Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K11528g35434917020.0
YKL114C (APN1)36732513280.0
Scas_721.13335935412941e-180
Kwal_26.768536032712561e-174
KLLA0C14256g36832511601e-159
ABL054C35931711211e-153
Scas_720.3098256681.9
Scas_712.3486145672.6
KLLA0C15169g54992653.9
CAGL0D01518g29726644.7
CAGL0K09834g132055655.3
CAGL0A04829g486134645.9
CAGL0M10395g166556646.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K11528g
         (349 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K11528g 1116427..1117491 highly similar to sp|P22936 Saccha...   660   0.0  
YKL114C (APN1) [3149] chr11 complement(222998..224101) AP endonu...   516   0.0  
Scas_721.133                                                          503   e-180
Kwal_26.7685                                                          488   e-174
KLLA0C14256g 1239373..1240479 similar to sp|P22936 Saccharomyces...   451   e-159
ABL054C [538] [Homologous to ScYKL114C (APN1) - SH] (297682..298...   436   e-153
Scas_720.30                                                            31   1.9  
Scas_712.3                                                             30   2.6  
KLLA0C15169g 1320694..1322343 similar to sgd|S0002643 Saccharomy...    30   3.9  
CAGL0D01518g complement(164750..165643) similar to tr|Q99344 Sac...    29   4.7  
CAGL0K09834g complement(960064..964026) similar to sp|P53935 Sac...    30   5.3  
CAGL0A04829g complement(466099..467559) highly similar to sp|P04...    29   5.9  
CAGL0M10395g 1038860..1043857 no similarity, hypothetical start        29   6.1  

>CAGL0K11528g 1116427..1117491 highly similar to sp|P22936
           Saccharomyces cerevisiae YKL114c APN1 AP endonuclease,
           hypothetical start
          Length = 354

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/349 (92%), Positives = 323/349 (92%)

Query: 1   MSTFARSTVSKYKFGAHMSGAGGISNSVTNAFNAGCNSFAMFLKSPRKWVSPAFTQEEIA 60
           MSTFARSTVSKYKFGAHMSGAGGISNSVTNAFNAGCNSFAMFLKSPRKWVSPAFTQEEIA
Sbjct: 1   MSTFARSTVSKYKFGAHMSGAGGISNSVTNAFNAGCNSFAMFLKSPRKWVSPAFTQEEIA 60

Query: 61  KFKENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQLGVGLYNFH 120
           KFKENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQLGVGLYNFH
Sbjct: 61  KFKENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQLGVGLYNFH 120

Query: 121 PGSTLKGDHDEQLKQLASYINKALGETKFVKIVLENMAGTGNLVGSDLTDLRKVIDMVTD 180
           PGSTLKGDHDEQLKQLASYINKALGETKFVKIVLENMAGTGNLVGSDLTDLRKVIDMVTD
Sbjct: 121 PGSTLKGDHDEQLKQLASYINKALGETKFVKIVLENMAGTGNLVGSDLTDLRKVIDMVTD 180

Query: 181 KSRIGVCIDTCHTFAAGYDIQSXXXXXXXXXXXXXIIGYKYLASVHLNDSKAPLGANRDL 240
           KSRIGVCIDTCHTFAAGYDIQS             IIGYKYLASVHLNDSKAPLGANRDL
Sbjct: 181 KSRIGVCIDTCHTFAAGYDIQSKDAFDKFWKDFDDIIGYKYLASVHLNDSKAPLGANRDL 240

Query: 241 HEKLGEGYLGLDFFRNLAHYDHLKGIPIVLETPQPDDAGYAKEVKLLEWLETIEDGDTDK 300
           HEKLGEGYLGLDFFRNLAHYDHLKGIPIVLETPQPDDAGYAKEVKLLEWLETIEDGDTDK
Sbjct: 241 HEKLGEGYLGLDFFRNLAHYDHLKGIPIVLETPQPDDAGYAKEVKLLEWLETIEDGDTDK 300

Query: 301 LKEMEAKNEELQKLGEKSRKEQMSKFEXXXXXXXXXXXXXGAADITAQL 349
           LKEMEAKNEELQKLGEKSRKEQMSKFE             GAADITAQL
Sbjct: 301 LKEMEAKNEELQKLGEKSRKEQMSKFEKKKTTTTKKRKATGAADITAQL 349

>YKL114C (APN1) [3149] chr11 complement(222998..224101) AP
           endonuclease, DNA (apurinic or apyrimidinic site) lyase
           (3'-repair diesterase) [1104 bp, 367 aa]
          Length = 367

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/325 (74%), Positives = 274/325 (84%)

Query: 3   TFARSTVSKYKFGAHMSGAGGISNSVTNAFNAGCNSFAMFLKSPRKWVSPAFTQEEIAKF 62
           +F RS VSKYKFGAHMSGAGGISNSVTNAFN GCNSFAMFLKSPRKWVSP +TQEEI KF
Sbjct: 6   SFVRSAVSKYKFGAHMSGAGGISNSVTNAFNTGCNSFAMFLKSPRKWVSPQYTQEEIDKF 65

Query: 63  KENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQLGVGLYNFHPG 122
           K+NC  Y YNPLTD+LPHGQYFINLANPD EKAEKSYESF+DDL RCEQLG+GLYN HPG
Sbjct: 66  KKNCATYNYNPLTDVLPHGQYFINLANPDREKAEKSYESFMDDLNRCEQLGIGLYNLHPG 125

Query: 123 STLKGDHDEQLKQLASYINKALGETKFVKIVLENMAGTGNLVGSDLTDLRKVIDMVTDKS 182
           STLKGDH  QLKQLASY+NKA+ ETKFVKIVLENMAGTGNLVGS L DL++VI M+ DKS
Sbjct: 126 STLKGDHQLQLKQLASYLNKAIKETKFVKIVLENMAGTGNLVGSSLVDLKEVIGMIEDKS 185

Query: 183 RIGVCIDTCHTFAAGYDIQSXXXXXXXXXXXXXIIGYKYLASVHLNDSKAPLGANRDLHE 242
           RIGVCIDTCHTFAAGYDI +             +IG+KYL++VHLNDSKAPLGANRDLHE
Sbjct: 186 RIGVCIDTCHTFAAGYDISTTETFNNFWKEFNDVIGFKYLSAVHLNDSKAPLGANRDLHE 245

Query: 243 KLGEGYLGLDFFRNLAHYDHLKGIPIVLETPQPDDAGYAKEVKLLEWLETIEDGDTDKLK 302
           +LG+GYLG+D FR +AH ++L+GIPIVLETP  +D GY  E+KL+EWLE+  + +  + K
Sbjct: 246 RLGQGYLGIDVFRMIAHSEYLQGIPIVLETPYENDEGYGNEIKLMEWLESKSESELLEDK 305

Query: 303 EMEAKNEELQKLGEKSRKEQMSKFE 327
           E + KN+ LQKLG KSRKEQ+ KFE
Sbjct: 306 EYKEKNDTLQKLGAKSRKEQLDKFE 330

>Scas_721.133
          Length = 359

 Score =  503 bits (1294), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 242/354 (68%), Positives = 278/354 (78%), Gaps = 8/354 (2%)

Query: 1   MSTFARSTVSKYKFGAHMSGAGGISNSVTNAFNAGCNSFAMFLKSPRKWVSPAFTQEEIA 60
           MS F RST SKYKFGAHMSGAGGISNSV NA N GCN+FAMFLKSPRKWVSPAFT+EEIA
Sbjct: 1   MSKFIRSTTSKYKFGAHMSGAGGISNSVLNAHNTGCNAFAMFLKSPRKWVSPAFTKEEIA 60

Query: 61  KFKENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQLGVGLYNFH 120
           KF +NCEK+ YNPLTDILPHG Y INLANPD EK +KSYESF+DDL RCE LG+GLYNFH
Sbjct: 61  KFNDNCEKFNYNPLTDILPHGHYLINLANPDLEKVDKSYESFLDDLKRCESLGIGLYNFH 120

Query: 121 PGSTLKGDHDEQLKQLASYINKALGETKFVKIVLENMAGTGNLVGSDLTDLRKVIDMVTD 180
           PGS LKGD   QLKQLA ++N+A+ ETKFVKI+LENMAGTGNLVGS+L DL  VI+MV D
Sbjct: 121 PGSVLKGDRQVQLKQLAQFLNRAIKETKFVKILLENMAGTGNLVGSNLKDLHDVIEMVED 180

Query: 181 KSRIGVCIDTCHTFAAGYDIQSXXXXXXXXXXXXXIIGYKYLASVHLNDSKAPLGANRDL 240
           K+RIGVC+DTCHTFAAGYDI +             IIG KYL ++HLNDSKAPLGANRDL
Sbjct: 181 KTRIGVCVDTCHTFAAGYDISNQESFDKFWKDFDSIIGLKYLHAMHLNDSKAPLGANRDL 240

Query: 241 HEKLGEGYLGLDFFRNLAHYDHLKGIPIVLETPQPDDAGYAKEVKLLEWLETIEDGDTDK 300
           HEKLGEG+LGL+ FR +AH DHL+GIPI+LETPQPD+ GY  E+KLLEWLE++E+ +   
Sbjct: 241 HEKLGEGFLGLEVFRIIAHADHLRGIPIILETPQPDEEGYGHEIKLLEWLESVENPED-- 298

Query: 301 LKEMEAKNEELQKLGEKSRKEQMSKFEXXXXXXX-----XXXXXXGAADITAQL 349
            +E+  K+EE Q+LG KSRKEQ+SK+E                    ADI AQL
Sbjct: 299 -QELITKSEEKQQLGSKSRKEQLSKWEIKQKKATKVPRKRKTASSEGADIAAQL 351

>Kwal_26.7685
          Length = 360

 Score =  488 bits (1256), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 233/327 (71%), Positives = 268/327 (81%), Gaps = 2/327 (0%)

Query: 1   MSTFARSTVSKYKFGAHMSGAGGISNSVTNAFNAGCNSFAMFLKSPRKWVSPAFTQEEIA 60
           MS F R + SKYKFGAH+S AGGISNSVTNAFN GCN+FAMFLKSPRKWVSP ++QEEI 
Sbjct: 1   MSQFTRCSSSKYKFGAHISTAGGISNSVTNAFNIGCNAFAMFLKSPRKWVSPDYSQEEIE 60

Query: 61  KFKENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQLGVGLYNFH 120
           KFKENC++ GYNPLTD+LPHGQYFINLANP+ EKAEKSY SFIDDL RCEQLGVGLYNFH
Sbjct: 61  KFKENCKELGYNPLTDVLPHGQYFINLANPEHEKAEKSYASFIDDLRRCEQLGVGLYNFH 120

Query: 121 PGSTLKGDHDEQLKQLASYINKALGETKFVKIVLENMAGTGNLVGSDLTDLRKVIDMVTD 180
           PGS+LK DH  QL+QLASYINKA+ ET FVKIVLENMAGTG LVGS+L+DL++VID+V D
Sbjct: 121 PGSSLKADHPTQLRQLASYINKAISETSFVKIVLENMAGTGTLVGSELSDLKEVIDLVDD 180

Query: 181 KSRIGVCIDTCHTFAAGYDIQSXXXXXXXXXXXXXIIGYKYLASVHLNDSKAPLGANRDL 240
           KSR+GVCIDTCHTFAAGYDI S              IG+KYLA++HLNDSKAPL ANRDL
Sbjct: 181 KSRVGVCIDTCHTFAAGYDISSKEAFDKFWQLFDETIGFKYLAAIHLNDSKAPLAANRDL 240

Query: 241 HEKLGEGYLGLDFFRNLAHYDHLKGIPIVLETPQPDDAGYAKEVKLLEWLETIEDGDTDK 300
           HEKLGEG++GL+ F+ +A  D LKGIPI+LETP   D GY  E+KLLEWLE  ++ DTD 
Sbjct: 241 HEKLGEGFIGLEIFKLVAQSDFLKGIPIILETPHTKDEGYGHEIKLLEWLENFKE-DTD- 298

Query: 301 LKEMEAKNEELQKLGEKSRKEQMSKFE 327
           L E E+K ++L   G KSR EQ +KF+
Sbjct: 299 LAEFESKAQDLLSKGAKSRDEQAAKFD 325

>KLLA0C14256g 1239373..1240479 similar to sp|P22936 Saccharomyces
           cerevisiae YKL114c APN1 AP endonuclease singleton, start
           by similarity
          Length = 368

 Score =  451 bits (1160), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 214/325 (65%), Positives = 256/325 (78%), Gaps = 3/325 (0%)

Query: 3   TFARSTVSKYKFGAHMSGAGGISNSVTNAFNAGCNSFAMFLKSPRKWVSPAFTQEEIAKF 62
           +F RST SK+KFGAH+SGAGGISNSVTNA   GCNSFAMFLKSPR+W S  + + EI KF
Sbjct: 15  SFVRSTTSKFKFGAHVSGAGGISNSVTNAHEIGCNSFAMFLKSPRQWNSKPYPESEITKF 74

Query: 63  KENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQLGVGLYNFHPG 122
            ENC K  Y+P TDILPHG YFINL NPD EKAEK+Y++F+DDL RCEQLG+G YNFHPG
Sbjct: 75  NENCAKLSYDPKTDILPHGSYFINLGNPDHEKAEKAYDAFLDDLVRCEQLGIGHYNFHPG 134

Query: 123 STLKGDHDEQLKQLASYINKALGETKFVKIVLENMAGTGNLVGSDLTDLRKVIDMVTDKS 182
           S+L GDHD QLKQLA YINKA+ +TKFV IVLENMAG GNL+GS+L DL+ VIDM+ DK+
Sbjct: 135 SSLDGDHDTQLKQLAGYINKAINDTKFVNIVLENMAGHGNLIGSNLEDLKTVIDMIEDKN 194

Query: 183 RIGVCIDTCHTFAAGYDIQSXXXXXXXXXXXXXIIGYKYLASVHLNDSKAPLGANRDLHE 242
           R+GVC+DTCHT+AAGYDI +             IIG+KYL ++HLNDSKAPL AN D HE
Sbjct: 195 RVGVCVDTCHTYAAGYDISTKNAFDQFWKKFDAIIGFKYLKAIHLNDSKAPLAANADRHE 254

Query: 243 KLGEGYLGLDFFRNLAHYDHLKGIPIVLETPQPDDAGYAKEVKLLEWLETIEDGDTDKLK 302
            LG+G+LGL+ F+ +AH + L+GIPIVLETPQ +DAGY +E+KLLEWLETI   D ++ K
Sbjct: 255 ILGQGFLGLEVFKIIAHSEFLQGIPIVLETPQKEDAGYGEEIKLLEWLETI---DEEENK 311

Query: 303 EMEAKNEELQKLGEKSRKEQMSKFE 327
           +   K   L KLGEKSRKE  +KF+
Sbjct: 312 DYIEKRLALNKLGEKSRKEFQAKFD 336

>ABL054C [538] [Homologous to ScYKL114C (APN1) - SH]
           (297682..298761) [1080 bp, 359 aa]
          Length = 359

 Score =  436 bits (1121), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 202/317 (63%), Positives = 249/317 (78%), Gaps = 1/317 (0%)

Query: 4   FARSTVSKYKFGAHMSGAGGISNSVTNAFNAGCNSFAMFLKSPRKWVSPAFTQEEIAKFK 63
           F R T S+YKFGAH+SGAGGISNSV NA   GCN+FAMFLKSP++WVS A++ EEI +F 
Sbjct: 3   FVRCTASRYKFGAHVSGAGGISNSVVNAHRIGCNAFAMFLKSPKQWVSKAYSAEEIKRFH 62

Query: 64  ENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQLGVGLYNFHPGS 123
           +NCE+ GYNP TD+LPHG YFINLANPD EKAEK+Y +F+DDL RCEQLG+GLYNFHPGS
Sbjct: 63  DNCEELGYNPRTDVLPHGLYFINLANPDREKAEKAYGAFLDDLQRCEQLGIGLYNFHPGS 122

Query: 124 TLKGDHDEQLKQLASYINKALGETKFVKIVLENMAGTGNLVGSDLTDLRKVIDMVTDKSR 183
            LKG++D QL+QLA YIN+A+ ETKFVKIVLENMAG GN++GS L DLR VID+V  K R
Sbjct: 123 ALKGEYDAQLRQLAMYINRAISETKFVKIVLENMAGHGNIIGSKLEDLRTVIDLVEQKDR 182

Query: 184 IGVCIDTCHTFAAGYDIQSXXXXXXXXXXXXXIIGYKYLASVHLNDSKAPLGANRDLHEK 243
           +GVC+DTCHTFAAGYDI+S              +G +YLAS+H+NDSKAPL AN D HE 
Sbjct: 183 VGVCVDTCHTFAAGYDIRSRAAFDSFWDKFRTTLGMQYLASMHINDSKAPLAANADRHEL 242

Query: 244 LGEGYLGLDFFRNLAHYDHLKGIPIVLETPQPDDAGYAKEVKLLEWLETIEDGDTDKLKE 303
           LG+G+LGL+ FR +A  D L+ IPI+LETPQ +D GY +E+K+LEWLE ++D +    +E
Sbjct: 243 LGQGFLGLEAFRLIARSDFLQNIPIILETPQKEDDGYGEEIKMLEWLEGVDD-EAALQQE 301

Query: 304 MEAKNEELQKLGEKSRK 320
            + K  ELQ+ G KSR+
Sbjct: 302 YKDKCAELQQRGAKSRQ 318

>Scas_720.30
          Length = 982

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 50  VSPAFTQEEIAKFKENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDD 105
           + P  T + + +F EN  K G N L DIL  G+ FIN    + E  E  Y + + D
Sbjct: 795 LEPTTTMDVLLQFYEN--KNGKNKLDDILKVGEVFINYIQFENELFEGKYANLLID 848

>Scas_712.3
          Length = 486

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 57/145 (39%), Gaps = 11/145 (7%)

Query: 65  NCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQLGVGLYNFHPGST 124
           NCE   ++    +LP  +Y + +    P   +++YE         E + + L ++H    
Sbjct: 267 NCEYGSFDNENAVLPRTKYDLQIDAESPRPNQQAYEKMSSGYYLGEVIRLVLVDYHKQGL 326

Query: 125 LKGDHDEQLKQLASYINKALGETKFVKIVLENMAGTGNLVGSDL-----TDLRKVIDMVT 179
           +  D D   K    YI       +  +   EN+  T  L+  +L        RK+I  + 
Sbjct: 327 IFKDQDVT-KLNTPYIMDTSFPARVEEDPFENLENTDELLQKELGINATVQERKLIRRLC 385

Query: 180 D-----KSRIGVCIDTCHTFAAGYD 199
           +      +R+GVC  +      GY+
Sbjct: 386 ELVGLRAARLGVCAISAICQKRGYE 410

>KLLA0C15169g 1320694..1322343 similar to sgd|S0002643 Saccharomyces
           cerevisiae YDR235w PRP42 U1 snRNP associated protein,
           required for pre-mRNA splicing, start by similarity
          Length = 549

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 46/92 (50%), Gaps = 13/92 (14%)

Query: 234 LGANRDLHEK--LGEGYLGLDFFRNLAHYDHLKGIPIVLETPQPDDAGYAK--EVKLLE- 288
           + +++ L +K    E Y+GL FF     + +L  I +  +TPQ       K  E+ L E 
Sbjct: 120 MPSDKQLFQKYAFAESYIGLHFFGAEFWHMYLNEIKLRCKTPQHYIRTLRKVIEIPLYEY 179

Query: 289 ------WLETIED-GDTDKLKEMEAKNEELQK 313
                 WL+TIED  D  +L+   A+++EL K
Sbjct: 180 SSFYDLWLQTIEDVKDLSQLR-FYAEDKELWK 210

>CAGL0D01518g complement(164750..165643) similar to tr|Q99344
           Saccharomyces cerevisiae YPR066w UBA3 ubiquitin-like
           protein activating enzyme, start by similarity
          Length = 297

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 244 LGEGYLGLDFFRNLAHYDHLKGIPIV 269
           LG G LG +  +NLA YD++  I +V
Sbjct: 8   LGAGGLGCELLKNLARYDYVSEIHVV 33

>CAGL0K09834g complement(960064..964026) similar to sp|P53935
           Saccharomyces cerevisiae YNL091w, start by similarity
          Length = 1320

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 57  EEIAKFKENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQ 111
           EE  ++    EKY Y+       HG+    +A+ D +  ++ YES IDD+ R E+
Sbjct: 566 EENLQYDTPQEKYNYSD------HGKDHGTIADEDEDSIDEGYESSIDDMERLEE 614

>CAGL0A04829g complement(466099..467559) highly similar to sp|P04807
           Saccharomyces cerevisiae YGL253w HXK2 or sp|P04806
           Saccharomyces cerevisiae YFR053c HXK1, start by
           similarity
          Length = 486

 Score = 29.3 bits (64), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 57/134 (42%), Gaps = 13/134 (9%)

Query: 65  NCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQLGVGLYNFH-PGS 123
           NCE   ++    +LP  +Y + +    P   ++++E         E L + L + +  G 
Sbjct: 267 NCEYGSFDNEHVVLPRNKYDLIIDEESPRPGQQAFEKMSSGYYLGEMLRLALLDLYDQGL 326

Query: 124 TLKGDHDEQLKQLASYINKALGETKFVKIVLENMAGTGNLVGSDL---------TDLRKV 174
            LKG    +LK+   Y+      +K      EN+  T  L+  +L           +R++
Sbjct: 327 ILKGQDISKLKK--PYVMDTSYPSKIEDDPFENLEDTDELLQKNLGIQTTVQERKLIRRL 384

Query: 175 IDMV-TDKSRIGVC 187
            +++ T  +R+ VC
Sbjct: 385 CELIGTRSARLSVC 398

>CAGL0M10395g 1038860..1043857 no similarity, hypothetical start
          Length = 1665

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 7/56 (12%)

Query: 17  HMSGAGGISNSVTNAFNAGCN-----SFAMFLKSPRKWVSPAFTQEEIAKFKENCE 67
           + +G  G+ N++T+ FN  CN     +F +  K P +   P+FT  EI   KEN E
Sbjct: 718 NANGNIGLGNAITSIFNETCNKLSSMTFPVLFKKPLQ-DEPSFTISEIDD-KENRE 771

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,247,608
Number of extensions: 511400
Number of successful extensions: 1760
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1789
Number of HSP's successfully gapped: 25
Length of query: 349
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 246
Effective length of database: 13,030,455
Effective search space: 3205491930
Effective search space used: 3205491930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)