGNAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVIRG---NGHTAAVD 700

Query: 450 TWAMGVILYSLLEDRLPF 467
            W +G+++Y +L    PF
Sbjct: 701 WWTLGILIYEMLFGFTPF 718

>Scas_700.35
          Length = 439

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 62/123 (50%), Gaps = 18/123 (14%)

Query: 346 GNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSF 405
           G +   ++ ++   +L G+ YLHE  IIHRD+K +NILL                 E   
Sbjct: 248 GRIGEKILGKIAESVLRGLSYLHERKIIHRDIKPQNILLN----------------EEGE 291

Query: 406 VEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRL 465
           V++ DFG+  +   + L T   G+  Y++PE + G PY     D W++G+ +  + + R 
Sbjct: 292 VKLCDFGVSGE-AVNSLATTFTGTSFYMAPERIQGHPYS-VTCDVWSLGLTILEVAQGRF 349

Query: 466 PFD 468
           PFD
Sbjct: 350 PFD 352

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 87/202 (43%), Gaps = 44/202 (21%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLL 338
           +  EI V+N   H  IV         F+E+       LK    L    ++M Y  GG L 
Sbjct: 626 IVNEIMVMNDSRHENIVN--------FLEA------YLKTEDDLW---VVMEYMEGGSLT 668

Query: 339 AAMSQCSGN------LDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIR 392
             +     N      L    I  +  E   G+K+LH+ NIIHRD+K +N+LL        
Sbjct: 669 DIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLHDKNIIHRDIKSDNVLLDT------ 722

Query: 393 SLKDKDIYYEHSFVEIADFGLCKKIEPDELCTAR-CGSEDYVSPEILMGVPYDGHLSDTW 451
                      + V+I DFG C K+       A   G+  +++PE++    YD  + D W
Sbjct: 723 ----------KARVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQKEYDAKV-DVW 771

Query: 452 AMGVILYSLLEDRLPF---DPL 470
           ++G++   +LE   P+   DPL
Sbjct: 772 SLGIMAIEMLEGEPPYLNEDPL 793

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 89/192 (46%), Gaps = 39/192 (20%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLL 338
           L  EI +  S+ HP IV+          E    +Y +L++             C  G ++
Sbjct: 134 LLSEIQIHKSMKHPNIVQFTDC-----FEDDTNVYILLEI-------------CPNGSVM 175

Query: 339 AAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKD 398
             + Q   +L    ++    +I+  ++Y+H   +IHRDLKL NI             DK+
Sbjct: 176 ELLRQ-RKHLTEPEVRFCMIQIIGAIRYMHSRRVIHRDLKLGNIFF-----------DKE 223

Query: 399 IYYEHSFVEIADFGLCKKIEPD-ELCTARCGSEDYVSPEILMGVPYDGHLS--DTWAMGV 455
                  ++I DFGL   +  D E     CG+ +Y++PE+L G  + GH    D W++GV
Sbjct: 224 YN-----LKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTG-KHTGHSYEVDIWSIGV 277

Query: 456 ILYSLLEDRLPF 467
           +LY+LL  + PF
Sbjct: 278 MLYALLFGKPPF 289

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 82/198 (41%), Gaps = 37/198 (18%)

Query: 275 LDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVG 334
               L RE+    S     IV+ FG+      E    +Y             + M Y  G
Sbjct: 220 FQKQLLRELQFNKSFKSEYIVRYFGM---FTDEQNSSIY-------------IAMEYMGG 263

Query: 335 GDLLAAMSQC---SGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNI 391
             L A   +     G +   ++ ++   +L G+ YLHE  +IHRD+K +NILL       
Sbjct: 264 KSLEAIYKELLSRGGRISEKVLGKISEAVLRGLSYLHEKKVIHRDIKPQNILLN------ 317

Query: 392 RSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTW 451
                     E   V++ DFG+  +   + L T   G+  Y++PE + G PY     D W
Sbjct: 318 ----------EDGQVKLCDFGVSGEAV-NSLATTFTGTSYYMAPERIQGQPYS-VTCDVW 365

Query: 452 AMGVILYSLLEDRLPFDP 469
           ++G+ +  + +   PF P
Sbjct: 366 SLGLTILEVAQGHFPFGP 383

>Kwal_27.10004
          Length = 735

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 77/161 (47%), Gaps = 37/161 (22%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRL--FTEILLGVKYLHEHNIIHRDLKLENILL 384
            +M YC  GDL + +S+ +    R L ++   + +++ G+K++H   ++HRD+K EN+L+
Sbjct: 361 FVMEYCTEGDLFSLISKPNWK-KRPLKEKYEYWRQVVEGIKFIHSQGVVHRDIKPENVLI 419

Query: 385 KVPLGNIRSLKDKDIYYEHSFVEIADFGLCK--KIEPDELCT------ARCGSEDYVSPE 436
                            +    ++ DFG+      +PD+L +         GS  Y +PE
Sbjct: 420 S----------------KEGIAKMTDFGISDWGNEDPDDLTSPVRLFDTYVGSPPYSAPE 463

Query: 437 ILM----------GVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           ++             PYD +  D WA+GV+L++L+    PF
Sbjct: 464 VVAFKDEDSTYQDRKPYDAYKMDCWALGVLLFTLVYQCTPF 504

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 71/143 (49%), Gaps = 21/143 (14%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           +IM +C GG L + +    G +D   I  +  E+L+ +K +H+ N+IHRD+K  N+L+  
Sbjct: 97  IIMEHCAGGSLRSLLRP--GKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLIT- 153

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDEL-CTARCGSEDYVSPEILM-GVPYD 444
                              V++ DFG+  ++    L      G+  +++PE++M GV YD
Sbjct: 154 ---------------NEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYD 198

Query: 445 GHLSDTWAMGVILYSLLEDRLPF 467
             + D W++G+  Y +     P+
Sbjct: 199 TKV-DIWSLGITTYEIATGNPPY 220

>Scas_703.5
          Length = 749

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 71/141 (50%), Gaps = 18/141 (12%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           L+  +  GG+L   + Q  G       +    E++L ++YLH+++I++RDLK ENILL  
Sbjct: 422 LVTDFMSGGELFWHL-QKEGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILLDA 480

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
             GNI                + DFGL K    D   T  CG+ +Y++PE+L+       
Sbjct: 481 N-GNI---------------ALCDFGLSKADLKDRTNTF-CGTTEYLAPELLLDEAGYTK 523

Query: 447 LSDTWAMGVILYSLLEDRLPF 467
           + D W++GV+++ +     PF
Sbjct: 524 MVDFWSLGVLIFEMCCGWSPF 544

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 70/142 (49%), Gaps = 20/142 (14%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           +IM Y  GG L   ++ C   L    I  +  E L G+ +LH   +IHRD+K +NILL +
Sbjct: 755 VIMEYMEGGSLTDVVTHCI--LTEGQIAAVSRETLRGLHFLHSKGVIHRDIKSDNILLSM 812

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELC-TARCGSEDYVSPEILMGVPYDG 445
             GNI+               + DFG C +I    L  T   G+  +++PE++    Y G
Sbjct: 813 D-GNIK---------------LTDFGFCAQINETNLKRTTMVGTPYWMAPEVVSRKEY-G 855

Query: 446 HLSDTWAMGVILYSLLEDRLPF 467
              D W++G+++  ++E   P+
Sbjct: 856 PKVDIWSLGIMIIEMIEGEPPY 877

>Kwal_47.16761
          Length = 744

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 71/141 (50%), Gaps = 18/141 (12%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           L+  +  GG+L   + Q  G       +    E++L ++YLHE++I++RDLK ENILL  
Sbjct: 412 LVTDFMSGGELFWHL-QKEGRFAEDRARFYIAELVLALEYLHENDIVYRDLKPENILLDA 470

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
             GNI                + DFGL K    D   T  CG+ +Y++PE+L+       
Sbjct: 471 N-GNI---------------ALCDFGLSKADLKDRTNTF-CGTTEYLAPELLLDESGYTK 513

Query: 447 LSDTWAMGVILYSLLEDRLPF 467
           + D W++GV+++ +     PF
Sbjct: 514 MVDFWSLGVLIFEMCCGWSPF 534

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 120/281 (42%), Gaps = 62/281 (22%)

Query: 190 LADDSNSQEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAV 249
           + +DSN  ++  V  G      T  L +++ + IG G F   ++Y++      ++  V V
Sbjct: 1   MPNDSNGSKEQGVGQGSN--SLTPQL-FKRTEVIGRGKFG--VVYKAYHAKTKQVYAVKV 55

Query: 250 KRIRYPQ-ELKDIRNRSANFDELLGRLDNSLTREISVLNSLNH-PCIVKLFGVNDPLFIE 307
             +  P+ E++D++                  +EI  L SL   P I + +G        
Sbjct: 56  LNLDCPEDEVEDVQ------------------KEIQFLASLKQVPNITRYYGSY------ 91

Query: 308 SCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYL 367
               LYD      KL    +IM YC GG L   +    G +D   +  +  ++L+ + Y+
Sbjct: 92  ----LYDT-----KLW---VIMEYCAGGSLRTLLR--PGKIDEKYLGVIVRKLLIALVYI 137

Query: 368 HEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKI-EPDELCTAR 426
           H+ N+IHRD+K  N+L+                     V++ DFG+  ++   +      
Sbjct: 138 HKDNVIHRDIKAANVLIT----------------NEGHVKLCDFGVAAQLTAANHKRQTM 181

Query: 427 CGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
            G+  +++PE++M   Y    +D W++G+  Y +     P+
Sbjct: 182 AGTPYWMAPEVIMEGVYYNTKADIWSLGITAYEIATGNPPY 222

>YHR082C (KSP1) [2372] chr8 complement(268460..271549)
           Serine/threonine kinase that suppresses prp20 mutant
           when oveproduced [3090 bp, 1029 aa]
          Length = 1029

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 69/150 (46%), Gaps = 27/150 (18%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           +IM YC GGDL  A+   +       I  + T+I+  ++Y+H   I HRD+K ENIL+  
Sbjct: 158 IIMEYCSGGDLYEAIKADAVPKKTKSITHIITQIMDAIEYVHNKGIYHRDIKPENILISG 217

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTAR-CGSEDYVSPEIL------- 438
               I+               + D+GL      D+    R  GSE Y+SPE+        
Sbjct: 218 IDWTIK---------------LTDWGLATT---DKTSMDRNVGSERYMSPELFDSNLDIK 259

Query: 439 -MGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
               PYD    D WAMG++  +++  + PF
Sbjct: 260 ERKEPYDCAKVDLWAMGIVFLNIVFHKNPF 289

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 126/291 (43%), Gaps = 45/291 (15%)

Query: 195 NSQEDDIVLMGYRIGEYTKAL------QWRKVKTIGVGNF--SDVLLYESIDQNDPELLQ 246
           ++ +DD+ L   R+     A+      +W K+K+  +G     D+L++            
Sbjct: 262 DAAQDDMFLGQVRLHPNMNAVTPGVHSEWHKLKSRALGEHVTGDILIHWEY--------- 312

Query: 247 VAVKRIRY-PQELKDIRNRSANFDELLGRLDNSLTREISVLNSLNHPCIVK------LFG 299
            + K+ +Y PQ+ + +R         + ++    T  I  +  L+   IVK        G
Sbjct: 313 TSTKKRQYGPQDFEVLRLLGKGTFGQVYQVRKKDTMRIYAMKVLSKKVIVKKNEIAHTIG 372

Query: 300 VNDPLFIESCR--PLYDMLKLR-QKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRL 356
             + L   + +  P    LK   Q      L+  +  GG+L   + Q  G       +  
Sbjct: 373 ERNILVRTASKSSPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHL-QKEGRFTEDRAKFY 431

Query: 357 FTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKK 416
             E++L ++YLH+++I++RDLK ENILL    GNI                + DFGL K 
Sbjct: 432 IAELVLALEYLHDNDIVYRDLKPENILLDAN-GNI---------------ALCDFGLSKA 475

Query: 417 IEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
              D   T  CG+ +Y++PE+LM       + D W++GV+++ +     PF
Sbjct: 476 DLKDRTNTF-CGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCGWSPF 525

>Kwal_27.9763
          Length = 868

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 87/189 (46%), Gaps = 39/189 (20%)

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
           EI +L +L H  IVK  G     FI+    L+             +++ YC  G L   +
Sbjct: 68  EIDLLKNLKHENIVKYHG-----FIQKSHQLF-------------ILLEYCSQGSLRDLI 109

Query: 342 SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYY 401
            +  G ++    +    + L G+KYLH+  +IHRD+K  N+LL                 
Sbjct: 110 KR--GPVEEQQCKTYIRQTLHGLKYLHDQGVIHRDIKAANLLLDA--------------- 152

Query: 402 EHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLL 461
             + V++ADFG+  ++  + L     GS ++++PE++MG      +SD W++G  +  +L
Sbjct: 153 -QNVVKLADFGVSTRV--NNLAMTYAGSPNWMAPEVMMGQGAST-VSDIWSLGATVVEIL 208

Query: 462 EDRLPFDPL 470
               PF  L
Sbjct: 209 TGNPPFHNL 217

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 92/224 (41%), Gaps = 61/224 (27%)

Query: 273 GRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYC 332
           G  D  + REI+++   +H  +VKL  V D       R +Y             L++ YC
Sbjct: 168 GIEDEKIKREIAIMKKCHHEHVVKLIEVLDDA---KSRKIY-------------LVLEYC 211

Query: 333 VGG-------DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLK 385
             G       D++   ++    L     + +F  +LLG++YLH   IIHRD+K  N+LL 
Sbjct: 212 SKGEIKWCPGDVIETKARGPPLLSFQRTREIFRGVLLGLEYLHFQGIIHRDIKPANLLLS 271

Query: 386 VPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPD-------ELCTAR-CGSEDYVSPEI 437
                           E   V+I+DFG+      D       EL  A+  G+  + +PEI
Sbjct: 272 ----------------EDGIVKISDFGVSLAFSSDSSTDSLNELELAKTAGTPAFFAPEI 315

Query: 438 LM--------------GVPYDGHLSDTWAMGVILYSLLEDRLPF 467
            +                P     +D WAMG+ L+ LL   LPF
Sbjct: 316 CLVEDTIKKFDLDPNSKEPIISFPTDIWAMGITLHCLLFGMLPF 359

>CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces
           cerevisiae YKL139w CTK1 carboxy-terminal domain kinase,
           hypothetical start
          Length = 553

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 85/188 (45%), Gaps = 44/188 (23%)

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYC---VGGDL 337
           REI +L S NH  +  +      + +ES + +Y             +I  Y    +GG L
Sbjct: 267 REIKLLQSFNHENVSTI----KEIMVESQKIIY-------------MIFEYADNDLGGLL 309

Query: 338 LAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDK 397
           L        N++    + +F +IL G++YLH++NI+HRD+K  NIL+     N  SLK  
Sbjct: 310 LNKQI----NINAAQSKHIFKQILHGIEYLHDNNILHRDIKGSNILID----NQGSLK-- 359

Query: 398 DIYYEHSFVEIADFGLCKKIEPDELC----TARCGSEDYVSPEILMGVPYDGHLSDTWAM 453
                     + DFGL +KI+ +       T R  +  Y  PE+L+G    G   D W  
Sbjct: 360 ----------LTDFGLARKIDCNRDAIRDYTNRVITIWYRPPELLLGTTNYGPEVDMWGC 409

Query: 454 GVILYSLL 461
           G IL  L 
Sbjct: 410 GCILVELF 417

>Kwal_26.7552
          Length = 461

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 102/246 (41%), Gaps = 52/246 (21%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLD 276
           + +++ +G G +  V  Y++ +    +L  VA+KR+R   E +     S           
Sbjct: 131 YERIQQVGEGTYGKV--YKARNTVTGQL--VALKRLRLEGEREGFPITS----------- 175

Query: 277 NSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGD 336
               REI +L S +H  I  L      + +ES + +Y             +I  Y    D
Sbjct: 176 ---IREIKLLQSFDHRNISTL----SEIMVESQKTVY-------------MIFEYA-DND 214

Query: 337 LLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKD 396
           L   +      L     + LF  +L G+ YLH++ I+HRD+K  NIL+     N   LK 
Sbjct: 215 LSGLLMNEQITLSNANCKHLFKSLLEGIHYLHDNGILHRDIKGSNILID----NKGQLK- 269

Query: 397 KDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVI 456
                      I DFGL +K+  D   T R  +  Y  PE+LMG    G   D W  G +
Sbjct: 270 -----------ITDFGLARKMRDDSDYTNRVITLWYRPPELLMGSTNYGTAVDMWGCGCL 318

Query: 457 LYSLLE 462
           L  L +
Sbjct: 319 LVELFK 324

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 71/141 (50%), Gaps = 18/141 (12%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           L+  +  GG+L   + Q  G       +    E++L ++YLH+++I++RDLK ENILL  
Sbjct: 382 LVTDFLSGGELFWHL-QKEGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILLDA 440

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
             GNI                + DFGL K    D   T  CG+ +Y++PE+L+       
Sbjct: 441 N-GNI---------------ALCDFGLSKADLKDRTNTF-CGTTEYLAPELLLDETGYTK 483

Query: 447 LSDTWAMGVILYSLLEDRLPF 467
           + D W++GV+++ +     PF
Sbjct: 484 MVDFWSLGVLIFEMCCGWSPF 504

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 91/211 (43%), Gaps = 51/211 (24%)

Query: 277 NSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGD 336
           + L +E  +L  LNHP I+K+F  +     +    LY    + Q+L+P   + SY   GD
Sbjct: 200 SKLDKEAKILMQLNHPNIIKVFKTHT----DKSNNLY----IFQELIPGGDLFSYLAKGD 251

Query: 337 LLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKD 396
            L  +SQ    +          +IL  +KYLH   I+HRDLKL+NILL  P         
Sbjct: 252 CLMPISQTEALV-------FVYQILHALKYLHTKGIVHRDLKLDNILLCTP--------- 295

Query: 397 KDIYYEHSFVEI--ADFGLCKKIE--PDELCTARCGSEDYVSPEILMGVPYDGHLS---- 448
                   F +I  ADFG+ + +      + T   G+ +Y +PE+        + S    
Sbjct: 296 ------EPFTKIVLADFGIARTVTTMKSRMFTV-VGTPEYCAPEVGFKANRKAYHSFFRA 348

Query: 449 ------------DTWAMGVILYSLLEDRLPF 467
                       D W++GVI + +L    PF
Sbjct: 349 ATLEQQGYDSKCDLWSLGVITHIMLTGISPF 379

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 76/319 (23%), Positives = 131/319 (41%), Gaps = 77/319 (24%)

Query: 223 IGVGNFSDVLLYESIDQNDPELLQVAV---KRIRYPQELKDIRNRSANFDELLGRLDNSL 279
           +G G++S V  Y+++D++  +L  + V   K I    ++K +                  
Sbjct: 16  LGHGSYSTV--YKAVDRSTGQLFAIKVCSKKHIISENKVKYV------------------ 55

Query: 280 TREISVLNSL---NHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGD 336
           T E + LN L   NHP I+KL+             LY              ++ +  GG+
Sbjct: 56  TIEKNTLNLLAHGNHPGIIKLYYT-----FHDSENLY-------------FVLDFAPGGE 97

Query: 337 LLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKD 396
           LL  + Q  G  +    +    +++  ++Y+H   ++HRDLK EN+LL            
Sbjct: 98  LLQLL-QTQGRFNEAWTKHFMCQLIDALEYIHGCKVVHRDLKPENLLLS----------- 145

Query: 397 KDIYYEHSFVEIADFGLCKKIEP-DELCTAR--CGSEDYVSPEILMGVPYDGHLSDTWAM 453
                    + I DFG+   +   D L +     G+ +YVSPE+L+        SD WA+
Sbjct: 146 -----SEGKLMITDFGVASNLAATDNLSSTSSFVGTAEYVSPELLLQNK-SNFCSDIWAV 199

Query: 454 GVILYSLLEDRLPFDPLPGASIRQKNRPTA-HRIARFEWKWHKMIEDDSSAKEIVNNTLT 512
           G +LY   +   PF        R +N   A  +I   ++ W  M+    +  ++V+  L 
Sbjct: 200 GCMLYQFTQGTPPF--------RGENELAAFEKIVNLDYHWIYMVSQHIT--DLVSKILV 249

Query: 513 RK-NQRWNCNDIFNSAFIQ 530
              + R+    I N A+ Q
Sbjct: 250 LDPDSRYTLPQIKNHAWFQ 268

>YKL168C (KKQ8) [3102] chr11 complement(131293..133497)
           Serine/threonine protein kinase of unknown function
           [2205 bp, 734 aa]
          Length = 734

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 67/143 (46%), Gaps = 25/143 (17%)

Query: 328 IMSYCVGGDL---LAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILL 384
           +M +C  GDL   L   S+  G L          ++L GVK++H+H I H DLK ENIL 
Sbjct: 522 VMEFCPAGDLYGMLVGKSKLKGRLHPLEADCFMKQLLHGVKFMHDHGIAHCDLKPENIL- 580

Query: 385 KVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEP--DELCTAR---CGSEDYVSPEILM 439
                          +Y H  ++I DFG     +   +    A+    GSE YV+PE  +
Sbjct: 581 ---------------FYPHGLLKICDFGTSSVFQTAWERRVHAQKGIIGSEPYVAPEEFV 625

Query: 440 -GVPYDGHLSDTWAMGVILYSLL 461
            G  YD  L D W+ GV+  +++
Sbjct: 626 DGEYYDPRLIDCWSCGVVYITMI 648

>Scas_668.22
          Length = 893

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 71/142 (50%), Gaps = 20/142 (14%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           +IM Y  GG L   ++ C   L    I  +  E L G+++LH   ++HRD+K +NILL +
Sbjct: 683 VIMEYMEGGSLTDVVTHCI--LTEGQIGAVCRETLSGLQFLHSKGVLHRDIKSDNILLSI 740

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELC-TARCGSEDYVSPEILMGVPYDG 445
             G+I+               + DFG C +I    L  T   G+  +++PE++    Y G
Sbjct: 741 S-GDIK---------------LTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEY-G 783

Query: 446 HLSDTWAMGVILYSLLEDRLPF 467
              D W++G+++  ++E   P+
Sbjct: 784 PKVDIWSLGIMIIEMIEGEPPY 805

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 79/158 (50%), Gaps = 28/158 (17%)

Query: 321 KLVPCN-------LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNII 373
           +++ CN       +++    GGDL   +    G +D  + Q  F +++  + YLH+  + 
Sbjct: 79  RVIDCNVGGEYLWIMLEMADGGDLFDKIEPDVG-VDPDVAQFYFQQLIRALNYLHDVGVA 137

Query: 374 HRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDE----LCTARCGS 429
           HRD+K ENILL    GN++               +ADFGL  +    +    + T + GS
Sbjct: 138 HRDIKPENILLDKK-GNLK---------------LADFGLASQFRRKDGTLRVSTDQRGS 181

Query: 430 EDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
             Y++PEIL    Y  +++D W+ GV+L+ LL   +P+
Sbjct: 182 PPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPW 219

>Kwal_55.21545
          Length = 865

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 94/207 (45%), Gaps = 29/207 (14%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           +IM YC GG L   +    G +    I  +  E+L  + ++H+  +IHRD+K  N+L+  
Sbjct: 93  VIMEYCAGGSLRTLLR--PGKIGEQYIGVIMRELLTALMHIHKDGVIHRDIKAANVLIT- 149

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDEL-CTARCGSEDYVSPEILM-GVPYD 444
                              +++ DFG+  ++   ++      G+  +++PE++M GV YD
Sbjct: 150 ---------------NDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIMEGVYYD 194

Query: 445 GHLSDTWAMGVILYSLLEDRLPFDPLPGASIRQKNRPTAHRIARFEWKWHKMIEDDSSAK 504
             + D W++G+  Y +     P+  +   ++R     T  +  R E + H      S+ K
Sbjct: 195 TKV-DIWSLGITAYEIATGNPPYCEV--EALRAMQLITKSKPPRLEGRQHS-----SALK 246

Query: 505 EIVNNTLTRK-NQRWNCNDIFNSAFIQ 530
           EI+   L     +R +  D+  + FI+
Sbjct: 247 EIIALCLDEDPKERPSAEDLLKTKFIK 273

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 67.4 bits (163), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 120/278 (43%), Gaps = 51/278 (18%)

Query: 216 QWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRL 275
           +++ ++ IG G+F  V           ++L V   ++   +E+K        +  +  + 
Sbjct: 26  EFKVLEEIGRGSFGSV----------RKVLHVPTSKLMVRKEIK--------YGHMNSKE 67

Query: 276 DNSLTREISVLNSLNHPCIVKLFGVNDP-----------------LFIE--SCRPLYDML 316
              L  E ++L  L H  IV+ +  +                   L++E  SC  L  M+
Sbjct: 68  RQQLIAECTILAGLRHENIVEFYNWDHASSRTGNSVDYGNGEVLYLYMEYCSCGDLSQMI 127

Query: 317 KLRQ---KLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEI---LLGVKYLHEH 370
           K  +   K VP   I    V   LL A+ +C  + D   +  ++ +I    +  +     
Sbjct: 128 KHYKGMRKYVPERDIWRIAV--QLLLALYKCHTSCDLPQLDTIYDKISKSAIESEAGKVT 185

Query: 371 NIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPD-ELCTARCGS 429
           ++IHRDLK  NI L       R   D    Y    V++ DFGL K ++   E  T   G+
Sbjct: 186 SVIHRDLKPGNIFLTGDGVGGRGSVD----YSKVEVKLGDFGLAKSLQSAIEFATTYVGT 241

Query: 430 EDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
             Y+SPE+LM  PY   LSD W++G ++Y L   R+PF
Sbjct: 242 PYYMSPEVLMDQPYSP-LSDIWSLGCVIYELCALRVPF 278

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 87/185 (47%), Gaps = 39/185 (21%)

Query: 283 ISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMS 342
           I +L +L H  IVK  G     FI+S   LY             +++ YC+ G L   + 
Sbjct: 65  IDLLKNLKHENIVKYHG-----FIQSSHELY-------------ILLEYCIRGSLRDLIK 106

Query: 343 QCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYE 402
           + +  L     +    + L G++YLH+  +IHRD+K  N+LL                 E
Sbjct: 107 KEA--LSEAKAKTYVRQTLRGLQYLHDQGVIHRDIKAANLLLT----------------E 148

Query: 403 HSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLE 462
           +  V++ADFG+  ++  + +     GS ++++PE+++G      +SD W++G  +  LL 
Sbjct: 149 NGVVKLADFGVSTRV--NNMAMTYAGSPNWMAPEVMLG-KGASTVSDIWSLGATVVELLT 205

Query: 463 DRLPF 467
              PF
Sbjct: 206 GNPPF 210

>Scas_629.16
          Length = 918

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 91/205 (44%), Gaps = 39/205 (19%)

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
           E  +L + NHP +V L               Y   +    L  C   M YC+GG+   A+
Sbjct: 567 EQEILATSNHPFVVTL---------------YHSFQSEDYLYFC---MEYCMGGEFFRAL 608

Query: 342 ----SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDK 397
               ++C    D        +E+   ++YLH    I+RDLK ENILL      + S  D 
Sbjct: 609 QTRRTKCISEDDARFYA---SEVTAALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDL 665

Query: 398 DIYYEHSFVEIADFGLCKKIEPDELCT------ARCGSEDYVSPEILMGVPYDGHLS--D 449
            +  + + V +        +   ++C+      +  G+E+Y++PE++ G   +GH +  D
Sbjct: 666 SVQAKDAKVPVMKGSAESTVVDTKICSDGFRTNSFVGTEEYIAPEVIRG---NGHTAAVD 722

Query: 450 TWAMGVILYSLLEDRLPFDPLPGAS 474
            W +G+++Y +L     F P  G+S
Sbjct: 723 WWTLGILIYEML---FGFTPFKGSS 744

>KLLA0F02838g 264329..266596 some similarities with sp|P32581
           Saccharomyces cerevisiae YJL106w IME2 ser/thr protein
           kinase, hypothetical start
          Length = 755

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 66/124 (53%), Gaps = 8/124 (6%)

Query: 353 IQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLK--DKDIYYEHSFVEIAD 410
           ++ +  +IL G+K++H+H+  HRD+K ENIL+  P     S K  + D Y ++  V++AD
Sbjct: 169 LRSILFQILAGIKHIHDHDFFHRDIKPENILIS-PSHRYFSKKWLEDDNYSDNYVVKLAD 227

Query: 411 FGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPL 470
           +GL + +      T    +  Y SPEIL+   Y     D WA G ++  L      F PL
Sbjct: 228 YGLARHVNNRSPYTTYVSTRWYRSPEILLRKGYYSKPLDIWAYGCVVVELAT----FSPL 283

Query: 471 -PGA 473
            PG+
Sbjct: 284 FPGS 287

>Kwal_33.13112
          Length = 505

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 126/313 (40%), Gaps = 80/313 (25%)

Query: 164 VISLPTVSEETTTENDKFPIHHDGTALADDSNSQEDDIVLMGYRIGEYTKALQWRKVKTI 223
           ++S+   S +T   +DK P+HH     A +  SQ  DI                   + +
Sbjct: 2   IVSITETSHDTLIGSDKEPLHHPPDT-AVEKPSQLYDIK------------------ECV 42

Query: 224 GVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLDNSLTREI 283
           G G+F DV  Y +ID+   E+  VAVK I   +   DI               + L +EI
Sbjct: 43  GKGSFGDV--YRAIDKETGEM--VAVKIINLEETQDDI---------------DVLAQEI 83

Query: 284 SVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG---DLLAA 340
             L+ L  P +   +      ++E               V   ++M +C GG   DLL  
Sbjct: 84  YFLSELRAPFVTTYYKT----YVED--------------VSMWIVMEFCGGGSCADLLKH 125

Query: 341 MSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIY 400
           + +    L    +  +  E+L G++YLH    IHRD+K  NILL                
Sbjct: 126 LPE--HRLPENKVAYIIREVLYGLEYLHSQRKIHRDVKAANILLT--------------- 168

Query: 401 YEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSL 460
            +   V++ DFG+  +I          G+  +++PEI+         +D W++G+    L
Sbjct: 169 -DEGEVKLGDFGVSGQIMATLKRNTFVGTPYWMAPEIIARDNGYDEKADIWSLGITAMEL 227

Query: 461 LEDRLP---FDPL 470
           L  + P   +DP+
Sbjct: 228 LTGQPPYAKYDPM 240

>CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces
           cerevisiae YJL106w IME2 ser/thr protein kinase,
           hypothetical start
          Length = 751

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 6/124 (4%)

Query: 353 IQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNI-RSLKDKDIYYEHSFVEIADF 411
           ++ +  ++L G++++H+ N  HRDLK ENIL+         S  +K  Y ++  V++ADF
Sbjct: 184 LKSILAQVLAGLRHIHDQNFFHRDLKPENILITPSTRYFDSSWLEKGNYPDNYVVKLADF 243

Query: 412 GLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPL- 470
           GL + +E     TA   +  Y SPEIL+   Y     D WA G +   +      F PL 
Sbjct: 244 GLARHVENKNPYTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCVAMEV----TVFKPLF 299

Query: 471 PGAS 474
           PG++
Sbjct: 300 PGSN 303

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 71/142 (50%), Gaps = 20/142 (14%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           ++M Y  GG L   ++ C   L    I  +  E L G+++LH   +IHRD+K +NILL +
Sbjct: 770 VVMEYMEGGSLTDVVTHCI--LTEGQIGAVSRETLKGLQFLHSKGVIHRDIKSDNILLSM 827

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELC-TARCGSEDYVSPEILMGVPYDG 445
             G+I+               + DFG C +I    L  T   G+  +++PE++    Y G
Sbjct: 828 -NGDIK---------------LTDFGFCAQINEVNLKRTTMVGTPYWMAPEVVSRKEY-G 870

Query: 446 HLSDTWAMGVILYSLLEDRLPF 467
              D W++G+++  ++E   P+
Sbjct: 871 PKVDIWSLGIMIIEMIEGEPPY 892

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 94/217 (43%), Gaps = 37/217 (17%)

Query: 263 NRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFI---ESCRPLYDMLKLR 319
           N S    ++L R   SL  E       NH C   L+ V+    I   ++   LYD     
Sbjct: 71  NSSLEKRQMLLRRQRSLISEKVRSRLSNHICFEALYEVDIQSKIGKHKNITELYDYFD-- 128

Query: 320 QKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKL 379
                  +IM YC GGDL  A+   +       +  + ++IL  V+++H   I HRD+K 
Sbjct: 129 -----SYIIMEYCSGGDLYEAIKADTIPRKTRQLTHIISQILDAVEFVHSKGIYHRDIKP 183

Query: 380 ENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTAR-CGSEDYVSPEIL 438
           ENIL          + D +       V++ D+GL      D+    R  GSE Y++PE+ 
Sbjct: 184 ENIL----------IADSNW-----TVKLTDWGLATT---DQTSMDRNVGSERYMAPELF 225

Query: 439 --------MGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
                      PY+    D WA+G++L +++  + PF
Sbjct: 226 ESNLDYDERNEPYECSKVDIWAIGIVLLNIVFHKNPF 262

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 68/145 (46%), Gaps = 21/145 (14%)

Query: 327 LIMSYCVGGDLLAAMSQC---SGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENIL 383
           + M Y  G  L A         G +   ++ ++   +L G+ YLH+  IIHRD+K +NIL
Sbjct: 312 IAMEYMGGRSLDAIYKHLLKHGGRVGEKVLGKIAESVLRGLSYLHQRKIIHRDIKPQNIL 371

Query: 384 LKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPY 443
           L                 E   V++ DFG+  +   + L T   G+  Y++PE + G PY
Sbjct: 372 LN----------------EAGQVKLCDFGVSGEAV-NSLATTFTGTSYYMAPERIQGQPY 414

Query: 444 DGHLSDTWAMGVILYSLLEDRLPFD 468
               SD W++G+ L  + +   PFD
Sbjct: 415 S-VTSDVWSLGLTLLEVAQAHFPFD 438

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 71/141 (50%), Gaps = 18/141 (12%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           L+  Y  GG+L   + Q  G       +    E++L +++LH+++I++RDLK ENILL  
Sbjct: 490 LVTDYMSGGELFWHL-QKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDA 548

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
             GNI                + DFGL K    D   T  CG+ +Y++PE+L+       
Sbjct: 549 N-GNI---------------ALCDFGLSKADLKDRTNTF-CGTTEYLAPELLLDETGYTK 591

Query: 447 LSDTWAMGVILYSLLEDRLPF 467
           + D W++GV+++ +     PF
Sbjct: 592 MVDFWSLGVLIFEMCCGWSPF 612

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 120/266 (45%), Gaps = 55/266 (20%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRY-PQEL---KDIRNRSANFDELL 272
           W K   IG G+F  V  Y  ++ +  EL+  AVK++   P  +    D +    + + ++
Sbjct: 415 WLKGARIGSGSFGSV--YLGMNAHTGELM--AVKQVELEPTTVMASSDDKKSHPSSNAVV 470

Query: 273 GRLDN-------SLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPC 325
            +L +       + + ++++L  L+H  IV  +G +                  Q+    
Sbjct: 471 KKLTDPPQDGGRASSTKMNLLKELHHENIVTYYGSS------------------QEGGNL 512

Query: 326 NLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLK 385
           N+ + Y  GG + ++M    G  +  L++    + L+G+ YLH  NIIHRD+K  N+L+ 
Sbjct: 513 NIFLEYVPGGSV-SSMLNSYGPFEEPLVKNFTRQTLVGLTYLHRKNIIHRDIKGANLLID 571

Query: 386 VPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEP-DELCTARC---GSEDYVSPEILMGV 441
           +                   V+I DFG+ KK+ P ++    R    GS  +++PE++  V
Sbjct: 572 I----------------KGSVKITDFGISKKLSPLNKKQNKRASLQGSVYWMAPEVVKQV 615

Query: 442 PYDGHLSDTWAMGVILYSLLEDRLPF 467
                 +D W++G ++  +   + PF
Sbjct: 616 -VTTEKADIWSVGCVVVEMFTGKHPF 640

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 94/216 (43%), Gaps = 55/216 (25%)

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
           E  +L + NHP IV L               Y   +    L  C   M YC+GG+   A+
Sbjct: 427 EQEILATSNHPFIVTL---------------YHSFQTEDYLYLC---MEYCMGGEFFRAL 468

Query: 342 ----SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIR----- 392
               ++C    D        +E+   ++YLH    I+RDLK ENILL    G+I      
Sbjct: 469 QTRKTKCISEDDARFYS---SEVTAALEYLHLMGFIYRDLKPENILLHQS-GHIMLSDFD 524

Query: 393 -SLKDKDIY-------YEHSFVEIADFGLCKKIEPDELCT-ARCGSEDYVSPEILMGVPY 443
            S++ KD           HS V+        KI  D   T +  G+E+Y++PE++ G   
Sbjct: 525 LSVQAKDTKNPQVKGNASHSLVDT-------KICSDGFRTNSFVGTEEYIAPEVIRG--- 574

Query: 444 DGHLS--DTWAMGVILYSLLEDRLPFDPLPGASIRQ 477
           +GH +  D W +G+++Y +L     F P  G +  Q
Sbjct: 575 NGHTAAVDWWTLGILIYEML---FGFTPFKGDNTNQ 607

>CAGL0H10318g complement(1006299..1007222) highly similar to
           sp|P06242 Saccharomyces cerevisiae YDL108w KIN28
           cyclin-dependent ser/thr protein kinase, hypothetical
           start
          Length = 307

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 114/258 (44%), Gaps = 57/258 (22%)

Query: 216 QWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRL 275
           ++ K K +G G ++  ++Y    Q+     ++AVK I+   E KD              L
Sbjct: 5   EYTKEKKVGEGTYA--VVYVGTKQSTGR--RIAVKEIK-TSEFKD-------------GL 46

Query: 276 DNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG 335
           D S  RE+  L  + H  +++L  +    F+      Y  L L  + +P +L +      
Sbjct: 47  DMSAIREVKYLQEMQHVNVIELVDI----FMS-----YGNLNLVLEYLPTDLEVVIKDKS 97

Query: 336 DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLK 395
            L         ++  W++  +      GV + H + I+HRDLK  N+L+  P G I+   
Sbjct: 98  ILFTP-----ADIKSWMLMSV-----RGVHHCHRNFILHRDLKPNNLLI-APDGQIK--- 143

Query: 396 DKDIYYEHSFVEIADFGLCKKI-EPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMG 454
                       +ADFGL + +  P E+ T+   +  Y +PE+L G  +     D W++G
Sbjct: 144 ------------VADFGLARAVPSPHEVLTSNVVTRWYRAPELLFGAKHYTSAIDVWSLG 191

Query: 455 VILYSLLEDRLPFDPLPG 472
           VI   L+  R+P+  LPG
Sbjct: 192 VIFAELML-RIPY--LPG 206

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 113/268 (42%), Gaps = 64/268 (23%)

Query: 216 QWRKVKTIGVGNFSDVLLYESIDQN----DPEL---LQVAVKRIRYPQELKDIRNRSANF 268
           Q++ ++ +G GNF DV L   +  N    DP++   + +A+K I       ++ + +   
Sbjct: 6   QFQLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAIKCI-------NLEHSNEPI 58

Query: 269 DELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLI 328
           D LL        +EI  L++L+ P I   +G     F   C  LY             ++
Sbjct: 59  DLLL--------KEIYFLSTLHCPYITHYYGT----FTGDCN-LY-------------IV 92

Query: 329 MSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPL 388
           M YC  G LL  +   S  L       +  ++   ++YLHE  +IHRDLK  NILL    
Sbjct: 93  MEYCSNGSLLNLLRYYS-RLTEQTTCFIILQVCHALEYLHEKRLIHRDLKAANILLN--- 148

Query: 389 GNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDEL------CTARCGSEDYVSPEILMGVP 442
                        +   V +AD G+  +++ +             G+  +++PEI+    
Sbjct: 149 -------------DDGEVRLADLGVTGQLKFNSTRHGGKNLNTFVGTPFWMAPEIIKNQS 195

Query: 443 YDGHLSDTWAMGVILYSLLEDRLPFDPL 470
           YDG   D W++G+    LL  + P   L
Sbjct: 196 YDGK-CDIWSLGITTLELLNGKPPMSHL 222

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 85/187 (45%), Gaps = 38/187 (20%)

Query: 282 EISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAM 341
           EI V+    HP IV         FI+S     D+           +IM Y  GG L   +
Sbjct: 665 EILVMKGSKHPNIVN--------FIDSYVLKGDLW----------VIMEYMEGGSLTDVV 706

Query: 342 SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYY 401
           + C   L    I  +  E L G+++LH   ++HRD+K +NILL +  G+I+         
Sbjct: 707 THCI--LTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSME-GDIK--------- 754

Query: 402 EHSFVEIADFGLCKKIEPDELC-TARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSL 460
                 + DFG C +I    L  T   G+  +++PE++    Y G   D W++G+++  +
Sbjct: 755 ------LTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEY-GPKVDIWSLGIMIIEM 807

Query: 461 LEDRLPF 467
           +E   P+
Sbjct: 808 IEGEPPY 814

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 71/141 (50%), Gaps = 18/141 (12%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           L+  Y  GG+L   + Q  G       +    E++L +++LH+++I++RDLK ENILL  
Sbjct: 418 LVTDYMSGGELFWHL-QREGRFTEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDA 476

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGH 446
             GNI                + DFGL K    D   T  CG+ +Y++PE+L+       
Sbjct: 477 N-GNI---------------ALCDFGLSKADLKDRTNTF-CGTTEYLAPELLLDESGYTK 519

Query: 447 LSDTWAMGVILYSLLEDRLPF 467
           + D W++GV+++ +     PF
Sbjct: 520 MVDFWSLGVLIFEMCCGWSPF 540

>Kwal_23.6458
          Length = 868

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 114/261 (43%), Gaps = 49/261 (18%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLD 276
           + K+K +G G+   V L +    N    L++  K                  +E++ R  
Sbjct: 464 FEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSK------------------EEMIKRKK 505

Query: 277 -NSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG 335
              +  E  +L + NHP IV L+        +S   LY             L M YC+GG
Sbjct: 506 IKRILAEQEILATSNHPFIVTLYHS-----FQSEDYLY-------------LCMEYCMGG 547

Query: 336 DLLAAM-SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSL 394
           +   A+ ++ +  +D    +   +E++  ++YLH    I+RDLK ENILL      + S 
Sbjct: 548 EFFRALQTRKTKCIDEDDARFYSSEVVAAIEYLHLMGFIYRDLKPENILLHKSGHIMLSD 607

Query: 395 KDKDIYYEHSFVEIADFGLCKKIEPDELCT------ARCGSEDYVSPEILMGVPYDGHLS 448
            D  +  + +   +        +   ++C+      +  G+E+Y++PE++ G   +GH +
Sbjct: 608 FDLSVQAKDTKNPVVKGSAQSSLLDTKICSDGFRTNSFVGTEEYIAPEVIRG---NGHTA 664

Query: 449 --DTWAMGVILYSLLEDRLPF 467
             D W +G+++Y +L    P+
Sbjct: 665 AVDWWTLGILIYEMLFGFTPY 685

>Kwal_26.8703
          Length = 444

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 82/190 (43%), Gaps = 37/190 (19%)

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
           RE+    S +   IV+ +G+      ES   +Y             + M Y  G  L A 
Sbjct: 203 RELQFNRSCSSEYIVRYYGM---FAEESTSSIY-------------IAMEYMGGKSLDAI 246

Query: 341 MSQC---SGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDK 397
                   G +   ++ ++   +L G+ YL E  IIHRD+K +NILL             
Sbjct: 247 YKHLLERGGRIGEKVLGKIAESVLKGLSYLQERKIIHRDIKPQNILLN------------ 294

Query: 398 DIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVIL 457
               E   V++ DFG+   +  + L T   G+  Y++PE + G PY    SD W++G+ L
Sbjct: 295 ----EAGQVKLCDFGV-SGVAVNSLATTFTGTSFYMAPERIQGQPYS-VTSDVWSLGLTL 348

Query: 458 YSLLEDRLPF 467
             + + + PF
Sbjct: 349 LEVAQGQFPF 358

>Kwal_33.13831
          Length = 700

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 96/220 (43%), Gaps = 53/220 (24%)

Query: 258 LKDIRNRSANFDELLGRLDNSLTREISVLNSLN---------HPCIVKLFGVNDPLFIES 308
           +K+++ +S   DE   +    LT E  + +SL+         HP I+K+           
Sbjct: 428 VKELKPKS---DEAKDKFGTRLTSEFIIGHSLSERETASQKPHPNILKML---------- 474

Query: 309 CRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILL-GVKYL 367
                D+++     +    ++ +C  GDL + +S+ S N    L    F + LL GVKY+
Sbjct: 475 -----DLMQTHDGFIE---VLEFCPSGDLYSLLSRTSKNGLHPLEADCFMKQLLHGVKYM 526

Query: 368 HEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPD-----EL 422
           H+H I H DLK ENIL   P G                ++I DFG     +         
Sbjct: 527 HDHGIAHCDLKPENILFG-PQG---------------VLKICDFGTSCVFQTAWEKQVHF 570

Query: 423 CTARCGSEDYVSPEILMG-VPYDGHLSDTWAMGVILYSLL 461
            T   GSE YV+PE  +    YD  L D+W+ GVI  +++
Sbjct: 571 QTGAVGSEPYVAPEEFIAEREYDPRLVDSWSCGVIYCTMV 610

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 102/236 (43%), Gaps = 55/236 (23%)

Query: 279 LTREISVLNSL---NHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG 335
           +T E + LN L   NHP IVKL+              +D   L         ++ Y  GG
Sbjct: 57  VTIEKNTLNLLARGNHPGIVKLYYT-----------FHDEENLY-------FVLDYASGG 98

Query: 336 DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV--------- 386
           +LL+ + +     D W  +    +++  ++++H   +IHRDLK EN+LL           
Sbjct: 99  ELLSLLHKMGTFTDSWA-KHFAAQLVDTLEFMHARGVIHRDLKPENVLLSKEGILMITDF 157

Query: 387 -PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDE----LCTARCGSEDYVSPEILMGV 441
                  +  DKD    +     A+ G+ K   P       C++  G+ +YVSPE+L+  
Sbjct: 158 GAAATQNNFSDKDNTRSN-----ANEGIPKDDVPSSGDKTECSSFVGTAEYVSPELLL-- 210

Query: 442 PYD--GHLSDTWAMGVILYSLLEDRLPFDPLPGASIRQKNR-PTAHRIARFEWKWH 494
            Y+     SD WA+G ++Y  ++   PF        R +N   T  +I   ++ W+
Sbjct: 211 -YNKCSFGSDIWALGCMVYQFIQGFPPF--------RGENELKTFEKIVSLDYSWN 257

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 94/230 (40%), Gaps = 67/230 (29%)

Query: 273 GRLDN-SLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSY 331
           G+ +N  + REI+++   +H  +VKL  V D L     R +Y             L++ Y
Sbjct: 189 GKTENDKIKREIAIMKKCHHKHVVKLIEVLDDL---KSRKIY-------------LVLEY 232

Query: 332 CVGG-------DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILL 384
           C  G       D L   ++    L     + +   ++LG++YLH   IIHRD+K  N+LL
Sbjct: 233 CSRGEVKWCPPDCLETEAKGPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLL 292

Query: 385 KVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEP----------DELCTAR-CGSEDYV 433
                            E   V+I+DFG+                DEL  A+  G+  + 
Sbjct: 293 S----------------ETGIVKISDFGVSLAASSSNVDGSDETIDELELAKTAGTPAFF 336

Query: 434 SPEILMGVP------------YDGHL----SDTWAMGVILYSLLEDRLPF 467
           +PEI +G              + G       D WA+GV LY L+   LPF
Sbjct: 337 APEICLGEDAFEKYQLDREELFKGSCISFKIDIWALGVTLYCLVFGMLPF 386

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 93/199 (46%), Gaps = 39/199 (19%)

Query: 275 LDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVG 334
           LD S  RE+  L  L H  +++L  V    F+ +     D L L  + +P +L     + 
Sbjct: 50  LDMSALREVKFLQELKHVNVIELVDV----FMAN-----DNLNLVLEFLPADL---EIII 97

Query: 335 GDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSL 394
            D   ++     ++  W++       L GV + H + I+HRDLK  N+LL  P G ++  
Sbjct: 98  KD--TSIMFSPADIKSWILM-----TLRGVHHCHRNFILHRDLKPNNLLL-APDGQLK-- 147

Query: 395 KDKDIYYEHSFVEIADFGLCKKI-EPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAM 453
                        IADFGL + +  P E+ T+   +  Y +PE+L G  +     D W++
Sbjct: 148 -------------IADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSV 194

Query: 454 GVILYSLLEDRLPFDPLPG 472
           GVI   L+  R+P+  LPG
Sbjct: 195 GVIFAELML-RIPY--LPG 210

>Scas_653.25
          Length = 666

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 76/152 (50%), Gaps = 17/152 (11%)

Query: 328 IMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVP 387
           IM +C        MS+ +  L R      F ++  GV+YLH   I HRDLKL+N +  + 
Sbjct: 348 IMEWCPHDFFNIVMSR-THLLTRRETFCYFKQLCNGVRYLHTLGIAHRDLKLDNCV--IT 404

Query: 388 LGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPD-ELCTAR--CGSEDYVSPEILMG--VP 442
              I  L D        F     F L K  E   EL  +R   GS+ Y++PE+L+   +P
Sbjct: 405 YNGILKLID--------FGSATIFQLNKSTEEKPELIPSRGIVGSDPYLAPEVLLSKEIP 456

Query: 443 YDGHLSDTWAMGVILYSLLEDRLPFDPLPGAS 474
           YD  L+D W++G+I  +++  R P+  +P AS
Sbjct: 457 YDASLADVWSLGIIFCAIMLKRFPWR-IPLAS 487

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 69/148 (46%), Gaps = 24/148 (16%)

Query: 327 LIMSYCVGGDLLAAMSQCSGN------LDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLE 380
           ++M Y  GG L   +    G+      +    I  +  E   G+K+LH+ +IIHRD+K +
Sbjct: 589 VVMEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSD 648

Query: 381 NILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTAR-CGSEDYVSPEILM 439
           N+LL                  H  V+I DFG C K+       A   G+  +++PE++ 
Sbjct: 649 NVLLDT----------------HGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVK 692

Query: 440 GVPYDGHLSDTWAMGVILYSLLEDRLPF 467
              YD  + D W++G++   +LE   P+
Sbjct: 693 QREYDEKV-DVWSLGIMTIEMLEGEPPY 719

>Scas_598.6
          Length = 790

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 72/154 (46%), Gaps = 27/154 (17%)

Query: 327 LIMSYCVGGDLL------AAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLE 380
           ++M +  GG L        A    S  L    I  +  E   G+K+LH+ +IIHRD+K +
Sbjct: 586 VVMEFMEGGSLTDIIENSPATGSSSSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSD 645

Query: 381 NILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTAR-CGSEDYVSPEILM 439
           N+LL     N R             V+I DFG C K+       A   G+  +++PE++ 
Sbjct: 646 NVLLD---NNAR-------------VKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVK 689

Query: 440 GVPYDGHLSDTWAMGVILYSLLEDRLPF---DPL 470
              YD  + D W++G++   +LE   P+   DPL
Sbjct: 690 QREYDEKV-DVWSLGIMTIEMLESEPPYLNEDPL 722

>Scas_640.16
          Length = 505

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 67/144 (46%), Gaps = 21/144 (14%)

Query: 327 LIMSYCVGGDLLAAMSQC---SGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENIL 383
           + M Y  G  L A         G +   ++ ++   +L G+ YLHE  +IHRD+K +NIL
Sbjct: 286 IAMEYMGGKSLEAVYKNLLSRGGRISEKVLGKISESVLRGLSYLHEQKVIHRDIKPQNIL 345

Query: 384 LKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPY 443
                           + E   V++ DFG+  +   + L T   G+  Y++PE + G PY
Sbjct: 346 ----------------FNEKGQVKLCDFGVSGEAV-NSLATTFTGTSFYMAPERIQGQPY 388

Query: 444 DGHLSDTWAMGVILYSLLEDRLPF 467
                D W++G+ +  + + R PF
Sbjct: 389 SV-TCDIWSLGLTILEVAQGRFPF 411

>Kwal_47.17263
          Length = 1127

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 92/221 (41%), Gaps = 64/221 (28%)

Query: 279 LTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG--- 335
           + REI+++   +H  +VKL  V D     + R +Y             L++ YC  G   
Sbjct: 158 IKREIAIMKKCHHEHVVKLVEVLDD---STSRKIY-------------LVLEYCSKGEVK 201

Query: 336 ----DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNI 391
               D L   ++    L     + +F  ++LG++YLH   IIHRD+K  N+L+       
Sbjct: 202 WCPGDQLETEARGPPLLTFQRAREIFRGVVLGLEYLHYQGIIHRDIKPANLLIS------ 255

Query: 392 RSLKDKDIYYEHSFVEIADFGLCKKIEP--------DELCTAR-CGSEDYVSPEILMG-- 440
                     E   V+I+DFG+              DEL  A+  G+  + +PEI +G  
Sbjct: 256 ----------ESGTVKISDFGVSFAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHE 305

Query: 441 --------VPYDGHLS------DTWAMGVILYSLLEDRLPF 467
                    P   H S      D WA+GV L+ LL   LPF
Sbjct: 306 ASERFAPDRPSSDHGSIISYNIDIWAIGVTLHCLLFGMLPF 346

>Kwal_23.5290
          Length = 819

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 71/154 (46%), Gaps = 27/154 (17%)

Query: 327 LIMSYCVGGDLLAAMSQCSGN------LDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLE 380
           ++M Y  GG L   +     N      L    I  +  E   G+K+LH+ +IIHRD+K +
Sbjct: 615 VVMEYMEGGSLTDLIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSD 674

Query: 381 NILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTAR-CGSEDYVSPEILM 439
           N+LL                   + V+I DFG C K+       A   G+  +++PE++ 
Sbjct: 675 NVLLD----------------NRARVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVK 718

Query: 440 GVPYDGHLSDTWAMGVILYSLLEDRLPF---DPL 470
              YD  + D W++G++   +LE   P+   DPL
Sbjct: 719 QREYDEKV-DVWSLGIMTIEMLEGEPPYLNEDPL 751

>CAGL0F03311g complement(327599..330736) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 1045

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 76/172 (44%), Gaps = 33/172 (19%)

Query: 305 FIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGV 364
           F E+   LYD            +IM YC GGDL  A+           I  + T+IL  +
Sbjct: 135 FHENIVQLYDFFD-------SYIIMEYCSGGDLYEAIKDDLVPKKTKEITHILTQILDAI 187

Query: 365 KYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCT 424
           +++H   I HRD+K ENIL       I SL D  I       ++ D+GL      DE   
Sbjct: 188 EFVHNKQIYHRDIKPENIL-------ITSLIDWKI-------KLTDWGLATT---DEKSY 230

Query: 425 AR-CGSEDYVSPEILMG--------VPYDGHLSDTWAMGVILYSLLEDRLPF 467
            R  GSE Y+ PE+            PYD    D W++G++  +++  + PF
Sbjct: 231 DRNVGSERYMPPELFESNLDIDERKEPYDCSKVDLWSIGIVFLNVVFYKNPF 282

>Kwal_26.7861
          Length = 955

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 70/142 (49%), Gaps = 20/142 (14%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           ++M Y  GG L   ++ C   L    I  +  E L G+++LH   +IHRD+K +N+LL +
Sbjct: 739 VVMEYMEGGSLTDVVTHCI--LTEGQIGAVSRETLKGLQFLHSKGVIHRDIKSDNVLLSM 796

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELC-TARCGSEDYVSPEILMGVPYDG 445
             G I+               + DFG C +I    L  T   G+  +++PE++    Y G
Sbjct: 797 S-GEIK---------------LTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEY-G 839

Query: 446 HLSDTWAMGVILYSLLEDRLPF 467
              D W++G+++  ++E   P+
Sbjct: 840 PKVDIWSLGIMIIEMIEGEPPY 861

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 115/264 (43%), Gaps = 58/264 (21%)

Query: 217 WRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGR-- 274
           + K++ +G G+   V L    D N    L+V  K                   E++ R  
Sbjct: 324 FEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNKH------------------EMIKRKK 365

Query: 275 LDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVG 334
           +   LT E  +L + +HP IV L               Y   + +  L  C   M YC+G
Sbjct: 366 IKRVLT-EQEILATSDHPFIVTL---------------YHSFQTKDYLYLC---MEYCMG 406

Query: 335 GDLLAAM----SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGN 390
           G+   A+    S+C    D        +E++  ++YLH    I+RDLK ENILL    G+
Sbjct: 407 GEFFRALQTRKSKCIAEEDAKFYA---SEVVAALEYLHLLGFIYRDLKPENILLHQS-GH 462

Query: 391 IRSLKDKDIYYEHSFVEIADFG----LCKKIEPDELCT-ARCGSEDYVSPEILMGVPYDG 445
           +  L D D+  + +  +         L  KI  D   T +  G+E+Y++PE++ G   +G
Sbjct: 463 VM-LSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVIRG---NG 518

Query: 446 HLS--DTWAMGVILYSLLEDRLPF 467
           H +  D W +G+++Y +L    PF
Sbjct: 519 HTAAVDWWTLGILIYEMLFGCTPF 542

>Scas_717.69
          Length = 674

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 67/137 (48%), Gaps = 18/137 (13%)

Query: 332 CVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNI 391
           C+ G  L    Q  G  +    +    E+L  ++ LH  ++I+RDLK ENILL       
Sbjct: 424 CINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLD------ 477

Query: 392 RSLKDKDIYYEHSFVEIADFGLCKKIEPDELCT-ARCGSEDYVSPEILMGVPYDGHLSDT 450
                   Y  H  + + DFGLCK    D+  T   CG+ +Y++PE+L+   Y   + D 
Sbjct: 478 --------YQGH--IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY-SKVVDW 526

Query: 451 WAMGVILYSLLEDRLPF 467
           W +G++LY +L    P+
Sbjct: 527 WTLGILLYEMLTGLPPY 543

>Scas_643.20
          Length = 1082

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 63/125 (50%), Gaps = 17/125 (13%)

Query: 343  QCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYE 402
            +   N+  +  + +F +++ G+K+LH+  I+HRD+K EN+++                  
Sbjct: 923  ELKKNMTEYEEKLIFKQVVSGLKHLHDQGIVHRDIKDENVIVD----------------S 966

Query: 403  HSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLE 462
               V++ D+G     +         G+ DY +PE+L G  YDG   D WA+G++LY+++ 
Sbjct: 967  KGHVKLIDYGSAAYTKSGPF-DVFVGTIDYAAPEVLGGSVYDGKPQDIWAIGILLYTIIF 1025

Query: 463  DRLPF 467
               PF
Sbjct: 1026 KENPF 1030

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 69/143 (48%), Gaps = 21/143 (14%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           +IM YC GG L   +    G ++   I  +  EIL+ +  +H  N+IHRD+K  NIL+  
Sbjct: 90  VIMEYCAGGSLRTLLR--PGIIEEKYIGVIMREILVALISIHRDNVIHRDIKAANILIA- 146

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELC-TARCGSEDYVSPEILM-GVPYD 444
                           +  V++ DFG+  ++    L      G+  +++PE++M GV YD
Sbjct: 147 ---------------NNGSVKLCDFGVAAQLSQSMLKRQTMAGTPYWMAPEVIMEGVYYD 191

Query: 445 GHLSDTWAMGVILYSLLEDRLPF 467
             + D W++G+  Y +     P+
Sbjct: 192 TKV-DIWSLGITAYEIATGNPPY 213

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 69/150 (46%), Gaps = 28/150 (18%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
           +IM YC GGDL  A+           +  +  +IL  V+Y+H   I HRD+K ENIL+  
Sbjct: 140 IIMEYCSGGDLYEAIKDDMVPRKTKNVTNIINQILDAVEYVHSRGIYHRDIKPENILI-- 197

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTAR-CGSEDYVSPEILMGV---- 441
             GN               +++ D+GL      D+    R  GSE Y++PE+        
Sbjct: 198 -AGNWN-------------IKLTDWGLATT---DKTSMERNVGSERYMAPELFESNLDRE 240

Query: 442 ----PYDGHLSDTWAMGVILYSLLEDRLPF 467
                YD    D WA+G+++ +++  + PF
Sbjct: 241 ERTDAYDCAKVDIWAIGIVMLNIVFHKNPF 270

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 70/153 (45%), Gaps = 30/153 (19%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
            ++ Y   GD L+ + +  G L+         +I+  +  +H H IIHRD+K ENILL  
Sbjct: 195 FLLEYAPNGDFLSLIKKF-GTLNEECTIYYSAQIIDAIGSMHSHGIIHRDIKPENILLD- 252

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDE------------LCTARCGSEDYVS 434
             GN++             +++ DFG  K ++                 ++  G+ +YVS
Sbjct: 253 --GNMK-------------IKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSFVGTAEYVS 297

Query: 435 PEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           PE+L    Y  +  D WA G ++Y ++  + PF
Sbjct: 298 PELLSD-NYTDYKCDIWAFGCLVYQMIAGKPPF 329

>Scas_684.28
          Length = 620

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 83/179 (46%), Gaps = 30/179 (16%)

Query: 312 LYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRL---FTEILL-GVKYL 367
           L+D  + +  +V   LI   C   DL   +   +G LD   +QR    FT  L+   ++L
Sbjct: 135 LFDFFETQDSIV---LITQLCQKDDLYELIIN-NGKLD---LQRQVIPFTACLISAFQFL 187

Query: 368 HEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYE---HSFVEIADFGLCKKIEP--DEL 422
           H H I+HRD+K EN+L ++     +S    D  Y+   H  + +ADFGL  +++   D  
Sbjct: 188 HSHGIVHRDIKAENVLFRLNKNKSQSNNTVDTKYDLMAHDLI-LADFGLAVQLDAATDNA 246

Query: 423 CTARCGSEDYVSPEI-------------LMGVPYDGHLSDTWAMGVILYSLLEDRLPFD 468
                G+  Y++PEI             L  +   G   D WA+GV++Y +     PFD
Sbjct: 247 LKEYVGTISYIAPEIVKCKGVGSFTRDELTNLKKYGCPVDIWALGVLVYFMAFGYTPFD 305

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 62/123 (50%), Gaps = 18/123 (14%)

Query: 346 GNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSF 405
           G +   ++ ++   +L G+ YLHE  IIHRD+K +NIL                + E   
Sbjct: 276 GRIGEKVLGKIAESVLRGLFYLHERKIIHRDIKPQNIL----------------FNEIGQ 319

Query: 406 VEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRL 465
           +++ DFG+  +   + L T   G+  Y++PE + G PY    SD W++G+ L  + +   
Sbjct: 320 IKLCDFGVSGEAV-NSLATTFTGTSYYMAPERIQGQPYS-VTSDVWSLGLTLLEVAQGHS 377

Query: 466 PFD 468
           PFD
Sbjct: 378 PFD 380

>Scas_673.20*
          Length = 758

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 113/253 (44%), Gaps = 58/253 (22%)

Query: 216 QWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRL 275
           ++RK+K IG G    V     I  +    + VA+K+I       D++        +  RL
Sbjct: 480 RYRKLKRIGEGASGIVYTAYEIGTD----ISVAIKQI-------DLK--------IQPRL 520

Query: 276 DNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGG 335
               T E+ VL    HP I+         FI S   L+D L +         +M Y  GG
Sbjct: 521 QMIWT-EMLVLKEYQHPNIIN--------FINSYL-LHDTLWI---------VMEYMDGG 561

Query: 336 DLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLK 395
            L   +S  +   ++  +  +  E L G+ +LH   I+HRD+K +NILL +  G+I+   
Sbjct: 562 SLADIVSFFTPTEEQ--MATICRETLFGLNFLHSRGIVHRDIKSDNILLSMN-GDIK--- 615

Query: 396 DKDIYYEHSFVEIADFGLCKKI-EPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMG 454
                       I DFG C ++ E +   T   G+  +++PE++    Y G   D W++G
Sbjct: 616 ------------ITDFGFCGQLTESNTKRTTMVGTPYWMAPEVIASKEY-GPKVDVWSLG 662

Query: 455 VILYSLLEDRLPF 467
           +++  ++E   P+
Sbjct: 663 IMIIEMIEGEPPY 675

>Scas_651.19
          Length = 801

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 66/143 (46%), Gaps = 25/143 (17%)

Query: 328 IMSYCVGGDLLAAMSQCSGN---LDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILL 384
           +M +C  GDL + +++ S N   L          ++L GVKY+H+H + H DLK ENIL 
Sbjct: 590 VMEFCPSGDLYSLLTRKSKNGTALHPLEADCFMKQLLHGVKYMHDHGVAHCDLKPENIL- 648

Query: 385 KVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPD-----ELCTARCGSEDYVSP-EIL 438
                          ++    ++I DFG     +          +   GSE YV+P E +
Sbjct: 649 ---------------FHPDGLLKICDFGTSCVFQTAWEKHVHFQSGAMGSEPYVAPEEFI 693

Query: 439 MGVPYDGHLSDTWAMGVILYSLL 461
            G  YD  L D W+ GV+  +++
Sbjct: 694 SGKEYDPRLVDCWSCGVVYCTMV 716

>YLR248W (RCK2) [3644] chr12 (634254..636086)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) [1833 bp, 610 aa]
          Length = 610

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 94/199 (47%), Gaps = 36/199 (18%)

Query: 327 LIMSYCVGGDLLAA---MSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENIL 383
           +I     GG++      ++  S +L R +I++L     L VK++H   ++HRD+K EN+L
Sbjct: 265 IIQELLTGGEIFGEIVRLTYFSEDLSRHVIKQL----ALAVKHMHSLGVVHRDIKPENLL 320

Query: 384 LKVPLGNIRSLK-------------DKDIY------YEHSFVEIADFGLCKKIEPDELCT 424
            + P+   RS+K             D+ I+           V++ADFGL K+I      T
Sbjct: 321 FE-PIEFTRSIKPKLRKSDDPQTKADEGIFTPGVGGGGIGIVKLADFGLSKQIFSKNTKT 379

Query: 425 ARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLPGASIRQKNRPTAH 484
             CG+  Y +PE++    Y   + D W +G +LY++L    PF         +K      
Sbjct: 380 P-CGTVGYTAPEVVKDEHYSMKV-DMWGIGCVLYTMLCGFPPF-------YDEKIDTLTE 430

Query: 485 RIARFEWKWHKMIEDDSSA 503
           +I+R E+ + K   D+ SA
Sbjct: 431 KISRGEYTFLKPWWDEISA 449

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 76/162 (46%), Gaps = 27/162 (16%)

Query: 327 LIMSYCVGGDLLAAM---SQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENIL 383
           +I     GG++   +   +  S +L R +I++L       VKY+H+  I+HRD+K EN+L
Sbjct: 220 IIQELLAGGEIFGEIVKYTYFSEDLSRHVIRQLAN----AVKYMHQLGIVHRDIKPENLL 275

Query: 384 LKV------PLGNIRSLKDKDIYYEHS------------FVEIADFGLCKKIEPDELCTA 425
            +       P   +RS  D     +               V++ADFGL K+I      T 
Sbjct: 276 FEPIDFIPNPKPKLRSSDDPSTKLDEGVFRPGIGGGGIGVVKLADFGLSKQIYQTNTKTP 335

Query: 426 RCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
            CG+  Y +PE++    Y   + D W +G +LY++L    PF
Sbjct: 336 -CGTVGYTAPEVVKDERYSMQV-DMWGVGCVLYTVLCGFPPF 375

>AGR334W [4645] [Homologous to ScYMR291W - SH]
           complement(1354612..1356207) [1596 bp, 531 aa]
          Length = 531

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 80/174 (45%), Gaps = 26/174 (14%)

Query: 312 LYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILL-GVKYLHEH 370
           L+D  + +  +V   L+   C   DL   +   SG+LD     + +   LL  + +LH+ 
Sbjct: 126 LFDYFETKDNIV---LVTQLCEQSDLYDCIIN-SGSLDIDTQVKPYVACLLSALDFLHQS 181

Query: 371 NIIHRDLKLENILLKVPLGNIRSLKDKDIYYE---HSFVEIADFGLCKKIEPDELCTARC 427
            +IHRD+K ENIL ++      ++   D  Y+   H  + IADFGL    E         
Sbjct: 182 GVIHRDIKAENILFRLR----ETVPSTDAKYDVRAHDLI-IADFGLAVGKEDRSSLKEYV 236

Query: 428 GSEDYVSPEILMG-------------VPYDGHLSDTWAMGVILYSLLEDRLPFD 468
           G+  Y++PE++               +P  G   D WA+GV+ Y ++   +PFD
Sbjct: 237 GTLSYLAPELVRCKDMKTMTPAEAERIPEYGAAVDIWALGVLCYFMMSGYMPFD 290

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 82/350 (23%), Positives = 136/350 (38%), Gaps = 75/350 (21%)

Query: 207 RIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPEL-LQVAVKRIRYPQELKDIRNRS 265
           R+GE+    Q      +G G F  VL+ E    +     L  AVK IR  +E        
Sbjct: 138 RVGEWEITPQ-----VVGSGTFGQVLVAERKSAHSKHRPLNYAVKVIRMKRE-------- 184

Query: 266 ANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPC 325
                       +L +E S+L  LNH   ++  G    L     R   +++K+    V  
Sbjct: 185 ------------ALAKEASILVRLNHVSGIETTGEEHVL----TRGQPNVIKVHDTFVDE 228

Query: 326 N----LIMSYCVGGDLLAAMSQ--CSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKL 379
           N    +      GGDL + +++  C   +       +  +IL  +K+LH   I+HRDLKL
Sbjct: 229 NDNIYIFEDLVAGGDLFSYLAKKDCLAPISETEALVIVYQILQALKFLHSKGIVHRDLKL 288

Query: 380 ENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDEL-CTARCGSEDYVSPEIL 438
           +NILL  P    R             + +ADFG+ K +    +      G+ +Y +PE+ 
Sbjct: 289 DNILLCTPEPCSR-------------IVLADFGIAKDLPSTRVRMHTIVGTPEYCAPEVG 335

Query: 439 MGVPYDGHLS----------------DTWAMGVILYSLLEDRLPF--DPLPGASIRQKNR 480
             V  + + +                D W++GV+ + +L    PF  D    + IR    
Sbjct: 336 FRVDRNSYRNFSRTASMEQQGYDFKCDLWSLGVMTHIMLTGISPFYGDGTEASIIRNV-- 393

Query: 481 PTAHRIARFEWKWHKMIEDDSSAKEIVNNTL-TRKNQRWNCNDIFNSAFI 529
               +I +  +   + +    +AK  V   L     +R +  D F   +I
Sbjct: 394 ----KIGKLNFGTKQWVGVSDTAKSFVRQLLEVNAEKRMSVQDCFKHPWI 439

>KLLA0C07535g 658746..660620 some similarities with sgd|S0005793
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 624

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 114/281 (40%), Gaps = 57/281 (20%)

Query: 189 ALADDSNSQEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVA 248
           +L++ +N   DD +L   + G+  K L        G G    VL+  S    D  +  V 
Sbjct: 197 SLSNKTNIYHDDSIL-AQKYGKLGKVL------GSGAGGSVKVLVRPS----DGAMFAVK 245

Query: 249 VKRIRYPQE-LKDIRNRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIE 307
             R R P E ++D   +               T E  V + L+HP I++   +    F +
Sbjct: 246 QFRSRKPNEPIRDYARK--------------CTSEFCVGSMLHHPNIIETLDI----FSD 287

Query: 308 SCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYL 367
           + +  Y              +M YC   D  A +   SG + R  I   F +++  V YL
Sbjct: 288 AKQTQYYQ------------VMEYCPV-DFFAVV--MSGEMSRGEINCCFKQLVEAVNYL 332

Query: 368 HEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARC 427
           H     HRDLKL+N ++      I  L D    + + +    D  L   I          
Sbjct: 333 HSKGYAHRDLKLDNCVMTKE--GILKLIDFGSAFVYKYTYENDTKLAHGI---------V 381

Query: 428 GSEDYVSPEILMGV-PYDGHLSDTWAMGVILYSLLEDRLPF 467
           GS+ Y++PE+L+    YD  + D W+MG+I   ++  R P+
Sbjct: 382 GSDPYLAPEVLVHSNGYDAPMVDIWSMGIIFCCMMLKRFPW 422

>KLLA0E11979g complement(1060048..1061892) some similarities with
           sp|P25333 Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, hypothetical
           start
          Length = 614

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 78/196 (39%), Gaps = 39/196 (19%)

Query: 274 RLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCV 333
           +    LT E  + +SL H  I++   +      + C                  +M YC 
Sbjct: 376 KYSKRLTSEFCISSSLKHTNIIETLDLFQDAKGDYCE-----------------VMEYCS 418

Query: 334 GGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRS 393
           GGDL   +   +G L+         +++ GV Y+H   + HRDLK EN+LL         
Sbjct: 419 GGDLFTLII-AAGKLEYQEADCFLKQLITGVVYMHNMGVCHRDLKPENLLLT-------- 469

Query: 394 LKDKDIYYEHSFVEIADFG--LCKKIEPDE---LCTARCGSEDYVSPEILMGVPYDGHLS 448
                       ++I DFG   C ++  ++   L    CGS  Y++PE      +D    
Sbjct: 470 --------HDGTLKITDFGNSECFRMAWEKEIHLSGGVCGSGPYIAPEEYTQEEFDPRAV 521

Query: 449 DTWAMGVILYSLLEDR 464
           D WA GVI  ++   R
Sbjct: 522 DIWACGVIYMAMRTGR 537

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 70/155 (45%), Gaps = 32/155 (20%)

Query: 327 LIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKV 386
            ++ Y   GD L  + +  G+L+    +   ++I+  V  LH   IIHRD+K ENILL  
Sbjct: 201 FLLEYAPHGDFLGLIKKY-GSLNETCARYYASQIIDAVDSLHNIGIIHRDIKPENILL-- 257

Query: 387 PLGNIRSLKDKDIYYEHSFVEIADFGLCKKI--EPDELCTAR------------CGSEDY 432
                    DK++      V++ DFG  K +  EP      +             G+ +Y
Sbjct: 258 ---------DKNMK-----VKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEY 303

Query: 433 VSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPF 467
           VSPE L+   Y     D WA G ILY +L  + PF
Sbjct: 304 VSPE-LLNDNYTDSRCDIWAFGCILYQMLAGKPPF 337

>Scas_721.110
          Length = 520

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 82/192 (42%), Gaps = 46/192 (23%)

Query: 281 REISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVGGDLLAA 340
           REI +L + +HP I  L  +     +ES + +Y             +I  Y    DL   
Sbjct: 231 REIKLLQTFHHPNIATLVEI----MVESSKMVY-------------MIFEYA-DNDLTGL 272

Query: 341 MSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIY 400
           +   +  +     + LF ++L GVKYLH+  I+HRD+K  NIL+    GN++        
Sbjct: 273 LGDKNVVMSLGQRKHLFQQLLRGVKYLHDSLILHRDIKGSNILIDNK-GNLK-------- 323

Query: 401 YEHSFVEIADFGLCKKIEPDELCTARCGSEDYVS---------PEILMGVPYDGHLSDTW 451
                  I DFGL +K+    + +   GS DY +         PE+LMG        D W
Sbjct: 324 -------ITDFGLARKM---HVKSDSDGSNDYTNRVITLWYRPPELLMGTTNYSTEVDMW 373

Query: 452 AMGVILYSLLED 463
             G IL  L  +
Sbjct: 374 GCGCILMELFNN 385

>Scas_692.24
          Length = 718

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 95/216 (43%), Gaps = 43/216 (19%)

Query: 258 LKDIRNRSANFDELLGRLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLK 317
           +K+ R R  N  E +       T E  + ++L+HP +++   +    F +S +  Y    
Sbjct: 242 VKEFRPRKPN--ESVKEYAKKCTAEFCIGSTLHHPNVIETVDI----FSDSKQNKY---- 291

Query: 318 LRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDL 377
                     +M YC   D  A +   +G + R  I     ++L GVKYLH   + HRDL
Sbjct: 292 --------FEVMQYC-PVDFFAVV--MTGKMSRGEINCCLKQLLEGVKYLHSMGLAHRDL 340

Query: 378 KLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFG---LCKKIEPDELCTAR--CGSEDY 432
           KL+N ++                 E   +++ DFG   + +    D++  A    GS+ Y
Sbjct: 341 KLDNCVMN----------------EDGILKLIDFGSAVVFRYPYEDDIAMAHGIVGSDPY 384

Query: 433 VSPEILMGV-PYDGHLSDTWAMGVILYSLLEDRLPF 467
           ++PE++     YD    D W++G+I   ++  R P+
Sbjct: 385 LAPEVITSTKSYDPQCVDIWSVGIIYCCMMLKRFPW 420

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,731,335
Number of extensions: 873865
Number of successful extensions: 4387
Number of sequences better than 10.0: 669
Number of HSP's gapped: 3574
Number of HSP's successfully gapped: 710
Length of query: 530
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 424
Effective length of database: 12,926,601
Effective search space: 5480878824
Effective search space used: 5480878824
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)